F474489

General Info

Members Datasets Scaffolds Average Seq Length
676 339 1352 319

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100023012|Ga0070661_1000230123
Length 357
Sequence MLNPIVPRHRRRSIADISGLTDGIRRIAMMNQVTRRIKCLLIAGGSALSVFGMAAALAQTYPLRPVRIMVPYSTGSATDVLSRVVAQKLSDAWGQTVVVDNQPGANGIPATATVANAPPDGYTLVMIAANHVVNASLYSKLPYDTVKDFRPIVRIGQVPFALCVHPALPAQTLKEFIALAKQRPGQVNYASPGNGTPGHLAMEMLKTMAGINVVHVPYKGAAQALVDVLGGQVPASFVVVASAIPQIKNGKLRPLAISSMRRSPQLPDVASVDELGYKGFDVVSWIGLAGPARMPADIVAKVSADVMKSIQQADARERIAAAGVEIVPAAADEFAAYVASEHVKWAKVVKDSGAKID

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
323 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
324 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
333 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
334 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
335 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
336 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
337 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
338 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
339 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 7.54
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100023012 3300005344 Bacteria 4463
2 JGI25151J46595_10009804 3300003187 Bacteria 4506
3 JGI25404J52841_10001563 3300003659 Bacteria 4070
4 Ga0070658_10012254 3300005327 Bacteria 6883
5 Ga0070658_10095891 3300005327 Bacteria 2449
6 Ga0070676_10022875 3300005328 Bacteria 3508
7 Ga0070676_10113463 3300005328 Bacteria 1691
8 Ga0070683_100027689 3300005329 Bacteria 5114
9 Ga0070690_100000908 3300005330 Bacteria 15095
10 Ga0070670_100023559 3300005331 Bacteria 5299
11 Ga0070670_100027762 3300005331 Bacteria 4869
12 Ga0070670_100098093 3300005331 Bacteria 2521
13 Ga0070670_100186629 3300005331 Bacteria 1800
14 Ga0070677_10000370 3300005333 Bacteria 15833
15 Ga0068869_100019634 3300005334 Bacteria 4623
16 Ga0068869_100165491 3300005334 Bacteria 1724
17 Ga0070680_100009322 3300005336 Bacteria 7539
18 Ga0070680_100026982 3300005336 Bacteria 4597
19 Ga0070682_100008128 3300005337 Bacteria 5917
20 Ga0068868_100004385 3300005338 Bacteria 9890
21 Ga0068868_100016399 3300005338 Bacteria 5500
22 Ga0068868_100022555 3300005338 Bacteria 4753
23 Ga0068868_100026640 3300005338 Bacteria 4408
24 Ga0068868_100114910 3300005338 Unclassified 2190
25 Ga0068868_100116856 3300005338 Bacteria 2172
26 Ga0068868_100278982 3300005338 Bacteria 1414
27 Ga0070689_100003632 3300005340 Bacteria 10290
28 Ga0070689_100005791 3300005340 Bacteria 8476
29 Ga0070691_10002939 3300005341 Bacteria 7641
30 Ga0070687_100002301 3300005343 Bacteria 7099
31 Ga0070687_100078007 3300005343 Bacteria 1799
32 Ga0070661_100033664 3300005344 Bacteria 3712
33 Ga0070661_100042848 3300005344 Bacteria 3305
34 Ga0070661_100050270 3300005344 Bacteria 3050
35 Ga0070661_100108517 3300005344 Bacteria 2071
36 Ga0070692_10000816 3300005345 Bacteria 10379
37 Ga0070692_10208102 3300005345 Bacteria 1150
38 Ga0070668_100053970 3300005347 Bacteria 3099
39 Ga0070668_100116748 3300005347 Bacteria 2129
40 Ga0070668_100121530 3300005347 Bacteria 2088
41 Ga0070669_100070181 3300005353 Bacteria 2589
42 Ga0070669_100148614 3300005353 Bacteria 1812
43 Ga0070669_100202627 3300005353 Bacteria 1562
44 Ga0070675_100012011 3300005354 Bacteria 6789
45 Ga0070675_100057015 3300005354 Bacteria 3220
46 Ga0070675_100117434 3300005354 Bacteria 2258
47 Ga0070675_100157743 3300005354 Bacteria 1949
48 Ga0070675_100209463 3300005354 Bacteria 1694
49 Ga0070671_100002881 3300005355 Bacteria 13394
50 Ga0070671_100067753 3300005355 Bacteria 2976
51 Ga0070671_100120412 3300005355 Bacteria 2208
52 Ga0070671_100139333 3300005355 Bacteria 2047
53 Ga0070671_100155879 3300005355 Bacteria 1929
54 Ga0070671_100171475 3300005355 Bacteria 1835
55 Ga0070674_100007693 3300005356 Bacteria 6365
56 Ga0070674_100060768 3300005356 Bacteria 2635
57 Ga0070674_100264141 3300005356 Bacteria 1357
58 Ga0070673_100031162 3300005364 Bacteria 3999
59 Ga0070673_100037927 3300005364 Bacteria 3676
60 Ga0070673_100102331 3300005364 Bacteria 2361
61 Ga0070673_100303587 3300005364 Bacteria 1406
62 Ga0070673_100416842 3300005364 Bacteria 1203
63 Ga0070688_100003398 3300005365 Bacteria 8176
64 Ga0070659_100087751 3300005366 Bacteria 2491
65 Ga0070659_100225380 3300005366 Bacteria 1548
66 Ga0070667_100125599 3300005367 Bacteria 2235
67 Ga0070667_100176394 3300005367 Bacteria 1889
68 Ga0070667_100211889 3300005367 Bacteria 1722
69 Ga0070667_100399324 3300005367 Bacteria 1251
70 Ga0070713_100240433 3300005436 Bacteria 1649
71 Ga0070701_10001430 3300005438 Bacteria 8832
72 Ga0070701_10072961 3300005438 Bacteria 1839
73 Ga0070701_10125421 3300005438 Bacteria 1452
74 Ga0070701_10234036 3300005438 Bacteria 1102
75 Ga0070705_100003639 3300005440 Bacteria 7547
76 Ga0070700_100002359 3300005441 Bacteria 9611
77 Ga0070700_100176563 3300005441 Unclassified 1483
78 Ga0070694_100016852 3300005444 Bacteria 4607
79 Ga0070708_100017828 3300005445 Bacteria 5932
80 Ga0070708_100039112 3300005445 Bacteria 4148
81 Ga0070678_100088111 3300005456 Bacteria 2372
82 Ga0070678_100156637 3300005456 Bacteria 1841
83 Ga0070662_100051540 3300005457 Bacteria 2972
84 Ga0070662_100146411 3300005457 Bacteria 1835
85 Ga0068867_100007285 3300005459 Bacteria 7827
86 Ga0068867_100053488 3300005459 Bacteria 2982
87 Ga0068867_100063107 3300005459 Bacteria 2754
88 Ga0068867_100290319 3300005459 Bacteria 1344
89 Ga0070707_100129822 3300005468 Bacteria 2450
90 Ga0070698_100094848 3300005471 Bacteria 2962
91 Ga0070699_100258974 3300005518 Bacteria 1556
