F474654
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 240 | 1356 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300025904|Ga0207647_10000445|Ga0207647_1000044510 |
| Length | 249 |
| Sequence | MLSTNYLKKCSPHVGPLFVPLSDYDFYWDLWFDCRRMYDWLLAVARWLEVNVIGLPVYLAAPAMIVIGALDSSLLSLPEINDYLVVGRCFKQPSAVFYFPLFAAAGSVLGCLLLYTIVRRGGQAVLRKRFNLEHIKRVEKAYERFGFLAIGLPAILPPPLPFKIFVATAGALEYPRWKFLLTVMIARSLRYYVEGILAVYYGRRVLIFIRDNGIVVVSIVATLVLIGLLIYFLFKRRRNATVQTERTPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 186 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 201 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 203 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 204 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 208 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 211 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 212 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 221 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 222 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 223 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 224 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 226 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 229 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 230 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 231 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.51 |
| Rhizosphere | 97.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 36.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207647_10000445 | 3300025904 | Bacteria | 33611 |
| 2 | SwRhRL3b_contig_2005254 | 2162886006 | Bacteria | 1717 |
| 3 | SwRhRL2b_contig_73591 | 2162886007 | Unclassified | 2554 |
| 4 | MBSR1b_contig_1246515 | 2162886012 | Unclassified | 1104 |
| 5 | MBSR1b_contig_5388315 | 2162886012 | Bacteria | 1270 |
| 6 | CNAas_1000674 | 3300000532 | Bacteria | 3273 |
| 7 | JGI24751J29686_10000023 | 3300002459 | Bacteria | 97529 |
| 8 | JGI25406J46586_10035896 | 3300003203 | Unclassified | 1804 |
| 9 | Ga0065704_10106120 | 3300005289 | Unclassified | 2092 |
| 10 | Ga0065712_10025915 | 3300005290 | Bacteria | 1416 |
| 11 | Ga0065712_10075521 | 3300005290 | Bacteria | 3844 |
| 12 | Ga0065712_10095014 | 3300005290 | Bacteria | 2231 |
| 13 | Ga0065712_10141247 | 3300005290 | Unclassified | 1448 |
| 14 | Ga0065715_10006188 | 3300005293 | Bacteria | 4953 |
| 15 | Ga0065715_10092412 | 3300005293 | Bacteria | 5139 |
| 16 | Ga0065715_10094282 | 3300005293 | Bacteria | 4343 |
| 17 | Ga0065715_10095606 | 3300005293 | Bacteria | 4046 |
| 18 | Ga0065715_10103948 | 3300005293 | Bacteria | 2996 |
| 19 | Ga0065715_10296685 | 3300005293 | Bacteria | 1051 |
| 20 | Ga0065707_10002957 | 3300005295 | Bacteria | 4680 |
| 21 | Ga0065707_10092486 | 3300005295 | Bacteria | 3763 |
| 22 | Ga0070676_10027009 | 3300005328 | Bacteria | 3253 |
| 23 | Ga0070676_10098041 | 3300005328 | Bacteria | 1806 |
| 24 | Ga0070690_100004875 | 3300005330 | Bacteria | 7501 |
| 25 | Ga0070690_100064231 | 3300005330 | Bacteria | 2370 |
| 26 | Ga0070670_100000324 | 3300005331 | Bacteria | 40556 |
| 27 | Ga0070670_100000490 | 3300005331 | Bacteria | 31622 |
| 28 | Ga0070670_100214788 | 3300005331 | Bacteria | 1673 |
| 29 | Ga0070670_100224232 | 3300005331 | Unclassified | 1635 |
| 30 | Ga0068869_100017058 | 3300005334 | Bacteria | 4913 |
| 31 | Ga0068869_100107052 | 3300005334 | Bacteria | 2122 |
| 32 | Ga0068869_100308894 | 3300005334 | Bacteria | 1279 |
| 33 | Ga0068869_100732993 | 3300005334 | Bacteria | 845 |
| 34 | Ga0068869_100845142 | 3300005334 | Unclassified | 789 |
| 35 | Ga0070666_10033159 | 3300005335 | Bacteria | 3415 |
| 36 | Ga0070680_100001584 | 3300005336 | Bacteria | 16608 |
| 37 | Ga0070680_100032700 | 3300005336 | Bacteria | 4188 |
| 38 | Ga0070682_100001581 | 3300005337 | Bacteria | 12686 |
| 39 | Ga0070682_100051608 | 3300005337 | Viruses | 2571 |
| 40 | Ga0068868_100027093 | 3300005338 | Bacteria | 4370 |
| 41 | Ga0070689_100011673 | 3300005340 | Bacteria | 6301 |
| 42 | Ga0070689_100027432 | 3300005340 | Unclassified | 4293 |
| 43 | Ga0070689_100169852 | 3300005340 | Bacteria | 1767 |
| 44 | Ga0070689_100559466 | 3300005340 | Unclassified | 986 |
| 45 | Ga0070689_100588125 | 3300005340 | Unclassified | 963 |
| 46 | Ga0070689_100650018 | 3300005340 | Bacteria | 917 |
| 47 | Ga0070689_100883170 | 3300005340 | Bacteria | 790 |
| 48 | Ga0070687_100036292 | 3300005343 | Unclassified | 2455 |
| 49 | Ga0070687_100056576 | 3300005343 | Unclassified | 2053 |
| 50 | Ga0070661_100267239 | 3300005344 | Bacteria | 1324 |
| 51 | Ga0070692_10011404 | 3300005345 | Bacteria | 4079 |
| 52 | Ga0070692_10079332 | 3300005345 | Unclassified | 1764 |
| 53 | Ga0070692_10101772 | 3300005345 | Bacteria | 1576 |
| 54 | Ga0070692_10148708 | 3300005345 | Unclassified | 1332 |
| 55 | Ga0070669_100000309 | 3300005353 | Bacteria | 38458 |
| 56 | Ga0070669_100595859 | 3300005353 | Unclassified | 925 |
| 57 | Ga0070675_100198983 | 3300005354 | Unclassified | 1738 |
| 58 | Ga0070671_100041883 | 3300005355 | Bacteria | 3806 |
| 59 | Ga0070671_100042966 | 3300005355 | Unclassified | 3759 |
| 60 | Ga0070671_100072433 | 3300005355 | Bacteria | 2877 |
| 61 | Ga0070671_100647371 | 3300005355 | Unclassified | 915 |
| 62 | Ga0070674_100183072 | 3300005356 | Unclassified | 1606 |
| 63 | Ga0070673_100017320 | 3300005364 | Bacteria | 5119 |
| 64 | Ga0070673_100021714 | 3300005364 | Bacteria | 4661 |
| 65 | Ga0070673_100029620 | 3300005364 | Bacteria | 4085 |
| 66 | Ga0070673_100459762 | 3300005364 | Bacteria | 1146 |
| 67 | Ga0070688_100108691 | 3300005365 | Unclassified | 1840 |
| 68 | Ga0070659_100044040 | 3300005366 | Bacteria | 3492 |
| 69 | Ga0070667_100056268 | 3300005367 | Bacteria | 3323 |
| 70 | Ga0070703_10022153 | 3300005406 | Bacteria | 1863 |
| 71 | Ga0070709_10531450 | 3300005434 | Bacteria | 897 |
| 72 | Ga0070701_10190439 | 3300005438 | Bacteria | 1206 |
| 73 | Ga0070705_100039910 | 3300005440 | Bacteria | 2667 |
| 74 | Ga0070705_100077595 | 3300005440 | Bacteria | 2029 |
| 75 | Ga0070705_100171452 | 3300005440 | Bacteria | 1461 |
| 76 | Ga0070705_100318900 | 3300005440 | Bacteria | 1121 |
| 77 | Ga0070700_100000042 | 3300005441 | Bacteria | 99515 |
| 78 | Ga0070700_100005045 | 3300005441 | Bacteria | 6964 |
| 79 | Ga0070700_100007847 | 3300005441 | Bacteria | 5788 |
| 80 | Ga0070700_100026835 | 3300005441 | Unclassified | 3407 |
| 81 | Ga0070700_100093467 | 3300005441 | Bacteria | 1967 |
| 82 | Ga0070700_100298275 | 3300005441 | Unclassified | 1175 |
| 83 | Ga0070700_100528719 | 3300005441 | Bacteria | 912 |
| 84 | Ga0070700_100727528 | 3300005441 | Bacteria | 792 |
| 85 | Ga0070694_100005424 | 3300005444 | Bacteria | 7721 |
| 86 | Ga0070694_100007222 | 3300005444 | Bacteria | 6765 |
| 87 | Ga0070694_100028474 | 3300005444 | Bacteria | 3636 |
| 88 | Ga0070694_100031665 | 3300005444 | Unclassified | 3468 |
| 89 | Ga0070694_100074036 | 3300005444 | Viruses | 2353 |
| 90 | Ga0070694_100101200 | 3300005444 | Unclassified | 2039 |
| 91 | Ga0070694_100110161 | 3300005444 | Bacteria | 1961 |
| 92 | Ga0070694_100111463 | 3300005444 | Unclassified | 1950 |
| 93 | Ga0070694_100228948 | 3300005444 | Bacteria | 1398 |
| 94 | Ga0070694_100255741 | 3300005444 | Unclassified | 1327 |
| 95 | Ga0070708_100000158 | 3300005445 | Bacteria | 47837 |
| 96 | Ga0070708_100438193 | 3300005445 | Bacteria | 1232 |
| 97 | Ga0070678_100054393 | 3300005456 | Unclassified | 2917 |
| 98 | Ga0070678_100156902 | 3300005456 | Bacteria | 1839 |
| 99 | Ga0070681_10000354 | 3300005458 | Bacteria | 36996 |
| 100 | Ga0070681_10004835 | 3300005458 | Bacteria | 12910 |
| 101 | Ga0070681_10012618 | 3300005458 | Bacteria | 8383 |
| 102 | Ga0068867_100003348 | 3300005459 | Bacteria | 11289 |
| 103 | Ga0068867_100255602 | 3300005459 | Bacteria | 1426 |
| 104 | Ga0068867_100557473 | 3300005459 | Unclassified | 993 |
| 105 | Ga0070685_10010231 | 3300005466 | Bacteria | 4869 |
| 106 | Ga0070685_10640199 | 3300005466 | Bacteria | 769 |
| 107 | Ga0070706_100000480 | 3300005467 | Bacteria | 47075 |
| 108 | Ga0070706_100004115 | 3300005467 | Bacteria | 14151 |
| 109 | Ga0070707_100113119 | 3300005468 | Bacteria | 2634 |
| 110 | Ga0070707_100314363 | 3300005468 | Unclassified | 1522 |
| 111 | Ga0070698_100004618 | 3300005471 | Bacteria | 15130 |
| 112 | Ga0070698_100045289 | 3300005471 | Bacteria | 4503 |
| 113 | Ga0070698_100056643 | 3300005471 | Bacteria | 3971 |
| 114 | Ga0070699_100002826 | 3300005518 | Bacteria | 15494 |