92 Ga0070679_100007500 3300005530 Bacteria 10202
93 Ga0070679_100016776 3300005530 Bacteria 7078
94 Ga0070684_100049538 3300005535 Unclassified 3646
95 Ga0070684_100075591 3300005535 Bacteria 2971
96 Ga0070684_100130616 3300005535 Bacteria 2266
97 Ga0070697_100066625 3300005536 Bacteria 2944
98 Ga0070697_100075944 3300005536 Bacteria 2763
99 Ga0068853_100232365 3300005539 Bacteria 1687
100 Ga0068853_100345655 3300005539 Bacteria 1383
101 Ga0070672_100001668 3300005543 Bacteria 13828
102 Ga0070672_100087819 3300005543 Bacteria 2503
103 Ga0070672_100157268 3300005543 Bacteria 1883
104 Ga0070672_100281392 3300005543 Bacteria 1406
105 Ga0070686_100002358 3300005544 Bacteria 10404
106 Ga0070695_100000869 3300005545 Bacteria 16258
107 Ga0070695_100037903 3300005545 Bacteria 3040
108 Ga0070696_100000605 3300005546 Bacteria 23016
109 Ga0070696_100134127 3300005546 Bacteria 1804
110 Ga0070693_100000399 3300005547 Bacteria 19738
111 Ga0070665_100101574 3300005548 Bacteria 2880
112 Ga0070704_100008073 3300005549 Bacteria 6289
113 Ga0068855_100006537 3300005563 Bacteria 14176
114 Ga0068855_100016104 3300005563 Bacteria 8989
115 Ga0070664_100027578 3300005564 Bacteria 4720
116 Ga0070664_100036603 3300005564 Bacteria 4123
117 Ga0070664_100198674 3300005564 Bacteria 1789
118 Ga0068854_100009029 3300005578 Bacteria 6424
119 Ga0068854_100031407 3300005578 Bacteria 3690
120 Ga0068854_100059662 3300005578 Bacteria 2757
121 Ga0068856_100026129 3300005614 Bacteria 5693
122 Ga0068856_100216010 3300005614 Bacteria 1933
123 Ga0070702_100000114 3300005615 Bacteria 24382
124 Ga0070702_100043127 3300005615 Bacteria 2540
125 Ga0068852_100000352 3300005616 Bacteria 30946
126 Ga0068852_100000656 3300005616 Bacteria 22663
127 Ga0068852_100012307 3300005616 Bacteria 6490
128 Ga0068852_100017473 3300005616 Bacteria 5629
129 Ga0068852_100064954 3300005616 Bacteria 3183
130 Ga0068852_100416556 3300005616 Bacteria 1324
131 Ga0068859_100006008 3300005617 Bacteria 12334
132 Ga0068859_100090798 3300005617 Bacteria 3105
133 Ga0068859_100189902 3300005617 Unclassified 2138
134 Ga0068864_100001314 3300005618 Bacteria 20671
135 Ga0068864_100070002 3300005618 Bacteria 3052
136 Ga0068864_100098600 3300005618 Bacteria 2588
137 Ga0068866_10000944 3300005718 Bacteria 12772
138 Ga0068861_100015141 3300005719 Bacteria 5428
139 Ga0068861_100204585 3300005719 Bacteria 1659
140 Ga0068851_10000550 3300005834 Bacteria 16325
141 Ga0068851_10072008 3300005834 Bacteria 1790
142 Ga0068851_10090413 3300005834 Bacteria 1611
143 Ga0068870_10152194 3300005840 Bacteria 1364
144 Ga0068863_100039797 3300005841 Bacteria 4471
145 Ga0068863_100093142 3300005841 Bacteria 2859
146 Ga0068858_100003354 3300005842 Bacteria 15941
147 Ga0068858_100351606 3300005842 Bacteria 1411
148 Ga0068860_100025974 3300005843 Bacteria 5650
149 Ga0068860_100251012 3300005843 Bacteria 1723
150 Ga0068862_100015577 3300005844 Bacteria 6315
151 Ga0081455_10004547 3300005937 Bacteria 15486
152 Ga0081455_10007792 3300005937 Bacteria 11218
153 Ga0081455_10084902 3300005937 Bacteria 2583
154 Ga0081540_1001523 3300005983 Bacteria 19916
155 Ga0070717_10102983 3300006028 Bacteria 2426
156 Ga0070716_100035231 3300006173 Bacteria 2751
157 Ga0075369_10089216 3300006186 Bacteria 1374
158 Ga0075366_10049684 3300006195 Bacteria 2489
159 Ga0097621_100001037 3300006237 Bacteria 19482
160 Ga0097621_100005404 3300006237 Bacteria 9001
161 Ga0097621_100028635 3300006237 Bacteria 4391
162 Ga0097621_100101292 3300006237 Bacteria 2423
163 Ga0097621_100213088 3300006237 Bacteria 1681
164 Ga0068871_100003917 3300006358 Bacteria 10262
165 Ga0068871_100016679 3300006358 Bacteria 5540
166 Ga0068871_100120727 3300006358 Bacteria 2213
167 Ga0075428_100001027 3300006844 Bacteria 29563
168 Ga0075428_100218811 3300006844 Bacteria 2057
169 Ga0075430_100017854 3300006846 Bacteria 6039
170 Ga0075431_100000017 3300006847 Bacteria 84171
171 Ga0075433_10205103 3300006852 Bacteria 1753
172 Ga0075434_100009020 3300006871 Bacteria 9293
173 Ga0075434_100126040 3300006871 Bacteria 2577
174 Ga0068865_100003074 3300006881 Bacteria 9983
175 Ga0068865_100053576 3300006881 Bacteria 2799
176 Ga0068865_100058220 3300006881 Bacteria 2698
177 Ga0068865_100065186 3300006881 Bacteria 2565
178 Ga0068865_100109539 3300006881 Bacteria 2035
179 Ga0068865_100197566 3300006881 Unclassified 1559
180 Ga0097620_100006008 3300006931 Bacteria 12334
181 Ga0097620_100090796 3300006931 Bacteria 3105
182 Ga0097620_100189912 3300006931 Unclassified 2138
183 Ga0075435_100016629 3300007076 Bacteria 5547
184 Ga0099794_10006350 3300007265 Bacteria 4779
185 Ga0099794_10050614 3300007265 Bacteria 1998
186 Ga0099794_10109111 3300007265 Bacteria 1385
187 Ga0099795_10005686 3300007788 Bacteria 3340
188 Ga0105240_10018089 3300009093 Bacteria 9476
189 Ga0111539_10000735 3300009094 Bacteria 42613
190 Ga0111539_10039154 3300009094 Bacteria 5715
191 Ga0111539_10056550 3300009094 Bacteria 4662
192 Ga0111539_10084594 3300009094 Bacteria 3729
193 Ga0111539_10258467 3300009094 Bacteria 2027
194 Ga0111539_10293127 3300009094 Bacteria 1893
195 Ga0105245_10004254 3300009098 Bacteria 12695
196 Ga0105245_10038585 3300009098 Bacteria 4250
197 Ga0105245_10061560 3300009098 Bacteria 3384
198 Ga0105245_10219434 3300009098 Bacteria 1834
199 Ga0105247_10135348 3300009101 Bacteria 1609
200 Ga0114129_10000025 3300009147 Bacteria 116480
201 Ga0114129_10037156 3300009147 Bacteria 6876
202 Ga0114129_10207644 3300009147 Bacteria 2649
203 Ga0114129_10257932 3300009147 Bacteria 2338
204 Ga0105243_10007417 3300009148 Bacteria 8431
205 Ga0105243_10103447 3300009148 Bacteria 2368
206 Ga0105243_10159771 3300009148 Bacteria 1942
207 Ga0105243_10234225 3300009148 Bacteria 1631
208 Ga0105242_10017566 3300009176 Bacteria 5578
209 Ga0105242_10112595 3300009176 Bacteria 2322
210 Ga0105242_10313351 3300009176 Bacteria 1436
211 Ga0105248_10079432 3300009177 Bacteria 3687
212 Ga0105248_10091026 3300009177 Bacteria 3436
213 Ga0105248_10321005 3300009177 Bacteria 1744
214 Ga0105248_10381448 3300009177 Bacteria 1587
215 Ga0105237_10026873 3300009545 Bacteria 5881
216 Ga0105237_10375129 3300009545 Bacteria 1427
217 Ga0105238_10017286 3300009551 Bacteria 7328
218 Ga0105249_10059415 3300009553 Bacteria 3506
219 Ga0105249_10458674 3300009553 Bacteria 1314
220 Ga0099796_10025944 3300010159 Bacteria 1856
221 Ga0105239_10314720 3300010375 Bacteria 1765
222 Ga0105239_10454736 3300010375 Bacteria 1453
223 Ga0105246_10061121 3300011119 Bacteria 2620
224 Ga0105246_10199180 3300011119 Bacteria 1556
225 Ga0105246_10268113 3300011119 Unclassified 1363
226 Ga0157371_10054234 3300013102 Bacteria 2848
227 Ga0157369_10043993 3300013105 Bacteria 4863
228 Ga0157369_10440611 3300013105 Bacteria 1349
229 Ga0157374_10001160 3300013296 Bacteria 22449
230 Ga0157374_10021251 3300013296 Bacteria 5771
231 Ga0157374_10049172 3300013296 Bacteria 3916
232 Ga0157374_10096828 3300013296 Bacteria 2822
233 Ga0157374_10101556 3300013296 Bacteria 2758
234 Ga0157374_10214504 3300013296 Bacteria 1888
235 Ga0157378_10003312 3300013297 Bacteria 14324
236 Ga0157378_10003994 3300013297 Bacteria 13030
237 Ga0157378_10043297 3300013297 Bacteria 3997
238 Ga0157378_10073009 3300013297 Bacteria 3084
239 Ga0163162_10001182 3300013306 Bacteria 24341
240 Ga0163162_10118283 3300013306 Bacteria 2752
241 Ga0163162_10303838 3300013306 Bacteria 1728
242 Ga0157372_10002666 3300013307 Bacteria 19326
243 Ga0157375_10004782 3300013308 Bacteria 11770
244 Ga0157375_10037421 3300013308 Bacteria 4649
245 Ga0157375_10062174 3300013308 Bacteria 3709
246 Ga0157375_10108238 3300013308 Bacteria 2874
247 Ga0157375_10119372 3300013308 Bacteria 2745
248 Ga0157375_10179460 3300013308 Bacteria 2268
249 Ga0157375_10182011 3300013308 Bacteria 2253
250 Ga0157375_10217432 3300013308 Bacteria 2069
251 Ga0157375_10222337 3300013308 Bacteria 2047
252 Ga0163163_10196113 3300014325 Bacteria 2067
253 Ga0157380_10006123 3300014326 Bacteria 8434
254 Ga0157380_10030150 3300014326 Bacteria 4152
255 Ga0157380_10124447 3300014326 Bacteria 2189
256 Ga0157380_10137033 3300014326 Bacteria 2097
257 Ga0157377_10206009 3300014745 Bacteria 1251
258 Ga0157379_10067629 3300014968 Bacteria 3193
259 Ga0157379_10250535 3300014968 Bacteria 1608
260 Ga0157376_10006897 3300014969 Bacteria 8046
261 Ga0157376_10012322 3300014969 Bacteria 6343
262 Ga0157376_10023778 3300014969 Bacteria 4802
263 Ga0157376_10033941 3300014969 Bacteria 4114
264 Ga0157376_10050475 3300014969 Bacteria 3452
265 Ga0157376_10071986 3300014969 Bacteria 2939
266 Ga0157376_10084779 3300014969 Bacteria 2729
267 Ga0157376_10212180 3300014969 Bacteria 1788
268 Ga0157376_10304242 3300014969 Bacteria 1510
269 Ga0209025_1000139 3300025294 Bacteria 188553
270 Ga0207697_10036263 3300025315 Bacteria 2019
271 Ga0207656_10031568 3300025321 Bacteria 2196
272 Ga0207682_10006360 3300025893 Bacteria 4766
273 Ga0207682_10014454 3300025893 Bacteria 3075
274 Ga0207682_10019676 3300025893 Bacteria 2644
275 Ga0207642_10007512 3300025899 Bacteria 3687
276 Ga0207642_10038710 3300025899 Bacteria 2066
277 Ga0207688_10068511 3300025901 Bacteria 2010
278 Ga0207645_10016285 3300025907 Bacteria 4923
279 Ga0207645_10031525 3300025907 Bacteria 3410
280 Ga0207645_10038695 3300025907 Bacteria 3057
281 Ga0207643_10038746 3300025908 Unclassified 2678
282 Ga0207643_10062680 3300025908 Bacteria 2124
283 Ga0207643_10145659 3300025908 Bacteria 1417
284 Ga0207705_10289719 3300025909 Bacteria 1254
285 Ga0207684_10140950 3300025910 Bacteria 2072
286 Ga0207660_10306666 3300025917 Bacteria 1265
287 Ga0207662_10000152 3300025918 Bacteria 32975
288 Ga0207662_10012249 3300025918 Bacteria 4774
289 Ga0207649_10042870 3300025920 Bacteria 2763
290 Ga0207649_10053313 3300025920 Bacteria 2513
291 Ga0207652_10161311 3300025921 Bacteria 2010
292 Ga0207646_10023871 3300025922 Bacteria 5611
293 Ga0207646_10174369 3300025922 Unclassified 1942
294 Ga0207681_10186382 3300025923 Bacteria 1584
295 Ga0207694_10189223 3300025924 Bacteria 1671
296 Ga0207650_10012148 3300025925 Bacteria 5935
297 Ga0207650_10033960 3300025925 Bacteria 3698
298 Ga0207650_10340628 3300025925 Unclassified 1231
299 Ga0207659_10016895 3300025926 Bacteria 4759
300 Ga0207659_10023167 3300025926 Bacteria 4141
301 Ga0207659_10075137 3300025926 Bacteria 2478
302 Ga0207659_10092796 3300025926 Bacteria 2258
303 Ga0207659_10114579 3300025926 Bacteria 2055
304 Ga0207659_10204299 3300025926 Bacteria 1580
305 Ga0207659_10409634 3300025926 Bacteria 1135
306 Ga0207687_10003636 3300025927 Bacteria 10393
307 Ga0207687_10143684 3300025927 Bacteria 1813
308 Ga0207700_10053767 3300025928 Bacteria 3019
309 Ga0207644_10000534 3300025931 Bacteria 24639
310 Ga0207644_10008477 3300025931 Bacteria 6730
311 Ga0207644_10028614 3300025931 Bacteria 3860
312 Ga0207644_10038295 3300025931 Bacteria 3377
313 Ga0207644_10050643 3300025931 Bacteria 2978
314 Ga0207690_10072483 3300025932 Bacteria 2379
315 Ga0207706_10017660 3300025933 Bacteria 6428
316 Ga0207706_10062441 3300025933 Bacteria 3281
317 Ga0207706_10184019 3300025933 Bacteria 1835
318 Ga0207706_10289121 3300025933 Unclassified 1429