| 115 | Ga0070699_100004781 | 3300005518 | Bacteria | 11971 |
| 116 | Ga0070699_100013038 | 3300005518 | Bacteria | 7163 |
| 117 | Ga0070699_100326881 | 3300005518 | Unclassified | 1379 |
| 118 | Ga0070699_100357588 | 3300005518 | Unclassified | 1316 |
| 119 | Ga0070679_100001229 | 3300005530 | Bacteria | 22504 |
| 120 | Ga0070679_100688722 | 3300005530 | Unclassified | 965 |
| 121 | Ga0070684_100091258 | 3300005535 | Unclassified | 2710 |
| 122 | Ga0070697_100002092 | 3300005536 | Bacteria | 15271 |
| 123 | Ga0070697_100080183 | 3300005536 | Unclassified | 2688 |
| 124 | Ga0070697_100110433 | 3300005536 | Bacteria | 2291 |
| 125 | Ga0070697_100388219 | 3300005536 | Unclassified | 1210 |
| 126 | Ga0068853_100011334 | 3300005539 | Bacteria | 7240 |
| 127 | Ga0068853_100123255 | 3300005539 | Bacteria | 2314 |
| 128 | Ga0068853_101207163 | 3300005539 | Unclassified | 730 |
| 129 | Ga0070672_100025282 | 3300005543 | Unclassified | 4401 |
| 130 | Ga0070672_100607158 | 3300005543 | Bacteria | 953 |
| 131 | Ga0070686_100011993 | 3300005544 | Unclassified | 4928 |
| 132 | Ga0070686_100018677 | 3300005544 | Bacteria | 4075 |
| 133 | Ga0070686_100114266 | 3300005544 | Bacteria | 1844 |
| 134 | Ga0070695_100033398 | 3300005545 | Bacteria | 3219 |
| 135 | Ga0070695_100067556 | 3300005545 | Bacteria | 2332 |
| 136 | Ga0070695_100076471 | 3300005545 | Unclassified | 2205 |
| 137 | Ga0070695_100210946 | 3300005545 | Unclassified | 1394 |
| 138 | Ga0070695_100494704 | 3300005545 | Bacteria | 945 |
| 139 | Ga0070696_100009805 | 3300005546 | Bacteria | 6406 |
| 140 | Ga0070696_100041644 | 3300005546 | Bacteria | 3173 |
| 141 | Ga0070696_100094391 | 3300005546 | Unclassified | 2135 |
| 142 | Ga0070696_100177957 | 3300005546 | Bacteria | 1576 |
| 143 | Ga0070696_100299963 | 3300005546 | Bacteria | 1230 |
| 144 | Ga0070696_100725144 | 3300005546 | Unclassified | 812 |
| 145 | Ga0070693_100029631 | 3300005547 | Unclassified | 2987 |
| 146 | Ga0070693_100075741 | 3300005547 | Unclassified | 1993 |
| 147 | Ga0070693_100090220 | 3300005547 | Unclassified | 1846 |
| 148 | Ga0070693_100162405 | 3300005547 | Unclassified | 1424 |
| 149 | Ga0070665_101113058 | 3300005548 | Unclassified | 801 |
| 150 | Ga0070704_100083174 | 3300005549 | Bacteria | 2362 |
| 151 | Ga0070704_100093011 | 3300005549 | Bacteria | 2252 |
| 152 | Ga0070704_100117092 | 3300005549 | Unclassified | 2039 |
| 153 | Ga0070704_100153014 | 3300005549 | Unclassified | 1816 |
| 154 | Ga0070704_100175571 | 3300005549 | Unclassified | 1708 |
| 155 | Ga0070704_100549706 | 3300005549 | Unclassified | 1009 |
| 156 | Ga0070704_100903498 | 3300005549 | Unclassified | 794 |
| 157 | Ga0068855_100361977 | 3300005563 | Unclassified | 1596 |
| 158 | Ga0068857_100002908 | 3300005577 | Bacteria | 14112 |
| 159 | Ga0068854_100375177 | 3300005578 | Bacteria | 1171 |
| 160 | Ga0068854_100386911 | 3300005578 | Unclassified | 1154 |
| 161 | Ga0068856_100005175 | 3300005614 | Bacteria | 12877 |
| 162 | Ga0068856_100644322 | 3300005614 | Unclassified | 1080 |
| 163 | Ga0070702_100024935 | 3300005615 | Bacteria | 3198 |
| 164 | Ga0070702_100178485 | 3300005615 | Bacteria | 1388 |
| 165 | Ga0070702_100211514 | 3300005615 | Bacteria | 1291 |
| 166 | Ga0070702_100265323 | 3300005615 | Bacteria | 1171 |
| 167 | Ga0068852_100058329 | 3300005616 | Bacteria | 3343 |
| 168 | Ga0068852_100395108 | 3300005616 | Bacteria | 1359 |
| 169 | Ga0068852_100711441 | 3300005616 | Unclassified | 1015 |
| 170 | Ga0068859_100047427 | 3300005617 | Bacteria | 4316 |
| 171 | Ga0068859_100067873 | 3300005617 | Unclassified | 3601 |
| 172 | Ga0068859_100116817 | 3300005617 | Bacteria | 2732 |
| 173 | Ga0068859_100122586 | 3300005617 | Bacteria | 2666 |
| 174 | Ga0068859_100132701 | 3300005617 | Unclassified | 2562 |
| 175 | Ga0068859_100134873 | 3300005617 | Bacteria | 2541 |
| 176 | Ga0068859_100246430 | 3300005617 | Unclassified | 1876 |
| 177 | Ga0068859_100268272 | 3300005617 | Archaea | 1799 |
| 178 | Ga0068859_100912006 | 3300005617 | Unclassified | 963 |
| 179 | Ga0068864_100003467 | 3300005618 | Bacteria | 13027 |
| 180 | Ga0068864_100233545 | 3300005618 | Bacteria | 1702 |
| 181 | Ga0068864_100507157 | 3300005618 | Unclassified | 1161 |
| 182 | Ga0068864_100854334 | 3300005618 | Bacteria | 897 |
| 183 | Ga0068866_10026218 | 3300005718 | Bacteria | 2749 |
| 184 | Ga0068861_100010128 | 3300005719 | Bacteria | 6537 |
| 185 | Ga0068861_100060336 | 3300005719 | Bacteria | 2906 |
| 186 | Ga0068861_100107897 | 3300005719 | Bacteria | 2226 |
| 187 | Ga0068861_100223967 | 3300005719 | Unclassified | 1591 |
| 188 | Ga0068851_10016726 | 3300005834 | Viruses | 3514 |
| 189 | Ga0068870_10029124 | 3300005840 | Bacteria | 2779 |
| 190 | Ga0068870_10076909 | 3300005840 | Unclassified | 1834 |
| 191 | Ga0068870_10228919 | 3300005840 | Bacteria | 1142 |
| 192 | Ga0068870_10272652 | 3300005840 | Bacteria | 1057 |
| 193 | Ga0068870_10402733 | 3300005840 | Unclassified | 891 |
| 194 | Ga0068863_100047941 | 3300005841 | Unclassified | 4051 |
| 195 | Ga0068863_100065370 | 3300005841 | Unclassified | 3441 |
| 196 | Ga0068863_100143355 | 3300005841 | Bacteria | 2284 |
| 197 | Ga0068863_100503653 | 3300005841 | Bacteria | 1193 |
| 198 | Ga0068863_100715229 | 3300005841 | Bacteria | 996 |
| 199 | Ga0068858_100033656 | 3300005842 | Unclassified | 4753 |
| 200 | Ga0068858_100038439 | 3300005842 | Unclassified | 4439 |
| 201 | Ga0068858_100063698 | 3300005842 | Bacteria | 3411 |
| 202 | Ga0068858_100122681 | 3300005842 | Bacteria | 2431 |
| 203 | Ga0068858_100185450 | 3300005842 | Unclassified | 1965 |
| 204 | Ga0068858_100202414 | 3300005842 | Bacteria | 1878 |
| 205 | Ga0068860_100050177 | 3300005843 | Unclassified | 3973 |
| 206 | Ga0068860_100056878 | 3300005843 | Unclassified | 3717 |
| 207 | Ga0068860_100077306 | 3300005843 | Unclassified | 3165 |
| 208 | Ga0068860_100097470 | 3300005843 | Bacteria | 2803 |
| 209 | Ga0068860_100149902 | 3300005843 | Bacteria | 2245 |
| 210 | Ga0068860_100300486 | 3300005843 | Bacteria | 1572 |
| 211 | Ga0068862_100007320 | 3300005844 | Bacteria | 9164 |
| 212 | Ga0068862_100029204 | 3300005844 | Unclassified | 4645 |
| 213 | Ga0068862_100142850 | 3300005844 | Unclassified | 2125 |
| 214 | Ga0068862_100146558 | 3300005844 | Unclassified | 2098 |
| 215 | Ga0068862_100630797 | 3300005844 | Unclassified | 1032 |
| 216 | Ga0081539_10000395 | 3300005985 | Bacteria | 93818 |
| 217 | Ga0081539_10021230 | 3300005985 | Unclassified | 4347 |
| 218 | Ga0081539_10249776 | 3300005985 | Bacteria | 789 |
| 219 | Ga0075432_10193656 | 3300006058 | Unclassified | 801 |
| 220 | Ga0070716_100077610 | 3300006173 | Bacteria | 1972 |
| 221 | Ga0070716_100381189 | 3300006173 | Bacteria | 1008 |
| 222 | Ga0097621_100007032 | 3300006237 | Bacteria | 8016 |
| 223 | Ga0097621_100011502 | 3300006237 | Bacteria | 6520 |
| 224 | Ga0097621_100029679 | 3300006237 | Unclassified | 4322 |
| 225 | Ga0097621_100078942 | 3300006237 | Bacteria | 2735 |
| 226 | Ga0097621_100417529 | 3300006237 | Bacteria | 1204 |
| 227 | Ga0097621_100804644 | 3300006237 | Unclassified | 871 |
| 228 | Ga0068871_100008242 | 3300006358 | Bacteria | 7491 |
| 229 | Ga0068871_100019481 | 3300006358 | Bacteria | 5181 |
| 230 | Ga0068871_100023228 | 3300006358 | Unclassified | 4793 |
| 231 | Ga0068871_100244641 | 3300006358 | Unclassified | 1561 |
| 232 | Ga0075428_101097099 | 3300006844 | Bacteria | 841 |
| 233 | Ga0075428_101137298 | 3300006844 | Unclassified | 824 |
| 234 | Ga0075430_100018829 | 3300006846 | Bacteria | 5873 |
| 235 | Ga0075431_100631768 | 3300006847 | Bacteria | 1052 |
| 236 | Ga0075433_10011090 | 3300006852 | Bacteria | 7248 |
| 237 | Ga0075433_10048692 | 3300006852 | Unclassified | 3687 |
| 238 | Ga0075433_10140601 | 3300006852 | Bacteria | 2146 |
| 239 | Ga0075433_10200148 | 3300006852 | Bacteria | 1776 |
| 240 | Ga0075434_100017682 | 3300006871 | Bacteria | 6873 |
| 241 | Ga0075434_100098488 | 3300006871 | Unclassified | 2929 |
| 242 | Ga0075434_100158386 | 3300006871 | Unclassified | 2284 |
| 243 | Ga0075434_100388406 | 3300006871 | Bacteria | 1417 |
| 244 | Ga0075434_100548253 | 3300006871 | Bacteria | 1176 |
| 245 | Ga0075434_100558359 | 3300006871 | Unclassified | 1164 |
| 246 | Ga0075429_100204414 | 3300006880 | Bacteria | 1730 |
| 247 | Ga0068865_100089449 | 3300006881 | Bacteria | 2230 |
| 248 | Ga0097620_100047428 | 3300006931 | Bacteria | 4316 |
| 249 | Ga0097620_100067876 | 3300006931 | Unclassified | 3601 |
| 250 | Ga0097620_100116827 | 3300006931 | Bacteria | 2732 |