319 Ga0207706_10306268 3300025933 Unclassified 1384
320 Ga0207706_10333094 3300025933 Bacteria 1320
321 Ga0207686_10005125 3300025934 Bacteria 7046
322 Ga0207686_10041008 3300025934 Bacteria 2819
323 Ga0207670_10007111 3300025936 Bacteria 6234
324 Ga0207670_10089834 3300025936 Bacteria 2169
325 Ga0207669_10207715 3300025937 Bacteria 1427
326 Ga0207704_10002699 3300025938 Bacteria 8008
327 Ga0207704_10052252 3300025938 Bacteria 2476
328 Ga0207704_10115196 3300025938 Unclassified 1826
329 Ga0207665_10009274 3300025939 Bacteria 6461
330 Ga0207665_10039350 3300025939 Bacteria 3153
331 Ga0207691_10008629 3300025940 Bacteria 9781
332 Ga0207691_10013305 3300025940 Bacteria 7881
333 Ga0207691_10076702 3300025940 Bacteria 3012
334 Ga0207691_10082459 3300025940 Bacteria 2888
335 Ga0207691_10083141 3300025940 Bacteria 2874
336 Ga0207691_10329646 3300025940 Bacteria 1308
337 Ga0207689_10003896 3300025942 Bacteria 13591
338 Ga0207689_10033614 3300025942 Bacteria 4260
339 Ga0207689_10077876 3300025942 Unclassified 2724
340 Ga0207689_10190863 3300025942 Bacteria 1690
341 Ga0207661_10012001 3300025944 Bacteria 6295
342 Ga0207661_10052400 3300025944 Bacteria 3260
343 Ga0207661_10160623 3300025944 Bacteria 1949
344 Ga0207679_10019759 3300025945 Bacteria 4534
345 Ga0207679_10023282 3300025945 Bacteria 4232
346 Ga0207679_10086640 3300025945 Bacteria 2410
347 Ga0207667_10040778 3300025949 Bacteria 4941
348 Ga0207667_10202479 3300025949 Bacteria 2036
349 Ga0207651_10011056 3300025960 Bacteria 5033
350 Ga0207651_10024433 3300025960 Bacteria 3738
351 Ga0207651_10480777 3300025960 Bacteria 1070
352 Ga0207712_10021529 3300025961 Bacteria 4234
353 Ga0207712_10113354 3300025961 Bacteria 2038
354 Ga0207640_10023306 3300025981 Bacteria 3718
355 Ga0207640_10035930 3300025981 Bacteria 3106
356 Ga0207640_10130773 3300025981 Bacteria 1814
357 Ga0207640_10435567 3300025981 Unclassified 1076
358 Ga0207658_10121114 3300025986 Bacteria 2086
359 Ga0207677_10003783 3300026023 Bacteria 8039
360 Ga0207677_10017626 3300026023 Bacteria 4264
361 Ga0207639_10168769 3300026041 Bacteria 1851
362 Ga0207639_10245907 3300026041 Bacteria 1558
363 Ga0207678_10110735 3300026067 Bacteria 2342
364 Ga0207708_10000885 3300026075 Bacteria 22507
365 Ga0207708_10005155 3300026075 Bacteria 9637
366 Ga0207708_10048247 3300026075 Bacteria 3242
367 Ga0207702_10014041 3300026078 Bacteria 6650
368 Ga0207641_10071585 3300026088 Bacteria 2983
369 Ga0207641_10101754 3300026088 Bacteria 2532
370 Ga0207641_10119959 3300026088 Bacteria 2345
371 Ga0207641_10423629 3300026088 Bacteria 1282
372 Ga0207648_10004267 3300026089 Bacteria 14752
373 Ga0207648_10056629 3300026089 Bacteria 3420
374 Ga0207648_10339229 3300026089 Bacteria 1353
375 Ga0207676_10006882 3300026095 Bacteria 8055
376 Ga0207676_10047395 3300026095 Bacteria 3330
377 Ga0207675_100018277 3300026118 Bacteria 6536
378 Ga0207675_100019150 3300026118 Bacteria 6388
379 Ga0207675_100029164 3300026118 Bacteria 5143
380 Ga0207675_100080619 3300026118 Bacteria 3051
381 Ga0207675_100095192 3300026118 Bacteria 2802
382 Ga0207683_10000666 3300026121 Bacteria 31550
383 Ga0207683_10004510 3300026121 Bacteria 12016
384 Ga0207683_10010898 3300026121 Bacteria 7754
385 Ga0207683_10035340 3300026121 Bacteria 4345
386 Ga0207683_10056699 3300026121 Bacteria 3437
387 Ga0207683_10057711 3300026121 Bacteria 3408
388 Ga0207683_10066623 3300026121 Bacteria 3175
389 Ga0207683_10081459 3300026121 Bacteria 2873
390 Ga0207683_10166384 3300026121 Bacteria 1995
391 Ga0207698_10000262 3300026142 Bacteria 32282
392 Ga0207698_10004347 3300026142 Bacteria 8629
393 Ga0207698_10012112 3300026142 Bacteria 5628
394 Ga0207698_10056855 3300026142 Bacteria 3022
395 Ga0207698_10061171 3300026142 Bacteria 2933
396 Ga0207698_10085760 3300026142 Bacteria 2558
397 Ga0207698_10171507 3300026142 Bacteria 1911
398 Ga0207698_10275548 3300026142 Unclassified 1553
399 Ga0207698_10423142 3300026142 Bacteria 1279
400 Ga0209588_1007203 3300027671 Bacteria 3263
401 Ga0207428_10038695 3300027907 Bacteria 3875
402 Ga0207428_10187269 3300027907 Bacteria 1561
403 Ga0268266_10027553 3300028379 Bacteria 4831
404 Ga0268266_10260412 3300028379 Bacteria 1607
405 Ga0268266_10272025 3300028379 Bacteria 1573
406 Ga0268265_10068945 3300028380 Bacteria 2745
407 Ga0268265_10165953 3300028380 Bacteria 1882
408 Ga0268264_10017091 3300028381 Bacteria 5940
409 Ga0268264_10145861 3300028381 Bacteria 2116
410 Ga0307517_10000132 3300028786 Bacteria 113054
411 Ga0265338_10003603 3300028800 Bacteria 21619
412 Ga0307511_10041649 3300030521 Bacteria 3874
413 Ga0265330_10007447 3300031235 Bacteria 5333
414 Ga0265332_10006355 3300031238 Bacteria 5362
415 Ga0265328_10008594 3300031239 Bacteria 4199
416 Ga0265320_10037989 3300031240 Bacteria 2421
417 Ga0265339_10047934 3300031249 Bacteria 2345
418 Ga0265331_10004308 3300031250 Bacteria 8914
419 Ga0265316_10078322 3300031344 Bacteria 2537
420 Ga0307513_10080449 3300031456 Bacteria 3361
421 Ga0307509_10036348 3300031507 Bacteria 5393
422 Ga0307408_100097061 3300031548 Bacteria 2238
423 Ga0307408_100209361 3300031548 Bacteria 1584
424 Ga0265314_10000581 3300031711 Bacteria 45964
425 Ga0265314_10139055 3300031711 Bacteria 1504
426 Ga0265342_10008712 3300031712 Bacteria 7238
427 Ga0307516_10084722 3300031730 Bacteria 3008
428 Ga0307516_10099579 3300031730 Bacteria 2723
429 Ga0307413_10323018 3300031824 Bacteria 1180
430 Ga0307416_100024867 3300032002 Bacteria 4380
431 Ga0307414_10057854 3300032004 Unclassified 2728
432 Ga0307414_10094060 3300032004 Bacteria 2236