| 251 | Ga0097620_100122589 | 3300006931 | Bacteria | 2666 |
| 252 | Ga0097620_100132712 | 3300006931 | Unclassified | 2562 |
| 253 | Ga0097620_100134878 | 3300006931 | Bacteria | 2541 |
| 254 | Ga0097620_100246434 | 3300006931 | Unclassified | 1876 |
| 255 | Ga0097620_100268251 | 3300006931 | Archaea | 1799 |
| 256 | Ga0097620_100911855 | 3300006931 | Unclassified | 963 |
| 257 | Ga0075435_100461497 | 3300007076 | Unclassified | 1096 |
| 258 | Ga0105240_10033317 | 3300009093 | Bacteria | 6658 |
| 259 | Ga0105240_10349228 | 3300009093 | Unclassified | 1679 |
| 260 | Ga0105240_10509983 | 3300009093 | Unclassified | 1336 |
| 261 | Ga0105240_10722297 | 3300009093 | Bacteria | 1086 |
| 262 | Ga0111539_10000296 | 3300009094 | Bacteria | 60206 |
| 263 | Ga0111539_10047303 | 3300009094 | Bacteria | 5141 |
| 264 | Ga0111539_10081498 | 3300009094 | Unclassified | 3806 |
| 265 | Ga0111539_10134136 | 3300009094 | Bacteria | 2899 |
| 266 | Ga0111539_11414715 | 3300009094 | Bacteria | 807 |
| 267 | Ga0105245_10072162 | 3300009098 | Bacteria | 3136 |
| 268 | Ga0105245_10981013 | 3300009098 | Unclassified | 889 |
| 269 | Ga0105245_11241923 | 3300009098 | Bacteria | 793 |
| 270 | Ga0105247_10000635 | 3300009101 | Bacteria | 28087 |
| 271 | Ga0105247_10461149 | 3300009101 | Bacteria | 918 |
| 272 | Ga0114129_10023042 | 3300009147 | Bacteria | 8834 |
| 273 | Ga0114129_10083410 | 3300009147 | Bacteria | 4440 |
| 274 | Ga0114129_10087466 | 3300009147 | Bacteria | 4321 |
| 275 | Ga0114129_10110163 | 3300009147 | Unclassified | 3801 |
| 276 | Ga0114129_10221503 | 3300009147 | Bacteria | 2552 |
| 277 | Ga0114129_10281639 | 3300009147 | Bacteria | 2221 |
| 278 | Ga0105243_10046933 | 3300009148 | Bacteria | 3399 |
| 279 | Ga0105243_10048182 | 3300009148 | Bacteria | 3358 |
| 280 | Ga0105243_10176336 | 3300009148 | Unclassified | 1855 |
| 281 | Ga0105243_10184514 | 3300009148 | Bacteria | 1817 |
| 282 | Ga0105243_10376278 | 3300009148 | Unclassified | 1312 |
| 283 | Ga0105243_10601106 | 3300009148 | Unclassified | 1059 |
| 284 | Ga0105243_11378995 | 3300009148 | Bacteria | 725 |
| 285 | Ga0105241_10073258 | 3300009174 | Bacteria | 2664 |
| 286 | Ga0105241_10082831 | 3300009174 | Bacteria | 2515 |
| 287 | Ga0105241_10159375 | 3300009174 | Bacteria | 1853 |
| 288 | Ga0105241_10213546 | 3300009174 | Bacteria | 1618 |
| 289 | Ga0105241_10398526 | 3300009174 | Unclassified | 1206 |
| 290 | Ga0105241_10422586 | 3300009174 | Bacteria | 1173 |
| 291 | Ga0105241_10618061 | 3300009174 | Bacteria | 981 |
| 292 | Ga0105242_10010982 | 3300009176 | Bacteria | 6956 |
| 293 | Ga0105242_10063388 | 3300009176 | Unclassified | 3044 |
| 294 | Ga0105242_10136249 | 3300009176 | Unclassified | 2125 |
| 295 | Ga0105242_10183982 | 3300009176 | Bacteria | 1845 |
| 296 | Ga0105242_10285963 | 3300009176 | Unclassified | 1499 |
| 297 | Ga0105248_10005991 | 3300009177 | Bacteria | 13347 |
| 298 | Ga0105248_10019085 | 3300009177 | Bacteria | 7582 |
| 299 | Ga0105248_10049583 | 3300009177 | Bacteria | 4710 |
| 300 | Ga0105248_10074824 | 3300009177 | Unclassified | 3806 |
| 301 | Ga0105248_10099920 | 3300009177 | Bacteria | 3269 |
| 302 | Ga0105248_10202399 | 3300009177 | Unclassified | 2237 |
| 303 | Ga0105248_10304591 | 3300009177 | Bacteria | 1794 |
| 304 | Ga0105248_10420040 | 3300009177 | Bacteria | 1506 |
| 305 | Ga0105237_10003124 | 3300009545 | Bacteria | 19932 |
| 306 | Ga0105237_10042090 | 3300009545 | Unclassified | 4606 |
| 307 | Ga0105237_10102614 | 3300009545 | Bacteria | 2852 |
| 308 | Ga0105237_10136507 | 3300009545 | Bacteria | 2447 |
| 309 | Ga0105238_10017177 | 3300009551 | Bacteria | 7348 |
| 310 | Ga0105249_10009354 | 3300009553 | Bacteria | 8573 |
| 311 | Ga0105249_10023799 | 3300009553 | Bacteria | 5501 |
| 312 | Ga0105249_10064002 | 3300009553 | Bacteria | 3380 |
| 313 | Ga0105239_10058566 | 3300010375 | Unclassified | 4227 |
| 314 | Ga0105239_10195479 | 3300010375 | Bacteria | 2265 |
| 315 | Ga0105239_10337730 | 3300010375 | Bacteria | 1700 |
| 316 | Ga0105239_10388250 | 3300010375 | Bacteria | 1579 |
| 317 | Ga0105239_10510315 | 3300010375 | Bacteria | 1367 |
| 318 | Ga0105239_10516856 | 3300010375 | Unclassified | 1358 |
| 319 | Ga0105239_11126597 | 3300010375 | Unclassified | 903 |
| 320 | Ga0105239_11671874 | 3300010375 | Unclassified | 737 |
| 321 | Ga0105246_10009378 | 3300011119 | Bacteria | 6029 |
| 322 | Ga0105246_10048464 | 3300011119 | Unclassified | 2904 |
| 323 | Ga0105246_10123935 | 3300011119 | Unclassified | 1919 |
| 324 | Ga0105246_10329169 | 3300011119 | Unclassified | 1244 |
| 325 | Ga0157373_10002544 | 3300013100 | Bacteria | 13886 |
| 326 | Ga0157373_10035422 | 3300013100 | Bacteria | 3583 |
| 327 | Ga0157373_10047489 | 3300013100 | Unclassified | 3062 |
| 328 | Ga0157373_10433888 | 3300013100 | Bacteria | 944 |
| 329 | Ga0157371_10190925 | 3300013102 | Unclassified | 1467 |
| 330 | Ga0157374_10198389 | 3300013296 | Bacteria | 1965 |
| 331 | Ga0157374_10641585 | 3300013296 | Bacteria | 1073 |
| 332 | Ga0157378_10006269 | 3300013297 | Bacteria | 10412 |
| 333 | Ga0157378_10021443 | 3300013297 | Bacteria | 5681 |
| 334 | Ga0157378_10024293 | 3300013297 | Bacteria | 5330 |
| 335 | Ga0157378_10091569 | 3300013297 | Bacteria | 2765 |
| 336 | Ga0157378_10886950 | 3300013297 | Unclassified | 922 |
| 337 | Ga0163162_10012363 | 3300013306 | Bacteria | 8335 |
| 338 | Ga0163162_10028788 | 3300013306 | Bacteria | 5499 |
| 339 | Ga0163162_10086569 | 3300013306 | Unclassified | 3211 |
| 340 | Ga0163162_10199447 | 3300013306 | Bacteria | 2130 |
| 341 | Ga0157372_10021700 | 3300013307 | Bacteria | 6941 |
| 342 | Ga0157372_10096513 | 3300013307 | Unclassified | 3369 |
| 343 | Ga0157372_10228712 | 3300013307 | Bacteria | 2156 |
| 344 | Ga0157372_10293910 | 3300013307 | Unclassified | 1889 |
| 345 | Ga0157375_10024070 | 3300013308 | Bacteria | 5630 |
| 346 | Ga0157375_10046273 | 3300013308 | Unclassified | 4240 |
| 347 | Ga0157375_10080771 | 3300013308 | Unclassified | 3290 |
| 348 | Ga0157375_10117219 | 3300013308 | Bacteria | 2768 |
| 349 | Ga0157375_10142341 | 3300013308 | Unclassified | 2526 |
| 350 | Ga0157375_10178954 | 3300013308 | Unclassified | 2271 |
| 351 | Ga0157375_10513949 | 3300013308 | Bacteria | 1361 |
| 352 | Ga0157375_10754701 | 3300013308 | Unclassified | 1124 |
| 353 | Ga0163163_10002165 | 3300014325 | Bacteria | 16602 |
| 354 | Ga0163163_10025050 | 3300014325 | Bacteria | 5683 |
| 355 | Ga0163163_10076867 | 3300014325 | Unclassified | 3334 |
| 356 | Ga0163163_10096133 | 3300014325 | Bacteria | 2983 |
| 357 | Ga0163163_10127252 | 3300014325 | Unclassified | 2585 |
| 358 | Ga0163163_10152696 | 3300014325 | Bacteria | 2352 |
| 359 | Ga0163163_10247993 | 3300014325 | Bacteria | 1831 |
| 360 | Ga0163163_10270589 | 3300014325 | Unclassified | 1750 |
| 361 | Ga0163163_10688932 | 3300014325 | Bacteria | 1085 |
| 362 | Ga0163163_11067109 | 3300014325 | Bacteria | 871 |
| 363 | Ga0163163_11217231 | 3300014325 | Bacteria | 816 |
| 364 | Ga0157380_10015020 | 3300014326 | Bacteria | 5681 |
| 365 | Ga0157380_10095851 | 3300014326 | Bacteria | 2459 |
| 366 | Ga0157380_10190757 | 3300014326 | Bacteria | 1809 |
| 367 | Ga0157380_10206385 | 3300014326 | Bacteria | 1747 |
| 368 | Ga0157380_10825315 | 3300014326 | Unclassified | 946 |
| 369 | Ga0157380_11029393 | 3300014326 | Unclassified | 858 |
| 370 | Ga0157377_10007824 | 3300014745 | Bacteria | 5179 |
| 371 | Ga0157377_10102389 | 3300014745 | Bacteria | 1708 |
| 372 | Ga0157377_10186247 | 3300014745 | Unclassified | 1309 |
| 373 | Ga0157379_10076027 | 3300014968 | Unclassified | 3007 |
| 374 | Ga0157379_10106348 | 3300014968 | Bacteria | 2519 |
| 375 | Ga0157379_10106376 | 3300014968 | Unclassified | 2518 |
| 376 | Ga0157379_10462613 | 3300014968 | Unclassified | 1172 |
| 377 | Ga0157376_10005116 | 3300014969 | Bacteria | 9144 |
| 378 | Ga0157376_10090655 | 3300014969 | Unclassified | 2646 |
| 379 | Ga0157376_10585516 | 3300014969 | Unclassified | 1109 |
| 380 | Ga0163161_10014405 | 3300017792 | Bacteria | 5506 |
| 381 | Ga0213876_10000519 | 3300021384 | Bacteria | 29512 |
| 382 | Ga0207697_10014619 | 3300025315 | Bacteria | 3254 |
| 383 | Ga0207656_10006155 | 3300025321 | Viruses | 4296 |
| 384 | Ga0207653_10000019 | 3300025885 | Bacteria | 138019 |
| 385 | Ga0207653_10016917 | 3300025885 | Bacteria | 2293 |
| 386 | Ga0207653_10101690 | 3300025885 | Bacteria | 1017 |
| 387 | Ga0207642_10066000 | 3300025899 | Unclassified | 1702 |