433 Ga0307414_10262954 3300032004 Bacteria 1441
434 Ga0307411_10020838 3300032005 Bacteria 3823
435 Ga0307415_100050566 3300032126 Bacteria 2817
436 Ga0307415_100193901 3300032126 Bacteria 1605
437 Ga0307507_10038310 3300033179 Bacteria 4864
438 Ga0373959_0020640 3300034820 Bacteria 1258
439 Ga0373928_0021592 3300035084 Bacteria 1359
440 Ga0373934_0000194 3300035086 Bacteria 22345
441 Ga0373934_0004318 3300035086 Bacteria 5248
442 Ga0373949_0011327 3300035090 Bacteria 1963
443 Ga0373952_0003059 3300035092 Bacteria 3016
444 Ga0373923_0001397 3300035111 Bacteria 6878
445 Ga0373936_0002738 3300035113 Bacteria 6566
446 Ga0373939_0004839 3300035114 Bacteria 3193
447 Ga0373939_0019869 3300035114 Bacteria 1817
448 Ga0373945_0024158 3300035116 Bacteria 2104
449 Ga0373953_0002863 3300035117 Bacteria 5261
450 Ga0373953_0022844 3300035117 Bacteria 2363
451 Ga0373954_0000856 3300035118 Bacteria 11822
452 Ga0373954_0005061 3300035118 Bacteria 5686
453 Ga0373954_0012609 3300035118 Bacteria 3760
454 Ga0373956_0000246 3300035119 Bacteria 21523
455 Ga0373957_0001067 3300035120 Bacteria 7229
456 Ga0373946_0008337 3300035171 Bacteria 3802
457 Ga0373955_0008525 3300035172 Bacteria 4765
458 Ga0373955_0068511 3300035172 Bacteria 1977
459 Ga0373961_0038365 3300035241 Bacteria 1372
460 Ga0373924_0012450 3300035410 Bacteria 3178
461 Ga0373931_0004664 3300035691 Bacteria 6272
462 Ga0373931_0009787 3300035691 Bacteria 4589
463 Ga0373931_0082057 3300035691 Bacteria 1781
464 Ga0373935_0013420 3300035692 Bacteria 4942
465 Ga0373935_0042555 3300035692 Bacteria 2856
466 Ga0373927_0010821 3300035695 Bacteria 6078
467 Ga0373927_0154500 3300035695 Bacteria 1502
468 Ga0373933_0001544 3300035724 Bacteria 13471
469 Ga0373933_0038117 3300035724 Bacteria 2823
470 Ga0373947_0289495 3300035725 Bacteria 1090
471 Ga0373937_0000899 3300036401 Bacteria 25372
472 Ga0373937_0294764 3300036401 Bacteria 1532
473 Ga0395901_0547776 3300038443 Bacteria 1173
474 Ga0436363_1718752 3300039450 Bacteria 3018
475 Ga0439453_0011353 3300041408 Bacteria 1484
476 Ga0451853_2555002 3300041512 Unclassified 1358
477 Ga0439443_005701 3300042003 Bacteria 1676
478 Ga0439435_0003117 3300042436 Bacteria 3402
479 Ga0439460_0001883 3300042461 Bacteria 5006
480 Ga0451577_0250017 3300042876 Bacteria 1605
481 Ga0451576_0067248 3300045051 Bacteria 3729
482 Ga0495592_0026344 3300046454 Bacteria 4408
483 Ga0495592_0042269 3300046454 Bacteria 3413
484 Ga0495592_0195403 3300046454 Bacteria 1369
485 Ga0495629_0015285 3300046459 Bacteria 5513
486 Ga0495638_0171446 3300046460 Bacteria 1245
487 Ga0495641_0013459 3300046461 Bacteria 4493
488 Ga0495651_0000552 3300046462 Bacteria 28835
489 Ga0495651_0020745 3300046462 Bacteria 5102
490 Ga0495653_0008217 3300046463 Bacteria 8550
491 Ga0495580_0016639 3300046472 Bacteria 5517
492 Ga0495582_0004753 3300046473 Bacteria 7635
493 Ga0495662_0006319 3300046476 Bacteria 5924
494 Ga0495594_0025930 3300046499 Bacteria 3152
495 Ga0495608_0008199 3300046511 Bacteria 7334
496 Ga0495618_0005612 3300046514 Bacteria 7630
497 Ga0495628_0017102 3300046516 Bacteria 6041
498 Ga0495630_0042299 3300046517 Bacteria 3402
499 Ga0495666_0004616 3300046526 Bacteria 6966
500 Ga0495642_0104696 3300046528 Bacteria 1207
501 Ga0495652_0078639 3300046529 Bacteria 2729
502 Ga0495652_0397658 3300046529 Bacteria 976
503 Ga0495665_0045219 3300046531 Bacteria 2339
504 Ga0495640_0033596 3300046533 Bacteria 3642
505 Ga0495640_0062185 3300046533 Bacteria 2533
506 Ga0495586_0013519 3300046535 Bacteria 4329
507 Ga0495587_0003287 3300046536 Bacteria 10789
508 Ga0495621_0019150 3300046539 Bacteria 2233
509 Ga0495621_0074951 3300046539 Unclassified 1253
510 Ga0495645_0015788 3300046543 Bacteria 5376
511 Ga0495667_0003807 3300046559 Bacteria 10126
512 Ga0495634_0013821 3300046642 Bacteria 5830
513 Ga0495635_0019458 3300046663 Bacteria 4732
514 Ga0495657_0011674 3300046675 Bacteria 6555
515 Ga0495657_0265241 3300046675 Bacteria 1031
516 Ga0495599_0003950 3300046678 Bacteria 8719
517 Ga0495647_0003278 3300046681 Bacteria 5178
518 Ga0495658_0003743 3300046683 Bacteria 7523
519 Ga0495658_0037236 3300046683 Bacteria 2688
520 Ga0495613_0007390 3300046689 Bacteria 8189
521 Ga0495600_0000566 3300046809 Bacteria 19182
522 Ga0495581_0138404 3300047315 Bacteria 1420
523 Ga0495604_0010440 3300047317 Bacteria 7359
524 Ga0495636_0016841 3300047318 Bacteria 2923
525 Ga0495674_0030703 3300047319 Bacteria 4884
526 Ga0495672_0003700 3300047320 Bacteria 12907
527 Ga0495672_0084541 3300047320 Unclassified 1760
528 Ga0495676_0225043 3300047321 Bacteria 1291
529 Ga0495680_0046000 3300047322 Bacteria 3443
530 Ga0495675_0009386 3300047444 Bacteria 6086
531 Ga0495684_0068783 3300047471 Bacteria 2692
532 Ga0496100_0409824 3300048903 Bacteria 1034
533 Ga0496101_0014365 3300048904 Bacteria 5319
534 Ga0496101_0020920 3300048904 Bacteria 4489
535 Ga0496102_0005779 3300048905 Bacteria 10516
536 Ga0496102_0047652 3300048905 Bacteria 3896
537 Ga0496102_0061432 3300048905 Bacteria 3439
538 Ga0496102_0290852 3300048905 Bacteria 1540
539 Ga0496103_0014827 3300048906 Bacteria 4633
540 Ga0496104_0005199 3300048907 Bacteria 11378
541 Ga0496104_0099994 3300048907 Bacteria 2776
542 Ga0496104_0118978 3300048907 Bacteria 2536
543 Ga0496105_0055389 3300048908 Bacteria 3274
544 Ga0496105_0153587 3300048908 Bacteria 1891
545 Ga0496106_0072209 3300048909 Bacteria 2639
546 Ga0496106_0090847 3300048909 Bacteria 2357
547 Ga0496107_0004205 3300048910 Bacteria 9729
548 Ga0496107_0018360 3300048910 Bacteria 4925
549 Ga0496107_0098911 3300048910 Bacteria 2137