| 388 | Ga0207642_10159174 | 3300025899 | Unclassified | 1211 |
| 389 | Ga0207710_10001176 | 3300025900 | Bacteria | 13294 |
| 390 | Ga0207688_10076813 | 3300025901 | Unclassified | 1902 |
| 391 | Ga0207647_10060631 | 3300025904 | Bacteria | 2312 |
| 392 | Ga0207647_10086399 | 3300025904 | Archaea | 1874 |
| 393 | Ga0207647_10162541 | 3300025904 | Unclassified | 1302 |
| 394 | Ga0207645_10077852 | 3300025907 | Bacteria | 2125 |
| 395 | Ga0207643_10001352 | 3300025908 | Bacteria | 14172 |
| 396 | Ga0207643_10047041 | 3300025908 | Bacteria | 2439 |
| 397 | Ga0207643_10060382 | 3300025908 | Bacteria | 2164 |
| 398 | Ga0207643_10117502 | 3300025908 | Bacteria | 1572 |
| 399 | Ga0207684_10000533 | 3300025910 | Bacteria | 47088 |
| 400 | Ga0207684_10003673 | 3300025910 | Bacteria | 14881 |
| 401 | Ga0207684_10068882 | 3300025910 | Bacteria | 3007 |
| 402 | Ga0207684_10698075 | 3300025910 | Unclassified | 862 |
| 403 | Ga0207654_10047861 | 3300025911 | Bacteria | 2444 |
| 404 | Ga0207654_10207126 | 3300025911 | Unclassified | 1294 |
| 405 | Ga0207654_10290798 | 3300025911 | Unclassified | 1108 |
| 406 | Ga0207707_10000044 | 3300025912 | Bacteria | 122847 |
| 407 | Ga0207707_10041978 | 3300025912 | Unclassified | 3993 |
| 408 | Ga0207695_10051122 | 3300025913 | Unclassified | 4341 |
| 409 | Ga0207671_10054187 | 3300025914 | Bacteria | 2972 |
| 410 | Ga0207671_10138040 | 3300025914 | Bacteria | 1876 |
| 411 | Ga0207671_10215408 | 3300025914 | Unclassified | 1503 |
| 412 | Ga0207660_10010225 | 3300025917 | Bacteria | 6082 |
| 413 | Ga0207660_10060066 | 3300025917 | Bacteria | 2731 |
| 414 | Ga0207662_10007106 | 3300025918 | Bacteria | 6082 |
| 415 | Ga0207662_10025399 | 3300025918 | Bacteria | 3412 |
| 416 | Ga0207662_10104282 | 3300025918 | Unclassified | 1761 |
| 417 | Ga0207652_10000462 | 3300025921 | Bacteria | 41666 |
| 418 | Ga0207646_10149705 | 3300025922 | Bacteria | 2104 |
| 419 | Ga0207646_10260227 | 3300025922 | Unclassified | 1568 |
| 420 | Ga0207646_10277292 | 3300025922 | Bacteria | 1515 |
| 421 | Ga0207681_10000606 | 3300025923 | Bacteria | 24138 |
| 422 | Ga0207681_10302837 | 3300025923 | Unclassified | 1265 |
| 423 | Ga0207694_10004561 | 3300025924 | Bacteria | 10801 |
| 424 | Ga0207694_10005267 | 3300025924 | Bacteria | 9961 |
| 425 | Ga0207650_10000112 | 3300025925 | Bacteria | 106714 |
| 426 | Ga0207650_10007618 | 3300025925 | Bacteria | 7376 |
| 427 | Ga0207650_10086033 | 3300025925 | Unclassified | 2392 |
| 428 | Ga0207650_10160699 | 3300025925 | Unclassified | 1780 |
| 429 | Ga0207650_10195368 | 3300025925 | Bacteria | 1618 |
| 430 | Ga0207650_10485335 | 3300025925 | Bacteria | 1031 |
| 431 | Ga0207659_10026735 | 3300025926 | Bacteria | 3897 |
| 432 | Ga0207687_10172868 | 3300025927 | Unclassified | 1668 |
| 433 | Ga0207687_10548959 | 3300025927 | Unclassified | 969 |
| 434 | Ga0207644_10007284 | 3300025931 | Bacteria | 7201 |
| 435 | Ga0207644_10042952 | 3300025931 | Unclassified | 3206 |
| 436 | Ga0207644_10573093 | 3300025931 | Bacteria | 936 |
| 437 | Ga0207690_10032470 | 3300025932 | Bacteria | 3350 |
| 438 | Ga0207706_10222222 | 3300025933 | Bacteria | 1654 |
| 439 | Ga0207686_10036470 | 3300025934 | Bacteria | 2960 |
| 440 | Ga0207686_10061588 | 3300025934 | Unclassified | 2380 |
| 441 | Ga0207686_10412809 | 3300025934 | Unclassified | 1031 |
| 442 | Ga0207709_10005963 | 3300025935 | Bacteria | 6871 |
| 443 | Ga0207709_10009898 | 3300025935 | Bacteria | 5250 |
| 444 | Ga0207709_10052269 | 3300025935 | Bacteria | 2508 |
| 445 | Ga0207709_10254669 | 3300025935 | Unclassified | 1284 |
| 446 | Ga0207709_10565193 | 3300025935 | Unclassified | 896 |
| 447 | Ga0207670_10000957 | 3300025936 | Bacteria | 15223 |
| 448 | Ga0207670_10045600 | 3300025936 | Bacteria | 2907 |
| 449 | Ga0207670_10559352 | 3300025936 | Unclassified | 935 |
| 450 | Ga0207669_10406348 | 3300025937 | Unclassified | 1068 |
| 451 | Ga0207704_10221934 | 3300025938 | Bacteria | 1399 |
| 452 | Ga0207665_10259308 | 3300025939 | Bacteria | 1287 |
| 453 | Ga0207691_10001111 | 3300025940 | Bacteria | 26785 |
| 454 | Ga0207691_10203798 | 3300025940 | Bacteria | 1721 |
| 455 | Ga0207691_10557441 | 3300025940 | Bacteria | 971 |
| 456 | Ga0207691_10733441 | 3300025940 | Bacteria | 832 |
| 457 | Ga0207711_10007996 | 3300025941 | Bacteria | 8848 |
| 458 | Ga0207711_10131716 | 3300025941 | Unclassified | 2243 |
| 459 | Ga0207711_10300824 | 3300025941 | Unclassified | 1480 |
| 460 | Ga0207711_10764679 | 3300025941 | Unclassified | 900 |
| 461 | Ga0207711_10936428 | 3300025941 | Unclassified | 805 |
| 462 | Ga0207689_10025774 | 3300025942 | Bacteria | 4926 |
| 463 | Ga0207689_10029949 | 3300025942 | Bacteria | 4539 |
| 464 | Ga0207689_10239183 | 3300025942 | Unclassified | 1501 |
| 465 | Ga0207689_10668980 | 3300025942 | Bacteria | 875 |
| 466 | Ga0207679_10030908 | 3300025945 | Bacteria | 3744 |
| 467 | Ga0207679_10050209 | 3300025945 | Bacteria | 3046 |
| 468 | Ga0207679_11089904 | 3300025945 | Bacteria | 733 |
| 469 | Ga0207667_10467751 | 3300025949 | Bacteria | 1280 |
| 470 | Ga0207651_10053973 | 3300025960 | Bacteria | 2751 |
| 471 | Ga0207651_10074200 | 3300025960 | Bacteria | 2422 |
| 472 | Ga0207651_10278383 | 3300025960 | Bacteria | 1381 |
| 473 | Ga0207651_10284896 | 3300025960 | Bacteria | 1367 |
| 474 | Ga0207651_10963195 | 3300025960 | Bacteria | 762 |
| 475 | Ga0207712_10030166 | 3300025961 | Unclassified | 3643 |
| 476 | Ga0207712_10052417 | 3300025961 | Bacteria | 2858 |
| 477 | Ga0207712_10084731 | 3300025961 | Bacteria | 2317 |
| 478 | Ga0207712_10335740 | 3300025961 | Unclassified | 1252 |
| 479 | Ga0207640_10105307 | 3300025981 | Unclassified | 1987 |
| 480 | Ga0207640_10143314 | 3300025981 | Unclassified | 1745 |
| 481 | Ga0207640_10208497 | 3300025981 | Unclassified | 1487 |
| 482 | Ga0207658_10073476 | 3300025986 | Unclassified | 2596 |
| 483 | Ga0207658_10143134 | 3300025986 | Bacteria | 1938 |
| 484 | Ga0207677_10233437 | 3300026023 | Unclassified | 1483 |
| 485 | Ga0207703_10023842 | 3300026035 | Unclassified | 4812 |
| 486 | Ga0207703_10097938 | 3300026035 | Bacteria | 2479 |
| 487 | Ga0207703_10182266 | 3300026035 | Unclassified | 1854 |
| 488 | Ga0207703_10402856 | 3300026035 | Unclassified | 1270 |
| 489 | Ga0207703_10526618 | 3300026035 | Unclassified | 1112 |
| 490 | Ga0207639_10094632 | 3300026041 | Bacteria | 2399 |
| 491 | Ga0207639_10095548 | 3300026041 | Bacteria | 2389 |
| 492 | Ga0207639_10965650 | 3300026041 | Unclassified | 798 |
| 493 | Ga0207708_10000074 | 3300026075 | Bacteria | 79215 |
| 494 | Ga0207708_10005201 | 3300026075 | Bacteria | 9594 |
| 495 | Ga0207708_10008167 | 3300026075 | Bacteria | 7751 |
| 496 | Ga0207708_10016579 | 3300026075 | Bacteria | 5542 |
| 497 | Ga0207708_10119926 | 3300026075 | Unclassified | 2049 |
| 498 | Ga0207708_10151749 | 3300026075 | Bacteria | 1825 |
| 499 | Ga0207708_10166705 | 3300026075 | Unclassified | 1742 |
| 500 | Ga0207708_10183218 | 3300026075 | Bacteria | 1663 |
| 501 | Ga0207708_10205942 | 3300026075 | Bacteria | 1571 |
| 502 | Ga0207708_10249316 | 3300026075 | Bacteria | 1430 |
| 503 | Ga0207708_10837404 | 3300026075 | Bacteria | 794 |
| 504 | Ga0207702_10044004 | 3300026078 | Unclassified | 3751 |
| 505 | Ga0207641_10017575 | 3300026088 | Bacteria | 5855 |
| 506 | Ga0207641_10091951 | 3300026088 | Unclassified | 2656 |
| 507 | Ga0207641_10105025 | 3300026088 | Bacteria | 2495 |
| 508 | Ga0207641_10374601 | 3300026088 | Bacteria | 1362 |
| 509 | Ga0207641_10513539 | 3300026088 | Bacteria | 1165 |
| 510 | Ga0207648_10005481 | 3300026089 | Bacteria | 12788 |
| 511 | Ga0207648_10055692 | 3300026089 | Unclassified | 3451 |
| 512 | Ga0207648_10727272 | 3300026089 | Bacteria | 921 |
| 513 | Ga0207676_10002522 | 3300026095 | Bacteria | 13053 |
| 514 | Ga0207676_10020870 | 3300026095 | Unclassified | 4799 |
| 515 | Ga0207676_10181017 | 3300026095 | Bacteria | 1845 |
| 516 | Ga0207676_10190220 | 3300026095 | Unclassified | 1805 |
| 517 | Ga0207676_10196165 | 3300026095 | Bacteria | 1780 |
| 518 | Ga0207676_10287243 | 3300026095 | Bacteria | 1496 |
| 519 | Ga0207674_10004656 | 3300026116 | Bacteria | 16464 |
| 520 | Ga0207674_10074807 | 3300026116 | Bacteria | 3398 |
| 521 | Ga0207674_10108451 | 3300026116 | Unclassified | 2753 |
| 522 | Ga0207674_10113680 | 3300026116 | Unclassified | 2680 |
| 523 | Ga0207674_10232589 | 3300026116 | Bacteria | 1791 |
| 524 | Ga0207674_10463858 | 3300026116 | Unclassified | 1224 |
| 525 | Ga0207675_100013059 | 3300026118 | Bacteria | 7751 |