550 Ga0496108_0012258 3300048911 Bacteria 6972
551 Ga0496108_0024076 3300048911 Bacteria 5011
552 Ga0496108_0048517 3300048911 Bacteria 3550
553 Ga0496108_0103937 3300048911 Bacteria 2424
554 Ga0496108_0203210 3300048911 Bacteria 1719
555 Ga0496109_0039916 3300048912 Bacteria 4250
556 Ga0496109_0048744 3300048912 Bacteria 3854
557 Ga0496109_0060973 3300048912 Unclassified 3448
558 Ga0496109_0109569 3300048912 Bacteria 2567
559 Ga0496109_0207353 3300048912 Bacteria 1843
560 Ga0496109_0394799 3300048912 Bacteria 1307
561 Ga0496110_0001255 3300048913 Bacteria 18140
562 Ga0496110_0017366 3300048913 Bacteria 6018
563 Ga0496110_0070687 3300048913 Bacteria 3093
564 Ga0496110_0072935 3300048913 Bacteria 3047
565 Ga0496110_0203926 3300048913 Bacteria 1797
566 Ga0496110_0240266 3300048913 Bacteria 1648
567 Ga0496111_0012671 3300048914 Bacteria 5714
568 Ga0496111_0073702 3300048914 Bacteria 2486
569 Ga0496111_0076093 3300048914 Bacteria 2446
570 Ga0496111_0082045 3300048914 Bacteria 2354
571 Ga0496111_0271361 3300048914 Bacteria 1258
572 Ga0496112_0041540 3300048915 Bacteria 4500
573 Ga0496112_0184333 3300048915 Bacteria 2051
574 Ga0496112_0194438 3300048915 Bacteria 1990
575 Ga0496112_0498476 3300048915 Bacteria 1153
576 Ga0496113_0102786 3300048916 Bacteria 2216
577 Ga0496113_0518838 3300048916 Bacteria 956
578 Ga0496114_0039856 3300048917 Bacteria 3887
579 Ga0496114_0047004 3300048917 Bacteria 3588
580 Ga0496114_0188462 3300048917 Bacteria 1804
581 Ga0496115_0002551 3300048918 Bacteria 13089
582 Ga0496115_0194331 3300048918 Bacteria 1676
583 Ga0496126_0024606 3300048929 Bacteria 5810
584 Ga0496126_0164308 3300048929 Bacteria 1895
585 Ga0501031_0119309 3300049568 Bacteria 1723
586 Ga0501032_0075761 3300049569 Bacteria 2240
587 Ga0501034_0028842 3300049571 Bacteria 5646
588 Ga0501036_0146888 3300049572 Bacteria 1989
589 Ga0501036_0183430 3300049572 Bacteria 1761
590 Ga0501039_0001748 3300049575 Bacteria 16036
591 Ga0501039_0107636 3300049575 Bacteria 2178
592 Ga0501040_0128124 3300049576 Bacteria 1783
593 Ga0501041_0101947 3300049577 Bacteria 1777
594 Ga0501042_0308464 3300049578 Bacteria 1143
595 Ga0501043_0047897 3300049579 Bacteria 3360
596 Ga0501046_0006925 3300049580 Bacteria 9990
597 Ga0501046_0266157 3300049580 Bacteria 1258
598 Ga0501048_0002288 3300049582 Bacteria 14613
599 Ga0501067_0025528 3300049583 Bacteria 3275
600 Ga0501068_0027403 3300049584 Bacteria 3364
601 Ga0501068_0183285 3300049584 Bacteria 1324
602 Ga0501069_0056742 3300049585 Bacteria 2182
603 Ga0501071_0015531 3300049587 Bacteria 5229
604 Ga0501071_0153152 3300049587 Bacteria 1720
605 Ga0501072_0039838 3300049588 Bacteria 3689
606 Ga0501072_0071886 3300049588 Bacteria 2733
607 Ga0501073_0047177 3300049589 Bacteria 3027
608 Ga0501074_0003219 3300049590 Bacteria 11530
609 Ga0501075_0037945 3300049591 Bacteria 3601
610 Ga0501075_0079517 3300049591 Bacteria 2481
611 Ga0501075_0192825 3300049591 Bacteria 1554
612 Ga0501076_0057360 3300049592 Bacteria 3092
613 Ga0501076_0095793 3300049592 Bacteria 2390
614 Ga0501076_0118586 3300049592 Bacteria 2142
615 Ga0501077_0110535 3300049593 Bacteria 1741
616 Ga0501079_0029518 3300049741 Bacteria 4210
617 Ga0501079_0036884 3300049741 Bacteria 3765
618 Ga0501080_0026877 3300049742 Bacteria 5351
619 Ga0501081_0066166 3300049743 Bacteria 2513
620 Ga0501081_0148924 3300049743 Bacteria 1680
621 Ga0501083_0012910 3300049744 Bacteria 5838
622 Ga0501035_0018019 3300049822 Bacteria 6509
623 Ga0501035_0131342 3300049822 Bacteria 2183
624 Ga0501044_0127577 3300049823 Bacteria 2540
625 Ga0501045_0013355 3300049824 Bacteria 5799
626 Ga0501045_0015489 3300049824 Bacteria 5409
627 nmdc:mga03683_10099_c1 3300050489 Bacteria 3378
628 nmdc:mga0k408_109427_c1 3300050493 Bacteria 1633
629 nmdc:mga06z11_165460_c1 3300050494 Bacteria 1267
630 nmdc:mga05p37_368148_c1 3300050507 Bacteria 1687
631 nmdc:mga05p37_55116_c1 3300050507 Bacteria 4891
632 nmdc:mga05p37_95_c1 3300050507 Bacteria 79379
633 nmdc:mga0qj67_14081_c1 3300050509 Bacteria 6039
634 nmdc:mga06r32_114_c1 3300050510 Bacteria 57934
635 nmdc:mga08y16_48_c1 3300050511 Bacteria 111306
636 nmdc:mga08y16_91556_c1 3300050511 Bacteria 3169
637 nmdc:mga0n895_52774_c1 3300050512 Bacteria 3992
638 nmdc:mga0n895_74948_c1 3300050512 Bacteria 3362
639 nmdc:mga0rr50_343067_c1 3300050513 Bacteria 1255
640 nmdc:mga0rr50_346809_c1 3300050513 Bacteria 1248
641 nmdc:mga0rr50_71465_c1 3300050513 Bacteria 2648
642 nmdc:mga08x19_141488_c1 3300050514 Bacteria 1625
643 nmdc:mga0sz30_70712_c1 3300050516 Bacteria 1502
644 Ga0495601_0051878 3300053077 Bacteria 2589
645 Ga0495601_0054107 3300053077 Bacteria 2539
646 Ga0495601_0122016 3300053077 Bacteria 1693
647 Ga0500635_0056375 3300053080 Bacteria 1359
648 Ga0495655_0041675 3300053083 Bacteria 1175
649 Ga0495595_0002682 3300053084 Bacteria 6981
650 Ga0495595_0137990 3300053084 Bacteria 1195
651 Ga0495619_0005430 3300053085 Bacteria 8077
652 Ga0500595_009206 3300053119 Bacteria 3997
653 Ga0500559_0018866 3300053136 Bacteria 2914
654 Ga0500573_0066250 3300053140 Bacteria 2064
655 Ga0500590_009020 3300053148 Bacteria 5004
656 Ga0500603_007763 3300053150 Bacteria 2362
657 Ga0500603_028839 3300053150 Bacteria 1419
658 Ga0500616_0027338 3300053153 Bacteria 3150
659 Ga0500616_0045691 3300053153 Bacteria 2332
660 Ga0500619_104408 3300053154 Bacteria 963
661 Ga0500636_0010129 3300053177 Bacteria 5494
662 Ga0500636_0083612 3300053177 Bacteria 1836
663 Ga0500637_0000176 3300053178 Bacteria 23911
664 Ga0501084_0019616 3300054114 Bacteria 5634