| 526 | Ga0207675_100018268 | 3300026118 | Bacteria | 6538 |
| 527 | Ga0207675_100027423 | 3300026118 | Bacteria | 5305 |
| 528 | Ga0207675_100084984 | 3300026118 | Bacteria | 2969 |
| 529 | Ga0207675_100085864 | 3300026118 | Unclassified | 2954 |
| 530 | Ga0207675_100088148 | 3300026118 | Unclassified | 2915 |
| 531 | Ga0207675_100147674 | 3300026118 | Bacteria | 2236 |
| 532 | Ga0207683_10027129 | 3300026121 | Bacteria | 4950 |
| 533 | Ga0207683_10188071 | 3300026121 | Bacteria | 1874 |
| 534 | Ga0207698_10555749 | 3300026142 | Unclassified | 1126 |
| 535 | Ga0207428_10037183 | 3300027907 | Bacteria | 3963 |
| 536 | Ga0268265_10023091 | 3300028380 | Bacteria | 4381 |
| 537 | Ga0268265_10350777 | 3300028380 | Bacteria | 1347 |
| 538 | Ga0268265_10720639 | 3300028380 | Unclassified | 965 |
| 539 | Ga0268264_10012522 | 3300028381 | Bacteria | 6985 |
| 540 | Ga0268264_10065261 | 3300028381 | Bacteria | 3067 |
| 541 | Ga0268264_10075128 | 3300028381 | Unclassified | 2873 |
| 542 | Ga0268264_10092832 | 3300028381 | Unclassified | 2606 |
| 543 | Ga0268264_10122944 | 3300028381 | Unclassified | 2290 |
| 544 | Ga0268264_10777700 | 3300028381 | Unclassified | 955 |
| 545 | Ga0268264_11086007 | 3300028381 | Unclassified | 808 |
| 546 | Ga0307513_10187380 | 3300031456 | Bacteria | 1925 |
| 547 | Ga0307408_100033141 | 3300031548 | Unclassified | 3606 |
| 548 | Ga0307408_100055392 | 3300031548 | Unclassified | 2871 |
| 549 | Ga0307408_100322428 | 3300031548 | Bacteria | 1302 |
| 550 | Ga0307405_10015144 | 3300031731 | Unclassified | 4167 |
| 551 | Ga0307405_10106857 | 3300031731 | Bacteria | 1888 |
| 552 | Ga0307413_10038923 | 3300031824 | Unclassified | 2760 |
| 553 | Ga0307406_10003612 | 3300031901 | Bacteria | 8426 |
| 554 | Ga0307406_10132496 | 3300031901 | Bacteria | 1752 |
| 555 | Ga0307406_10200282 | 3300031901 | Unclassified | 1469 |
| 556 | Ga0307406_10552533 | 3300031901 | Bacteria | 942 |
| 557 | Ga0307412_10003279 | 3300031911 | Bacteria | 8982 |
| 558 | Ga0307412_10149986 | 3300031911 | Bacteria | 1719 |
| 559 | Ga0307409_100043134 | 3300031995 | Bacteria | 3384 |
| 560 | Ga0307409_101150697 | 3300031995 | Unclassified | 798 |
| 561 | Ga0307416_100078635 | 3300032002 | Unclassified | 2776 |
| 562 | Ga0307414_10002715 | 3300032004 | Bacteria | 9314 |
| 563 | Ga0307414_10498244 | 3300032004 | Unclassified | 1077 |
| 564 | Ga0307411_10008953 | 3300032005 | Bacteria | 5226 |
| 565 | Ga0307411_10058114 | 3300032005 | Bacteria | 2558 |
| 566 | Ga0307415_100003868 | 3300032126 | Bacteria | 7682 |
| 567 | Ga0373931_0491934 | 3300035691 | Unclassified | 790 |
| 568 | Ga0395898_0150634 | 3300037466 | Bacteria | 2226 |
| 569 | Ga0395898_0797902 | 3300037466 | Bacteria | 884 |
| 570 | Ga0395905_0016508 | 3300037471 | Bacteria | 7019 |
| 571 | Ga0242422_02492 | 3300038699 | Unclassified | 1245 |
| 572 | Ga0242420_005171 | 3300038996 | Bacteria | 2008 |
| 573 | Ga0242420_010415 | 3300038996 | Bacteria | 1544 |
| 574 | Ga0436365_0067166 | 3300039437 | Bacteria | 157821 |
| 575 | Ga0439458_0002859 | 3300042157 | Bacteria | 4150 |
| 576 | Ga0451576_0198652 | 3300045051 | Bacteria | 2095 |
| 577 | Ga0451576_1064431 | 3300045051 | Bacteria | 847 |
| 578 | Ga0495658_0173641 | 3300046683 | Bacteria | 1335 |
| 579 | Ga0496102_0026684 | 3300048905 | Bacteria | 5155 |
| 580 | Ga0496103_0096108 | 3300048906 | Bacteria | 1872 |
| 581 | Ga0496104_0052096 | 3300048907 | Unclassified | 3865 |
| 582 | Ga0496104_0614361 | 3300048907 | Unclassified | 997 |
| 583 | Ga0496106_0036566 | 3300048909 | Bacteria | 3673 |
| 584 | Ga0496106_0292087 | 3300048909 | Bacteria | 1307 |
| 585 | Ga0496108_0192612 | 3300048911 | Bacteria | 1767 |
| 586 | Ga0496109_0638919 | 3300048912 | Bacteria | 1001 |
| 587 | Ga0496110_0103817 | 3300048913 | Unclassified | 2550 |
| 588 | Ga0496110_0789903 | 3300048913 | Bacteria | 853 |
| 589 | Ga0496112_0104941 | 3300048915 | Bacteria | 2796 |
| 590 | Ga0496112_0127168 | 3300048915 | Unclassified | 2519 |
| 591 | Ga0496112_0244663 | 3300048915 | Bacteria | 1746 |
| 592 | Ga0496112_0251088 | 3300048915 | Bacteria | 1720 |
| 593 | Ga0496112_0263161 | 3300048915 | Unclassified | 1674 |
| 594 | Ga0496112_0520585 | 3300048915 | Unclassified | 1124 |
| 595 | Ga0496113_0349634 | 3300048916 | Bacteria | 1186 |
| 596 | Ga0501290_008304 | 3300049513 | Bacteria | 1310 |
| 597 | Ga0501290_017929 | 3300049513 | Unclassified | 951 |
| 598 | Ga0501291_003913 | 3300049514 | Bacteria | 1879 |
| 599 | Ga0501291_013130 | 3300049514 | Bacteria | 1221 |
| 600 | Ga0501292_003711 | 3300049515 | Bacteria | 2054 |
| 601 | Ga0501298_004915 | 3300049521 | Bacteria | 2126 |
| 602 | Ga0501298_005320 | 3300049521 | Bacteria | 2060 |
| 603 | Ga0501298_035227 | 3300049521 | Unclassified | 998 |
| 604 | Ga0501298_047029 | 3300049521 | Bacteria | 887 |
| 605 | Ga0501299_008182 | 3300049522 | Bacteria | 1694 |
| 606 | Ga0501299_012925 | 3300049522 | Bacteria | 1433 |
| 607 | Ga0501038_0001223 | 3300049574 | Bacteria | 23290 |
| 608 | Ga0501076_0151317 | 3300049592 | Bacteria | 1888 |
| 609 | Ga0501198_008940 | 3300049649 | Unclassified | 1463 |
| 610 | Ga0501198_030520 | 3300049649 | Bacteria | 898 |
| 611 | Ga0501201_003313 | 3300049651 | Bacteria | 1476 |
| 612 | Ga0501202_001485 | 3300049652 | Unclassified | 3770 |
| 613 | Ga0501202_008610 | 3300049652 | Bacteria | 1862 |
| 614 | Ga0501202_034974 | 3300049652 | Unclassified | 1064 |
| 615 | Ga0501206_026039 | 3300049653 | Unclassified | 853 |
| 616 | Ga0501217_000392 | 3300049661 | Bacteria | 7053 |
| 617 | Ga0501217_002225 | 3300049661 | Unclassified | 3785 |
| 618 | Ga0501217_004543 | 3300049661 | Bacteria | 2857 |
| 619 | Ga0501223_002306 | 3300049663 | Bacteria | 4257 |
| 620 | Ga0501223_011718 | 3300049663 | Bacteria | 1759 |
| 621 | Ga0501224_006823 | 3300049664 | Bacteria | 1660 |
| 622 | Ga0501227_000419 | 3300049665 | Bacteria | 9050 |
| 623 | Ga0501227_007003 | 3300049665 | Unclassified | 2415 |
| 624 | Ga0501233_004145 | 3300049668 | Bacteria | 2641 |
| 625 | Ga0501233_006722 | 3300049668 | Unclassified | 2169 |
| 626 | Ga0501233_036860 | 3300049668 | Bacteria | 1133 |
| 627 | Ga0501235_007599 | 3300049669 | Unclassified | 2361 |
| 628 | Ga0501235_020840 | 3300049669 | Unclassified | 1456 |
| 629 | Ga0501235_040932 | 3300049669 | Unclassified | 1059 |
| 630 | Ga0501240_001485 | 3300049673 | Unclassified | 2300 |
| 631 | Ga0501243_035626 | 3300049675 | Unclassified | 862 |
| 632 | Ga0501249_011770 | 3300049679 | Bacteria | 1842 |
| 633 | Ga0501250_004278 | 3300049680 | Bacteria | 1413 |
| 634 | Ga0501255_039539 | 3300049684 | Unclassified | 687 |
| 635 | Ga0501257_017061 | 3300049686 | Bacteria | 1687 |
| 636 | Ga0501221_021636 | 3300049704 | Unclassified | 1268 |
| 637 | Ga0501221_091514 | 3300049704 | Bacteria | 744 |
| 638 | Ga0501225_0002302 | 3300049705 | Bacteria | 5901 |
| 639 | Ga0501225_0002856 | 3300049705 | Bacteria | 5300 |
| 640 | Ga0501225_0004997 | 3300049705 | Bacteria | 3919 |
| 641 | Ga0501225_0033365 | 3300049705 | Bacteria | 1416 |
| 642 | Ga0501229_007533 | 3300049706 | Unclassified | 1356 |
| 643 | Ga0501234_001008 | 3300049707 | Bacteria | 4471 |
| 644 | Ga0501234_017699 | 3300049707 | Bacteria | 1127 |
| 645 | Ga0501234_020935 | 3300049707 | Unclassified | 1040 |
| 646 | Ga0501270_014408 | 3300049767 | Unclassified | 1113 |
| 647 | Ga0501273_001762 | 3300049770 | Bacteria | 2114 |
| 648 | Ga0501283_009959 | 3300049779 | Bacteria | 1393 |
| 649 | Ga0501283_018484 | 3300049779 | Unclassified | 1097 |
| 650 | Ga0501212_002675 | 3300049851 | Unclassified | 2173 |
| 651 | Ga0501212_008442 | 3300049851 | Bacteria | 1432 |
| 652 | Ga0501226_005607 | 3300049853 | Unclassified | 1428 |
| 653 | Ga0501226_010780 | 3300049853 | Bacteria | 1013 |
| 654 | nmdc:mga05p37_292778_c1 | 3300050507 | Bacteria | 1937 |
| 655 | nmdc:mga05p37_363634_c1 | 3300050507 | Unclassified | 1700 |
| 656 | nmdc:mga05p37_59302_c1 | 3300050507 | Bacteria | 4713 |
| 657 | nmdc:mga05p37_96306_c1 | 3300050507 | Bacteria | 3646 |
| 658 | nmdc:mga0qj67_284622_c1 | 3300050509 | Bacteria | 1340 |
| 659 | nmdc:mga0qj67_82457_c1 | 3300050509 | Unclassified | 2579 |
| 660 | nmdc:mga06r32_243708_c1 | 3300050510 | Bacteria | 1785 |
| 661 | nmdc:mga06r32_97352_c1 | 3300050510 | Unclassified | 2883 |
| 662 | nmdc:mga08y16_17931_c1 | 3300050511 | Bacteria | 7459 |
| 663 | nmdc:mga08y16_285331_c1 | 3300050511 | Unclassified | 1702 |
| 664 | nmdc:mga08y16_96939_c1 | 3300050511 | Bacteria | 3071 |
| 665 | nmdc:mga0n895_152117_c1 | 3300050512 | Unclassified | 2344 |
| 666 | nmdc:mga0n895_384838_c1 | 3300050512 | Bacteria | 1419 |
| 667 | nmdc:mga0n895_435453_c1 | 3300050512 | Unclassified | 1325 |
| 668 | nmdc:mga0n895_58744_c1 | 3300050512 | Unclassified | 3793 |
| 669 | nmdc:mga0n895_828115_c1 | 3300050512 | Unclassified | 914 |
| 670 | nmdc:mga0rr50_753310_c1 | 3300050513 | Unclassified | 831 |
| 671 | nmdc:mga08x19_87194_c1 | 3300050514 | Unclassified | 2056 |
| 672 | nmdc:mga0a205_114584_c1 | 3300050515 | Bacteria | 2078 |
| 673 | nmdc:mga0a205_173939_c1 | 3300050515 | Unclassified | 2049 |
| 674 | nmdc:mga0a205_254682_c1 | 3300050515 | Bacteria | 1634 |
| 675 | nmdc:mga0a205_276695_c1 | 3300050515 | Bacteria | 1555 |
| 676 | nmdc:mga0a205_324454_c1 | 3300050515 | Unclassified | 1410 |
| 677 | nmdc:mga0a205_76795_c1 | 3300050515 | Bacteria | 3228 |
| 678 | Ga0530510_0061580 | 3300061734 | Bacteria | 2717 |
| 679 | Ga0207647_10000445 | |||
| 680 | SwRhRL3b_contig_2005254 | |||
| 681 | SwRhRL2b_contig_73591 | |||
| 682 | MBSR1b_contig_1246515 | |||
| 683 | MBSR1b_contig_5388315 | |||
| 684 | CNAas_1000674 | |||
| 685 | JGI24751J29686_10000023 | |||
| 686 | JGI25406J46586_10035896 | |||
| 687 | Ga0065704_10106120 | |||
| 688 | Ga0065712_10025915 | |||
| 689 | Ga0065712_10075521 | |||
| 690 | Ga0065712_10095014 | |||
| 691 | Ga0065712_10141247 | |||
| 692 | Ga0065715_10006188 | |||
| 693 | Ga0065715_10092412 | |||
| 694 | Ga0065715_10094282 | |||
| 695 | Ga0065715_10095606 | |||
| 696 | Ga0065715_10103948 | |||
| 697 | Ga0065715_10296685 | |||
| 698 | Ga0065707_10002957 | |||
| 699 | Ga0065707_10092486 | |||
| 700 | Ga0070676_10027009 | |||
| 701 | Ga0070676_10098041 | |||
| 702 | Ga0070690_100004875 | |||
| 703 | Ga0070690_100064231 | |||
| 704 | Ga0070670_100000324 | |||
| 705 | Ga0070670_100000490 | |||
| 706 | Ga0070670_100214788 | |||
| 707 | Ga0070670_100224232 | |||
| 708 | Ga0068869_100017058 | |||
| 709 | Ga0068869_100107052 | |||
| 710 | Ga0068869_100308894 | |||
| 711 | Ga0068869_100732993 | |||
| 712 | Ga0068869_100845142 | |||
| 713 | Ga0070666_10033159 | |||
| 714 | Ga0070680_100001584 | |||
| 715 | Ga0070680_100032700 | |||
| 716 | Ga0070682_100001581 | |||
| 717 | Ga0070682_100051608 | |||
| 718 | Ga0068868_100027093 | |||
| 719 | Ga0070689_100011673 | |||
| 720 | Ga0070689_100027432 | |||
| 721 | Ga0070689_100169852 | |||
| 722 | Ga0070689_100559466 | |||
| 723 | Ga0070689_100588125 | |||
| 724 | Ga0070689_100650018 | |||
| 725 | Ga0070689_100883170 | |||
| 726 | Ga0070687_100036292 | |||
| 727 | Ga0070687_100056576 | |||
| 728 | Ga0070661_100267239 | |||
| 729 | Ga0070692_10011404 | |||
| 730 | Ga0070692_10079332 | |||
| 731 | Ga0070692_10101772 | |||
| 732 | Ga0070692_10148708 | |||
| 733 | Ga0070669_100000309 | |||
| 734 | Ga0070669_100595859 | |||
| 735 | Ga0070675_100198983 | |||
| 736 | Ga0070671_100041883 | |||
| 737 | Ga0070671_100042966 | |||
| 738 | Ga0070671_100072433 | |||
| 739 | Ga0070671_100647371 | |||
| 740 | Ga0070674_100183072 | |||
| 741 | Ga0070673_100017320 | |||
| 742 | Ga0070673_100021714 | |||
| 743 | Ga0070673_100029620 | |||
| 744 | Ga0070673_100459762 | |||
| 745 | Ga0070688_100108691 | |||
| 746 | Ga0070659_100044040 | |||
| 747 | Ga0070667_100056268 | |||
| 748 | Ga0070703_10022153 | |||
| 749 | Ga0070709_10531450 | |||
| 750 | Ga0070701_10190439 | |||
| 751 | Ga0070705_100039910 | |||
| 752 | Ga0070705_100077595 | |||
| 753 | Ga0070705_100171452 | |||
| 754 | Ga0070705_100318900 | |||
| 755 | Ga0070700_100000042 | |||
| 756 | Ga0070700_100005045 | |||
| 757 | Ga0070700_100007847 | |||
| 758 | Ga0070700_100026835 | |||
| 759 | Ga0070700_100093467 | |||
| 760 | Ga0070700_100298275 | |||
| 761 | Ga0070700_100528719 | |||
| 762 | Ga0070700_100727528 | |||
| 763 | Ga0070694_100005424 | |||
| 764 | Ga0070694_100007222 | |||
| 765 | Ga0070694_100028474 | |||
| 766 | Ga0070694_100031665 | |||
| 767 | Ga0070694_100074036 | |||
| 768 | Ga0070694_100101200 | |||
| 769 | Ga0070694_100110161 | |||
| 770 | Ga0070694_100111463 | |||
| 771 | Ga0070694_100228948 | |||
| 772 | Ga0070694_100255741 | |||
| 773 | Ga0070708_100000158 | |||
| 774 | Ga0070708_100438193 | |||
| 775 | Ga0070678_100054393 | |||
| 776 | Ga0070678_100156902 | |||
| 777 | Ga0070681_10000354 | |||
| 778 | Ga0070681_10004835 | |||
| 779 | Ga0070681_10012618 | |||
| 780 | Ga0068867_100003348 | |||
| 781 | Ga0068867_100255602 | |||
| 782 | Ga0068867_100557473 | |||
| 783 | Ga0070685_10010231 | |||
| 784 | Ga0070685_10640199 | |||
| 785 | Ga0070706_100000480 | |||
| 786 | Ga0070706_100004115 | |||
| 787 | Ga0070707_100113119 | |||
| 788 | Ga0070707_100314363 | |||
| 789 | Ga0070698_100004618 | |||
| 790 | Ga0070698_100045289 | |||
| 791 | Ga0070698_100056643 | |||
| 792 | Ga0070699_100002826 | |||
| 793 | Ga0070699_100004781 | |||
| 794 | Ga0070699_100013038 | |||
| 795 | Ga0070699_100326881 | |||
| 796 | Ga0070699_100357588 | |||
| 797 | Ga0070679_100001229 | |||
| 798 | Ga0070679_100688722 | |||
| 799 | Ga0070684_100091258 | |||
| 800 | Ga0070697_100002092 | |||
| 801 | Ga0070697_100080183 | |||
| 802 | Ga0070697_100110433 | |||
| 803 | Ga0070697_100388219 | |||
| 804 | Ga0068853_100011334 | |||
| 805 | Ga0068853_100123255 | |||
| 806 | Ga0068853_101207163 | |||
| 807 | Ga0070672_100025282 | |||
| 808 | Ga0070672_100607158 | |||
| 809 | Ga0070686_100011993 | |||
| 810 | Ga0070686_100018677 | |||
| 811 | Ga0070686_100114266 | |||
| 812 | Ga0070695_100033398 | |||
| 813 | Ga0070695_100067556 | |||
| 814 | Ga0070695_100076471 | |||
| 815 | Ga0070695_100210946 | |||
| 816 | Ga0070695_100494704 | |||
| 817 | Ga0070696_100009805 | |||
| 818 | Ga0070696_100041644 | |||
| 819 | Ga0070696_100094391 | |||
| 820 | Ga0070696_100177957 | |||
| 821 | Ga0070696_100299963 | |||
| 822 | Ga0070696_100725144 | |||
| 823 | Ga0070693_100029631 | |||
| 824 | Ga0070693_100075741 | |||
| 825 | Ga0070693_100090220 | |||
| 826 | Ga0070693_100162405 | |||
| 827 | Ga0070665_101113058 | |||
| 828 | Ga0070704_100083174 | |||
| 829 | Ga0070704_100093011 | |||
| 830 | Ga0070704_100117092 | |||
| 831 | Ga0070704_100153014 | |||
| 832 | Ga0070704_100175571 | |||
| 833 | Ga0070704_100549706 | |||
| 834 | Ga0070704_100903498 | |||
| 835 | Ga0068855_100361977 | |||
| 836 | Ga0068857_100002908 | |||
| 837 | Ga0068854_100375177 | |||
| 838 | Ga0068854_100386911 | |||
| 839 | Ga0068856_100005175 | |||
| 840 | Ga0068856_100644322 | |||
| 841 | Ga0070702_100024935 | |||
| 842 | Ga0070702_100178485 | |||
| 843 | Ga0070702_100211514 | |||
| 844 | Ga0070702_100265323 | |||
| 845 | Ga0068852_100058329 | |||
| 846 | Ga0068852_100395108 | |||
| 847 | Ga0068852_100711441 | |||
| 848 | Ga0068859_100047427 | |||
| 849 | Ga0068859_100067873 | |||
| 850 | Ga0068859_100116817 | |||
| 851 | Ga0068859_100122586 | |||
| 852 | Ga0068859_100132701 | |||
| 853 | Ga0068859_100134873 | |||
| 854 | Ga0068859_100246430 | |||
| 855 | Ga0068859_100268272 | |||
| 856 | Ga0068859_100912006 | |||
| 857 | Ga0068864_100003467 | |||
| 858 | Ga0068864_100233545 | |||
| 859 | Ga0068864_100507157 | |||
| 860 | Ga0068864_100854334 | |||
| 861 | Ga0068866_10026218 | |||
| 862 | Ga0068861_100010128 | |||
| 863 | Ga0068861_100060336 | |||
| 864 | Ga0068861_100107897 | |||
| 865 | Ga0068861_100223967 | |||
| 866 | Ga0068851_10016726 | |||
| 867 | Ga0068870_10029124 | |||
| 868 | Ga0068870_10076909 | |||
| 869 | Ga0068870_10228919 | |||
| 870 | Ga0068870_10272652 | |||
| 871 | Ga0068870_10402733 | |||
| 872 | Ga0068863_100047941 | |||
| 873 | Ga0068863_100065370 | |||
| 874 | Ga0068863_100143355 | |||
| 875 | Ga0068863_100503653 | |||
| 876 | Ga0068863_100715229 | |||
| 877 | Ga0068858_100033656 | |||
| 878 | Ga0068858_100038439 | |||
| 879 | Ga0068858_100063698 | |||
| 880 | Ga0068858_100122681 | |||
| 881 | Ga0068858_100185450 | |||
| 882 | Ga0068858_100202414 | |||
| 883 | Ga0068860_100050177 | |||
| 884 | Ga0068860_100056878 | |||
| 885 | Ga0068860_100077306 | |||
| 886 | Ga0068860_100097470 | |||
| 887 | Ga0068860_100149902 | |||
| 888 | Ga0068860_100300486 | |||
| 889 | Ga0068862_100007320 | |||
| 890 | Ga0068862_100029204 | |||
| 891 | Ga0068862_100142850 | |||
| 892 | Ga0068862_100146558 | |||
| 893 | Ga0068862_100630797 | |||
| 894 | Ga0081539_10000395 | |||
| 895 | Ga0081539_10021230 | |||
| 896 | Ga0081539_10249776 | |||
| 897 | Ga0075432_10193656 | |||
| 898 | Ga0070716_100077610 | |||
| 899 | Ga0070716_100381189 | |||
| 900 | Ga0097621_100007032 | |||
| 901 | Ga0097621_100011502 | |||