665 Ga0501084_0151867 3300054114 Bacteria 1952
666 Ga0500661_000053 3300055283 Bacteria 18041
667 Ga0501082_0026406 3300060353 Bacteria 5004
668 Ga0530510_0012300 3300061734 Bacteria 6010
669 Ga0530510_0079679 3300061734 Bacteria 2382
670 2513230407 2513020051 Bacteria 6053213
671 2842776801 2842775625 Bacteria 5587290
672 2891633768 2891633521 Bacteria 4602265
673 2894775129 2894772417 Bacteria 5305674
674 2904548896 2904541872 Bacteria 8915136
675 2929166685 2929160207 Bacteria 9075316
676 2939631380 2939631187 Bacteria 6118131
677 Ga0070661_100023012
678 JGI25151J46595_10009804
679 JGI25404J52841_10001563
680 Ga0070658_10012254
681 Ga0070658_10095891
682 Ga0070676_10022875
683 Ga0070676_10113463
684 Ga0070683_100027689
685 Ga0070690_100000908
686 Ga0070670_100023559
687 Ga0070670_100027762
688 Ga0070670_100098093
689 Ga0070670_100186629
690 Ga0070677_10000370
691 Ga0068869_100019634
692 Ga0068869_100165491
693 Ga0070680_100009322
694 Ga0070680_100026982
695 Ga0070682_100008128
696 Ga0068868_100004385
697 Ga0068868_100016399
698 Ga0068868_100022555
699 Ga0068868_100026640
700 Ga0068868_100114910
701 Ga0068868_100116856
702 Ga0068868_100278982
703 Ga0070689_100003632
704 Ga0070689_100005791
705 Ga0070691_10002939
706 Ga0070687_100002301
707 Ga0070687_100078007
708 Ga0070661_100033664
709 Ga0070661_100042848
710 Ga0070661_100050270
711 Ga0070661_100108517
712 Ga0070692_10000816
713 Ga0070692_10208102
714 Ga0070668_100053970
715 Ga0070668_100116748
716 Ga0070668_100121530
717 Ga0070669_100070181
718 Ga0070669_100148614
719 Ga0070669_100202627
720 Ga0070675_100012011
721 Ga0070675_100057015
722 Ga0070675_100117434
723 Ga0070675_100157743
724 Ga0070675_100209463
725 Ga0070671_100002881
726 Ga0070671_100067753
727 Ga0070671_100120412
728 Ga0070671_100139333
729 Ga0070671_100155879
730 Ga0070671_100171475
731 Ga0070674_100007693
732 Ga0070674_100060768
733 Ga0070674_100264141
734 Ga0070673_100031162
735 Ga0070673_100037927
736 Ga0070673_100102331
737 Ga0070673_100303587
738 Ga0070673_100416842
739 Ga0070688_100003398
740 Ga0070659_100087751
741 Ga0070659_100225380
742 Ga0070667_100125599
743 Ga0070667_100176394
744 Ga0070667_100211889
745 Ga0070667_100399324
746 Ga0070713_100240433
747 Ga0070701_10001430
748 Ga0070701_10072961
749 Ga0070701_10125421
750 Ga0070701_10234036
751 Ga0070705_100003639
752 Ga0070700_100002359
753 Ga0070700_100176563
754 Ga0070694_100016852
755 Ga0070708_100017828
756 Ga0070708_100039112
757 Ga0070678_100088111
758 Ga0070678_100156637
759 Ga0070662_100051540
760 Ga0070662_100146411
761 Ga0068867_100007285
762 Ga0068867_100053488
763 Ga0068867_100063107
764 Ga0068867_100290319
765 Ga0070707_100129822
766 Ga0070698_100094848
767 Ga0070699_100258974
768 Ga0070679_100007500
769 Ga0070679_100016776
770 Ga0070684_100049538
771 Ga0070684_100075591
772 Ga0070684_100130616
773 Ga0070697_100066625
774 Ga0070697_100075944
775 Ga0068853_100232365
776 Ga0068853_100345655
777 Ga0070672_100001668
778 Ga0070672_100087819
779 Ga0070672_100157268
780 Ga0070672_100281392
781 Ga0070686_100002358
782 Ga0070695_100000869
783 Ga0070695_100037903
784 Ga0070696_100000605
785 Ga0070696_100134127
786 Ga0070693_100000399
787 Ga0070665_100101574
788 Ga0070704_100008073
789 Ga0068855_100006537
790 Ga0068855_100016104
791 Ga0070664_100027578
792 Ga0070664_100036603
793 Ga0070664_100198674
794 Ga0068854_100009029
795 Ga0068854_100031407
796 Ga0068854_100059662
797 Ga0068856_100026129
798 Ga0068856_100216010
799 Ga0070702_100000114
800 Ga0070702_100043127
801 Ga0068852_100000352
802 Ga0068852_100000656
803 Ga0068852_100012307
804 Ga0068852_100017473
805 Ga0068852_100064954
806 Ga0068852_100416556
807 Ga0068859_100006008
808 Ga0068859_100090798
809 Ga0068859_100189902
810 Ga0068864_100001314
811 Ga0068864_100070002
812 Ga0068864_100098600
813 Ga0068866_10000944
814 Ga0068861_100015141
815 Ga0068861_100204585
816 Ga0068851_10000550
817 Ga0068851_10072008
818 Ga0068851_10090413
819 Ga0068870_10152194
820 Ga0068863_100039797
821 Ga0068863_100093142
822 Ga0068858_100003354
823 Ga0068858_100351606
824 Ga0068860_100025974
825 Ga0068860_100251012
826 Ga0068862_100015577
827 Ga0081455_10004547
828 Ga0081455_10007792
829 Ga0081455_10084902
830 Ga0081540_1001523
831 Ga0070717_10102983
832 Ga0070716_100035231
833 Ga0075369_10089216
834 Ga0075366_10049684
835 Ga0097621_100001037
836 Ga0097621_100005404
837 Ga0097621_100028635
838 Ga0097621_100101292
839 Ga0097621_100213088
840 Ga0068871_100003917
841 Ga0068871_100016679
842 Ga0068871_100120727
843 Ga0075428_100001027
844 Ga0075428_100218811
845 Ga0075430_100017854
846 Ga0075431_100000017
847 Ga0075433_10205103
848 Ga0075434_100009020
849 Ga0075434_100126040
850 Ga0068865_100003074
851 Ga0068865_100053576
852 Ga0068865_100058220
853 Ga0068865_100065186
854 Ga0068865_100109539
855 Ga0068865_100197566
856 Ga0097620_100006008
857 Ga0097620_100090796
858 Ga0097620_100189912
859 Ga0075435_100016629
860 Ga0099794_10006350
861 Ga0099794_10050614
862 Ga0099794_10109111
863 Ga0099795_10005686
864 Ga0105240_10018089
865 Ga0111539_10000735
866 Ga0111539_10039154
867 Ga0111539_10056550
868 Ga0111539_10084594
869 Ga0111539_10258467
870 Ga0111539_10293127
871 Ga0105245_10004254
872 Ga0105245_10038585
873 Ga0105245_10061560
874 Ga0105245_10219434
875 Ga0105247_10135348
876 Ga0114129_10000025
877 Ga0114129_10037156
878 Ga0114129_10207644
879 Ga0114129_10257932
880 Ga0105243_10007417
881 Ga0105243_10103447
882 Ga0105243_10159771
883 Ga0105243_10234225
884 Ga0105242_10017566
885 Ga0105242_10112595
886 Ga0105242_10313351