| 902 | Ga0097621_100029679 | |||
| 903 | Ga0097621_100078942 | |||
| 904 | Ga0097621_100417529 | |||
| 905 | Ga0097621_100804644 | |||
| 906 | Ga0068871_100008242 | |||
| 907 | Ga0068871_100019481 | |||
| 908 | Ga0068871_100023228 | |||
| 909 | Ga0068871_100244641 | |||
| 910 | Ga0075428_101097099 | |||
| 911 | Ga0075428_101137298 | |||
| 912 | Ga0075430_100018829 | |||
| 913 | Ga0075431_100631768 | |||
| 914 | Ga0075433_10011090 | |||
| 915 | Ga0075433_10048692 | |||
| 916 | Ga0075433_10140601 | |||
| 917 | Ga0075433_10200148 | |||
| 918 | Ga0075434_100017682 | |||
| 919 | Ga0075434_100098488 | |||
| 920 | Ga0075434_100158386 | |||
| 921 | Ga0075434_100388406 | |||
| 922 | Ga0075434_100548253 | |||
| 923 | Ga0075434_100558359 | |||
| 924 | Ga0075429_100204414 | |||
| 925 | Ga0068865_100089449 | |||
| 926 | Ga0097620_100047428 | |||
| 927 | Ga0097620_100067876 | |||
| 928 | Ga0097620_100116827 | |||
| 929 | Ga0097620_100122589 | |||
| 930 | Ga0097620_100132712 | |||
| 931 | Ga0097620_100134878 | |||
| 932 | Ga0097620_100246434 | |||
| 933 | Ga0097620_100268251 | |||
| 934 | Ga0097620_100911855 | |||
| 935 | Ga0075435_100461497 | |||
| 936 | Ga0105240_10033317 | |||
| 937 | Ga0105240_10349228 | |||
| 938 | Ga0105240_10509983 | |||
| 939 | Ga0105240_10722297 | |||
| 940 | Ga0111539_10000296 | |||
| 941 | Ga0111539_10047303 | |||
| 942 | Ga0111539_10081498 | |||
| 943 | Ga0111539_10134136 | |||
| 944 | Ga0111539_11414715 | |||
| 945 | Ga0105245_10072162 | |||
| 946 | Ga0105245_10981013 | |||
| 947 | Ga0105245_11241923 | |||
| 948 | Ga0105247_10000635 | |||
| 949 | Ga0105247_10461149 | |||
| 950 | Ga0114129_10023042 | |||
| 951 | Ga0114129_10083410 | |||
| 952 | Ga0114129_10087466 | |||
| 953 | Ga0114129_10110163 | |||
| 954 | Ga0114129_10221503 | |||
| 955 | Ga0114129_10281639 | |||
| 956 | Ga0105243_10046933 | |||
| 957 | Ga0105243_10048182 | |||
| 958 | Ga0105243_10176336 | |||
| 959 | Ga0105243_10184514 | |||
| 960 | Ga0105243_10376278 | |||
| 961 | Ga0105243_10601106 | |||
| 962 | Ga0105243_11378995 | |||
| 963 | Ga0105241_10073258 | |||
| 964 | Ga0105241_10082831 | |||
| 965 | Ga0105241_10159375 | |||
| 966 | Ga0105241_10213546 | |||
| 967 | Ga0105241_10398526 | |||
| 968 | Ga0105241_10422586 | |||
| 969 | Ga0105241_10618061 | |||
| 970 | Ga0105242_10010982 | |||
| 971 | Ga0105242_10063388 | |||
| 972 | Ga0105242_10136249 | |||
| 973 | Ga0105242_10183982 | |||
| 974 | Ga0105242_10285963 | |||
| 975 | Ga0105248_10005991 | |||
| 976 | Ga0105248_10019085 | |||
| 977 | Ga0105248_10049583 | |||
| 978 | Ga0105248_10074824 | |||
| 979 | Ga0105248_10099920 | |||
| 980 | Ga0105248_10202399 | |||
| 981 | Ga0105248_10304591 | |||
| 982 | Ga0105248_10420040 | |||
| 983 | Ga0105237_10003124 | |||
| 984 | Ga0105237_10042090 | |||
| 985 | Ga0105237_10102614 | |||
| 986 | Ga0105237_10136507 | |||
| 987 | Ga0105238_10017177 | |||
| 988 | Ga0105249_10009354 | |||
| 989 | Ga0105249_10023799 | |||
| 990 | Ga0105249_10064002 | |||
| 991 | Ga0105239_10058566 | |||
| 992 | Ga0105239_10195479 | |||
| 993 | Ga0105239_10337730 | |||
| 994 | Ga0105239_10388250 | |||
| 995 | Ga0105239_10510315 | |||
| 996 | Ga0105239_10516856 | |||
| 997 | Ga0105239_11126597 | |||
| 998 | Ga0105239_11671874 | |||
| 999 | Ga0105246_10009378 | |||
| 1000 | Ga0105246_10048464 | |||
| 1001 | Ga0105246_10123935 | |||
| 1002 | Ga0105246_10329169 | |||
| 1003 | Ga0157373_10002544 | |||
| 1004 | Ga0157373_10035422 | |||
| 1005 | Ga0157373_10047489 | |||
| 1006 | Ga0157373_10433888 | |||
| 1007 | Ga0157371_10190925 | |||
| 1008 | Ga0157374_10198389 | |||
| 1009 | Ga0157374_10641585 | |||
| 1010 | Ga0157378_10006269 | |||
| 1011 | Ga0157378_10021443 | |||
| 1012 | Ga0157378_10024293 | |||
| 1013 | Ga0157378_10091569 | |||
| 1014 | Ga0157378_10886950 | |||
| 1015 | Ga0163162_10012363 | |||
| 1016 | Ga0163162_10028788 | |||
| 1017 | Ga0163162_10086569 | |||
| 1018 | Ga0163162_10199447 | |||
| 1019 | Ga0157372_10021700 | |||
| 1020 | Ga0157372_10096513 | |||
| 1021 | Ga0157372_10228712 | |||
| 1022 | Ga0157372_10293910 | |||
| 1023 | Ga0157375_10024070 | |||
| 1024 | Ga0157375_10046273 | |||
| 1025 | Ga0157375_10080771 | |||
| 1026 | Ga0157375_10117219 | |||
| 1027 | Ga0157375_10142341 | |||
| 1028 | Ga0157375_10178954 | |||
| 1029 | Ga0157375_10513949 | |||
| 1030 | Ga0157375_10754701 | |||
| 1031 | Ga0163163_10002165 | |||
| 1032 | Ga0163163_10025050 | |||
| 1033 | Ga0163163_10076867 | |||
| 1034 | Ga0163163_10096133 | |||
| 1035 | Ga0163163_10127252 | |||
| 1036 | Ga0163163_10152696 | |||
| 1037 | Ga0163163_10247993 | |||
| 1038 | Ga0163163_10270589 | |||
| 1039 | Ga0163163_10688932 | |||
| 1040 | Ga0163163_11067109 | |||
| 1041 | Ga0163163_11217231 | |||
| 1042 | Ga0157380_10015020 | |||
| 1043 | Ga0157380_10095851 | |||
| 1044 | Ga0157380_10190757 | |||
| 1045 | Ga0157380_10206385 | |||
| 1046 | Ga0157380_10825315 | |||
| 1047 | Ga0157380_11029393 | |||
| 1048 | Ga0157377_10007824 | |||
| 1049 | Ga0157377_10102389 | |||
| 1050 | Ga0157377_10186247 | |||
| 1051 | Ga0157379_10076027 | |||
| 1052 | Ga0157379_10106348 | |||
| 1053 | Ga0157379_10106376 | |||
| 1054 | Ga0157379_10462613 | |||
| 1055 | Ga0157376_10005116 | |||
| 1056 | Ga0157376_10090655 | |||
| 1057 | Ga0157376_10585516 | |||
| 1058 | Ga0163161_10014405 | |||
| 1059 | Ga0213876_10000519 | |||
| 1060 | Ga0207697_10014619 | |||
| 1061 | Ga0207656_10006155 | |||
| 1062 | Ga0207653_10000019 | |||
| 1063 | Ga0207653_10016917 | |||
| 1064 | Ga0207653_10101690 | |||
| 1065 | Ga0207642_10066000 | |||
| 1066 | Ga0207642_10159174 | |||
| 1067 | Ga0207710_10001176 | |||
| 1068 | Ga0207688_10076813 | |||
| 1069 | Ga0207647_10060631 | |||
| 1070 | Ga0207647_10086399 | |||
| 1071 | Ga0207647_10162541 | |||
| 1072 | Ga0207645_10077852 | |||
| 1073 | Ga0207643_10001352 | |||
| 1074 | Ga0207643_10047041 | |||
| 1075 | Ga0207643_10060382 | |||
| 1076 | Ga0207643_10117502 | |||
| 1077 | Ga0207684_10000533 | |||
| 1078 | Ga0207684_10003673 | |||
| 1079 | Ga0207684_10068882 | |||
| 1080 | Ga0207684_10698075 | |||
| 1081 | Ga0207654_10047861 | |||
| 1082 | Ga0207654_10207126 | |||
| 1083 | Ga0207654_10290798 | |||
| 1084 | Ga0207707_10000044 | |||
| 1085 | Ga0207707_10041978 | |||
| 1086 | Ga0207695_10051122 | |||
| 1087 | Ga0207671_10054187 | |||
| 1088 | Ga0207671_10138040 | |||
| 1089 | Ga0207671_10215408 | |||
| 1090 | Ga0207660_10010225 | |||
| 1091 | Ga0207660_10060066 | |||
| 1092 | Ga0207662_10007106 | |||
| 1093 | Ga0207662_10025399 | |||
| 1094 | Ga0207662_10104282 | |||
| 1095 | Ga0207652_10000462 | |||
| 1096 | Ga0207646_10149705 | |||
| 1097 | Ga0207646_10260227 | |||
| 1098 | Ga0207646_10277292 | |||
| 1099 | Ga0207681_10000606 | |||
| 1100 | Ga0207681_10302837 | |||
| 1101 | Ga0207694_10004561 | |||
| 1102 | Ga0207694_10005267 | |||
| 1103 | Ga0207650_10000112 | |||
| 1104 | Ga0207650_10007618 | |||
| 1105 | Ga0207650_10086033 | |||
| 1106 | Ga0207650_10160699 | |||
| 1107 | Ga0207650_10195368 | |||
| 1108 | Ga0207650_10485335 | |||
| 1109 | Ga0207659_10026735 | |||
| 1110 | Ga0207687_10172868 | |||
| 1111 | Ga0207687_10548959 | |||
| 1112 | Ga0207644_10007284 | |||
| 1113 | Ga0207644_10042952 | |||
| 1114 | Ga0207644_10573093 | |||
| 1115 | Ga0207690_10032470 | |||
| 1116 | Ga0207706_10222222 | |||
| 1117 | Ga0207686_10036470 | |||
| 1118 | Ga0207686_10061588 | |||
| 1119 | Ga0207686_10412809 | |||
| 1120 | Ga0207709_10005963 | |||
| 1121 | Ga0207709_10009898 | |||
| 1122 | Ga0207709_10052269 | |||
| 1123 | Ga0207709_10254669 | |||
| 1124 | Ga0207709_10565193 | |||
| 1125 | Ga0207670_10000957 | |||
| 1126 | Ga0207670_10045600 | |||
| 1127 | Ga0207670_10559352 | |||
| 1128 | Ga0207669_10406348 | |||
| 1129 | Ga0207704_10221934 | |||
| 1130 | Ga0207665_10259308 | |||
| 1131 | Ga0207691_10001111 | |||
| 1132 | Ga0207691_10203798 | |||
| 1133 | Ga0207691_10557441 | |||
| 1134 | Ga0207691_10733441 | |||
| 1135 | Ga0207711_10007996 | |||
| 1136 | Ga0207711_10131716 | |||
| 1137 | Ga0207711_10300824 | |||
| 1138 | Ga0207711_10764679 | |||
| 1139 | Ga0207711_10936428 | |||
| 1140 | Ga0207689_10025774 | |||
| 1141 | Ga0207689_10029949 | |||
| 1142 | Ga0207689_10239183 | |||
| 1143 | Ga0207689_10668980 | |||
| 1144 | Ga0207679_10030908 | |||
| 1145 | Ga0207679_10050209 | |||
| 1146 | Ga0207679_11089904 | |||
| 1147 | Ga0207667_10467751 | |||
| 1148 | Ga0207651_10053973 | |||
| 1149 | Ga0207651_10074200 | |||
| 1150 | Ga0207651_10278383 | |||
| 1151 | Ga0207651_10284896 | |||
| 1152 | Ga0207651_10963195 | |||
| 1153 | Ga0207712_10030166 | |||
| 1154 | Ga0207712_10052417 | |||
| 1155 | Ga0207712_10084731 | |||
| 1156 | Ga0207712_10335740 | |||
| 1157 | Ga0207640_10105307 | |||
| 1158 | Ga0207640_10143314 | |||
| 1159 | Ga0207640_10208497 | |||
| 1160 | Ga0207658_10073476 | |||
| 1161 | Ga0207658_10143134 | |||
| 1162 | Ga0207677_10233437 | |||
| 1163 | Ga0207703_10023842 | |||
| 1164 | Ga0207703_10097938 | |||
| 1165 | Ga0207703_10182266 | |||
| 1166 | Ga0207703_10402856 | |||
| 1167 | Ga0207703_10526618 | |||
| 1168 | Ga0207639_10094632 | |||
| 1169 | Ga0207639_10095548 | |||
| 1170 | Ga0207639_10965650 | |||
| 1171 | Ga0207708_10000074 | |||
| 1172 | Ga0207708_10005201 | |||
| 1173 | Ga0207708_10008167 | |||
| 1174 | Ga0207708_10016579 | |||
| 1175 | Ga0207708_10119926 | |||
| 1176 | Ga0207708_10151749 | |||
| 1177 | Ga0207708_10166705 | |||
| 1178 | Ga0207708_10183218 | |||
| 1179 | Ga0207708_10205942 | |||
| 1180 | Ga0207708_10249316 | |||
| 1181 | Ga0207708_10837404 | |||
| 1182 | Ga0207702_10044004 | |||
| 1183 | Ga0207641_10017575 | |||
| 1184 | Ga0207641_10091951 | |||
| 1185 | Ga0207641_10105025 | |||
| 1186 | Ga0207641_10374601 | |||
| 1187 | Ga0207641_10513539 | |||
| 1188 | Ga0207648_10005481 | |||
| 1189 | Ga0207648_10055692 | |||
| 1190 | Ga0207648_10727272 | |||
| 1191 | Ga0207676_10002522 | |||
| 1192 | Ga0207676_10020870 | |||
| 1193 | Ga0207676_10181017 | |||
| 1194 | Ga0207676_10190220 | |||
| 1195 | Ga0207676_10196165 | |||
| 1196 | Ga0207676_10287243 | |||
| 1197 | Ga0207674_10004656 | |||
| 1198 | Ga0207674_10074807 | |||
| 1199 | Ga0207674_10108451 | |||
| 1200 | Ga0207674_10113680 | |||
| 1201 | Ga0207674_10232589 | |||
| 1202 | Ga0207674_10463858 | |||
| 1203 | Ga0207675_100013059 | |||
| 1204 | Ga0207675_100018268 | |||
| 1205 | Ga0207675_100027423 | |||
| 1206 | Ga0207675_100084984 | |||
| 1207 | Ga0207675_100085864 | |||
| 1208 | Ga0207675_100088148 | |||
| 1209 | Ga0207675_100147674 | |||
| 1210 | Ga0207683_10027129 | |||
| 1211 | Ga0207683_10188071 | |||
| 1212 | Ga0207698_10555749 | |||
| 1213 | Ga0207428_10037183 | |||
| 1214 | Ga0268265_10023091 | |||
| 1215 | Ga0268265_10350777 | |||
| 1216 | Ga0268265_10720639 | |||
| 1217 | Ga0268264_10012522 | |||
| 1218 | Ga0268264_10065261 | |||
| 1219 | Ga0268264_10075128 | |||
| 1220 | Ga0268264_10092832 | |||
| 1221 | Ga0268264_10122944 | |||
| 1222 | Ga0268264_10777700 | |||
| 1223 | Ga0268264_11086007 | |||
| 1224 | Ga0307513_10187380 | |||
| 1225 | Ga0307408_100033141 | |||
| 1226 | Ga0307408_100055392 | |||
| 1227 | Ga0307408_100322428 | |||
| 1228 | Ga0307405_10015144 | |||
| 1229 | Ga0307405_10106857 | |||
| 1230 | Ga0307413_10038923 | |||
| 1231 | Ga0307406_10003612 | |||
| 1232 | Ga0307406_10132496 | |||
| 1233 | Ga0307406_10200282 | |||
| 1234 | Ga0307406_10552533 | |||
| 1235 | Ga0307412_10003279 | |||
| 1236 | Ga0307412_10149986 | |||
| 1237 | Ga0307409_100043134 | |||
| 1238 | Ga0307409_101150697 | |||
| 1239 | Ga0307416_100078635 | |||
| 1240 | Ga0307414_10002715 | |||
| 1241 | Ga0307414_10498244 | |||
| 1242 | Ga0307411_10008953 | |||
| 1243 | Ga0307411_10058114 | |||
| 1244 | Ga0307415_100003868 | |||
| 1245 | Ga0373931_0491934 | |||
| 1246 | Ga0395898_0150634 | |||
| 1247 | Ga0395898_0797902 | |||
| 1248 | Ga0395905_0016508 | |||
| 1249 | Ga0242422_02492 | |||
| 1250 | Ga0242420_005171 | |||
| 1251 | Ga0242420_010415 | |||
| 1252 | Ga0436365_0067166 | |||
| 1253 | Ga0439458_0002859 | |||
| 1254 | Ga0451576_0198652 | |||
| 1255 | Ga0451576_1064431 | |||
| 1256 | Ga0495658_0173641 | |||
| 1257 | Ga0496102_0026684 | |||
| 1258 | Ga0496103_0096108 | |||
| 1259 | Ga0496104_0052096 | |||
| 1260 | Ga0496104_0614361 | |||
| 1261 | Ga0496106_0036566 | |||
| 1262 | Ga0496106_0292087 | |||
| 1263 | Ga0496108_0192612 | |||
| 1264 | Ga0496109_0638919 | |||
| 1265 | Ga0496110_0103817 | |||
| 1266 | Ga0496110_0789903 | |||
| 1267 | Ga0496112_0104941 | |||
| 1268 | Ga0496112_0127168 | |||
| 1269 | Ga0496112_0244663 | |||
| 1270 | Ga0496112_0251088 | |||
| 1271 | Ga0496112_0263161 | |||
| 1272 | Ga0496112_0520585 | |||
| 1273 | Ga0496113_0349634 | |||
| 1274 | Ga0501290_008304 | |||
| 1275 | Ga0501290_017929 | |||
| 1276 | Ga0501291_003913 | |||
| 1277 | Ga0501291_013130 | |||
| 1278 | Ga0501292_003711 | |||
| 1279 | Ga0501298_004915 | |||
| 1280 | Ga0501298_005320 | |||
| 1281 | Ga0501298_035227 | |||
| 1282 | Ga0501298_047029 | |||
| 1283 | Ga0501299_008182 | |||
| 1284 | Ga0501299_012925 | |||
| 1285 | Ga0501038_0001223 | |||
| 1286 | Ga0501076_0151317 | |||
| 1287 | Ga0501198_008940 | |||
| 1288 | Ga0501198_030520 | |||
| 1289 | Ga0501201_003313 | |||
| 1290 | Ga0501202_001485 | |||
| 1291 | Ga0501202_008610 | |||
| 1292 | Ga0501202_034974 | |||
| 1293 | Ga0501206_026039 | |||
| 1294 | Ga0501217_000392 | |||
| 1295 | Ga0501217_002225 | |||
| 1296 | Ga0501217_004543 | |||
| 1297 | Ga0501223_002306 | |||
| 1298 | Ga0501223_011718 | |||
| 1299 | Ga0501224_006823 | |||
| 1300 | Ga0501227_000419 | |||
| 1301 | Ga0501227_007003 | |||
| 1302 | Ga0501233_004145 | |||
| 1303 | Ga0501233_006722 | |||
| 1304 | Ga0501233_036860 | |||
| 1305 | Ga0501235_007599 | |||
| 1306 | Ga0501235_020840 | |||
| 1307 | Ga0501235_040932 | |||
| 1308 | Ga0501240_001485 | |||
| 1309 | Ga0501243_035626 | |||
| 1310 | Ga0501249_011770 | |||
| 1311 | Ga0501250_004278 | |||
| 1312 | Ga0501255_039539 | |||
| 1313 | Ga0501257_017061 | |||
| 1314 | Ga0501221_021636 | |||
| 1315 | Ga0501221_091514 | |||
| 1316 | Ga0501225_0002302 | |||
| 1317 | Ga0501225_0002856 | |||
| 1318 | Ga0501225_0004997 | |||
| 1319 | Ga0501225_0033365 | |||
| 1320 | Ga0501229_007533 | |||
| 1321 | Ga0501234_001008 | |||
| 1322 | Ga0501234_017699 | |||
| 1323 | Ga0501234_020935 | |||
| 1324 | Ga0501270_014408 | |||
| 1325 | Ga0501273_001762 | |||
| 1326 | Ga0501283_009959 | |||
| 1327 | Ga0501283_018484 | |||
| 1328 | Ga0501212_002675 | |||
| 1329 | Ga0501212_008442 | |||
| 1330 | Ga0501226_005607 | |||
| 1331 | Ga0501226_010780 | |||
| 1332 | nmdc:mga05p37_292778_c1 | |||
| 1333 | nmdc:mga05p37_363634_c1 | |||
| 1334 | nmdc:mga05p37_59302_c1 | |||
| 1335 | nmdc:mga05p37_96306_c1 | |||
| 1336 | nmdc:mga0qj67_284622_c1 | |||
| 1337 | nmdc:mga0qj67_82457_c1 | |||
| 1338 | nmdc:mga06r32_243708_c1 | |||
| 1339 | nmdc:mga06r32_97352_c1 | |||
| 1340 | nmdc:mga08y16_17931_c1 | |||
| 1341 | nmdc:mga08y16_285331_c1 | |||
| 1342 | nmdc:mga08y16_96939_c1 | |||
| 1343 | nmdc:mga0n895_152117_c1 | |||
| 1344 | nmdc:mga0n895_384838_c1 | |||
| 1345 | nmdc:mga0n895_435453_c1 | |||
| 1346 | nmdc:mga0n895_58744_c1 | |||
| 1347 | nmdc:mga0n895_828115_c1 | |||
| 1348 | nmdc:mga0rr50_753310_c1 | |||
| 1349 | nmdc:mga08x19_87194_c1 | |||
| 1350 | nmdc:mga0a205_114584_c1 | |||
| 1351 | nmdc:mga0a205_173939_c1 | |||
| 1352 | nmdc:mga0a205_254682_c1 | |||
| 1353 | nmdc:mga0a205_276695_c1 | |||
| 1354 | nmdc:mga0a205_324454_c1 | |||
| 1355 | nmdc:mga0a205_76795_c1 | |||
| 1356 | Ga0530510_0061580 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u4t-assembly1.cif.gz_A | structure of a nitrate/nitrite antiporter nark in nitrate-bound inward-open state | 0.3212 | 28 | 160 |
| 6w2v-assembly1.cif.gz_A | junction 23, dhr14-dhr18 | 0.3042 | 3 | 168 |
| 8fed-assembly1.cif.gz_K | structure of mce1-lucb complex from mycobacterium smegmatis (map1) | 0.2983 | 28 | 175 |
| 5a6a-assembly1.cif.gz_A | gh20c, beta-hexosaminidase from streptococcus pneumoniae in complex with ngt | 0.2968 | 45 | 165 |
| 8fed-assembly1.cif.gz_K | structure of mce1-lucb complex from mycobacterium smegmatis (map1) | 0.2967 | 28 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7585 | 46 | 162 | 1.10.1760.20 |
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7161 | 46 | 162 | 1.10.1760.20 |
| af_Q54TT3_40_280_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4368 | 28 | 165 | 1.20.1250.20 |
| 3gi7B00 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4181 | 64 | 162 | 1.20.1270.180 |
| 3gi7B00 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.3983 | 64 | 162 | 1.20.1270.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497SD91-F1-model_v4 | DedA family protein | 0.8831 | 6 | 169 |
GO:0016020
|
| AF-A0A2W0BS23-F1-model_v4 | TVP38/TMEM64 family protein | 0.8643 | 3 | 161 |
GO:0005886
|
| AF-A0A397WQV2-F1-model_v4 | VTT domain-containing protein | 0.8597 | 22 | 168 |
GO:0005886
|
| AF-A0A2W0BS23-F1-model_v4 | TVP38/TMEM64 family protein | 0.8499 | 3 | 161 |
GO:0005886
|
| AF-A0A7J4BBL0-F1-model_v4 | DedA family protein | 0.8461 | 1 | 172 |
GO:0005886
|