887 Ga0105248_10079432
888 Ga0105248_10091026
889 Ga0105248_10321005
890 Ga0105248_10381448
891 Ga0105237_10026873
892 Ga0105237_10375129
893 Ga0105238_10017286
894 Ga0105249_10059415
895 Ga0105249_10458674
896 Ga0099796_10025944
897 Ga0105239_10314720
898 Ga0105239_10454736
899 Ga0105246_10061121
900 Ga0105246_10199180
901 Ga0105246_10268113
902 Ga0157371_10054234
903 Ga0157369_10043993
904 Ga0157369_10440611
905 Ga0157374_10001160
906 Ga0157374_10021251
907 Ga0157374_10049172
908 Ga0157374_10096828
909 Ga0157374_10101556
910 Ga0157374_10214504
911 Ga0157378_10003312
912 Ga0157378_10003994
913 Ga0157378_10043297
914 Ga0157378_10073009
915 Ga0163162_10001182
916 Ga0163162_10118283
917 Ga0163162_10303838
918 Ga0157372_10002666
919 Ga0157375_10004782
920 Ga0157375_10037421
921 Ga0157375_10062174
922 Ga0157375_10108238
923 Ga0157375_10119372
924 Ga0157375_10179460
925 Ga0157375_10182011
926 Ga0157375_10217432
927 Ga0157375_10222337
928 Ga0163163_10196113
929 Ga0157380_10006123
930 Ga0157380_10030150
931 Ga0157380_10124447
932 Ga0157380_10137033
933 Ga0157377_10206009
934 Ga0157379_10067629
935 Ga0157379_10250535
936 Ga0157376_10006897
937 Ga0157376_10012322
938 Ga0157376_10023778
939 Ga0157376_10033941
940 Ga0157376_10050475
941 Ga0157376_10071986
942 Ga0157376_10084779
943 Ga0157376_10212180
944 Ga0157376_10304242
945 Ga0209025_1000139
946 Ga0207697_10036263
947 Ga0207656_10031568
948 Ga0207682_10006360
949 Ga0207682_10014454
950 Ga0207682_10019676
951 Ga0207642_10007512
952 Ga0207642_10038710
953 Ga0207688_10068511
954 Ga0207645_10016285
955 Ga0207645_10031525
956 Ga0207645_10038695
957 Ga0207643_10038746
958 Ga0207643_10062680
959 Ga0207643_10145659
960 Ga0207705_10289719
961 Ga0207684_10140950
962 Ga0207660_10306666
963 Ga0207662_10000152
964 Ga0207662_10012249
965 Ga0207649_10042870
966 Ga0207649_10053313
967 Ga0207652_10161311
968 Ga0207646_10023871
969 Ga0207646_10174369
970 Ga0207681_10186382
971 Ga0207694_10189223
972 Ga0207650_10012148
973 Ga0207650_10033960
974 Ga0207650_10340628
975 Ga0207659_10016895
976 Ga0207659_10023167
977 Ga0207659_10075137
978 Ga0207659_10092796
979 Ga0207659_10114579
980 Ga0207659_10204299
981 Ga0207659_10409634
982 Ga0207687_10003636
983 Ga0207687_10143684
984 Ga0207700_10053767
985 Ga0207644_10000534
986 Ga0207644_10008477
987 Ga0207644_10028614
988 Ga0207644_10038295
989 Ga0207644_10050643
990 Ga0207690_10072483
991 Ga0207706_10017660
992 Ga0207706_10062441
993 Ga0207706_10184019
994 Ga0207706_10289121
995 Ga0207706_10306268
996 Ga0207706_10333094
997 Ga0207686_10005125
998 Ga0207686_10041008
999 Ga0207670_10007111
1000 Ga0207670_10089834
1001 Ga0207669_10207715
1002 Ga0207704_10002699
1003 Ga0207704_10052252
1004 Ga0207704_10115196
1005 Ga0207665_10009274
1006 Ga0207665_10039350
1007 Ga0207691_10008629
1008 Ga0207691_10013305
1009 Ga0207691_10076702
1010 Ga0207691_10082459
1011 Ga0207691_10083141
1012 Ga0207691_10329646
1013 Ga0207689_10003896
1014 Ga0207689_10033614
1015 Ga0207689_10077876
1016 Ga0207689_10190863
1017 Ga0207661_10012001
1018 Ga0207661_10052400
1019 Ga0207661_10160623
1020 Ga0207679_10019759
1021 Ga0207679_10023282
1022 Ga0207679_10086640
1023 Ga0207667_10040778
1024 Ga0207667_10202479
1025 Ga0207651_10011056
1026 Ga0207651_10024433
1027 Ga0207651_10480777
1028 Ga0207712_10021529
1029 Ga0207712_10113354
1030 Ga0207640_10023306
1031 Ga0207640_10035930
1032 Ga0207640_10130773
1033 Ga0207640_10435567
1034 Ga0207658_10121114
1035 Ga0207677_10003783
1036 Ga0207677_10017626
1037 Ga0207639_10168769
1038 Ga0207639_10245907
1039 Ga0207678_10110735
1040 Ga0207708_10000885
1041 Ga0207708_10005155
1042 Ga0207708_10048247
1043 Ga0207702_10014041
1044 Ga0207641_10071585
1045 Ga0207641_10101754
1046 Ga0207641_10119959
1047 Ga0207641_10423629
1048 Ga0207648_10004267
1049 Ga0207648_10056629
1050 Ga0207648_10339229
1051 Ga0207676_10006882
1052 Ga0207676_10047395
1053 Ga0207675_100018277
1054 Ga0207675_100019150
1055 Ga0207675_100029164
1056 Ga0207675_100080619
1057 Ga0207675_100095192
1058 Ga0207683_10000666
1059 Ga0207683_10004510
1060 Ga0207683_10010898
1061 Ga0207683_10035340
1062 Ga0207683_10056699
1063 Ga0207683_10057711
1064 Ga0207683_10066623
1065 Ga0207683_10081459
1066 Ga0207683_10166384
1067 Ga0207698_10000262
1068 Ga0207698_10004347
1069 Ga0207698_10012112
1070 Ga0207698_10056855
1071 Ga0207698_10061171
1072 Ga0207698_10085760
1073 Ga0207698_10171507
1074 Ga0207698_10275548
1075 Ga0207698_10423142
1076 Ga0209588_1007203
1077 Ga0207428_10038695
1078 Ga0207428_10187269
1079 Ga0268266_10027553
1080 Ga0268266_10260412
1081 Ga0268266_10272025
1082 Ga0268265_10068945
1083 Ga0268265_10165953
1084 Ga0268264_10017091
1085 Ga0268264_10145861
1086 Ga0307517_10000132
1087 Ga0265338_10003603
1088 Ga0307511_10041649
1089 Ga0265330_10007447
1090 Ga0265332_10006355
1091 Ga0265328_10008594
1092 Ga0265320_10037989
1093 Ga0265339_10047934
1094 Ga0265331_10004308
1095 Ga0265316_10078322
1096 Ga0307513_10080449
1097 Ga0307509_10036348
1098 Ga0307408_100097061
1099 Ga0307408_100209361
1100 Ga0265314_10000581
1101 Ga0265314_10139055
1102 Ga0265342_10008712
1103 Ga0307516_10084722
1104 Ga0307516_10099579
1105 Ga0307413_10323018
1106 Ga0307416_100024867
1107 Ga0307414_10057854
1108 Ga0307414_10094060
1109 Ga0307414_10262954
1110 Ga0307411_10020838
1111 Ga0307415_100050566
1112 Ga0307415_100193901
1113 Ga0307507_10038310
1114 Ga0373959_0020640
1115 Ga0373928_0021592
1116 Ga0373934_0000194
1117 Ga0373934_0004318
1118 Ga0373949_0011327
1119 Ga0373952_0003059
1120 Ga0373923_0001397
1121 Ga0373936_0002738
1122 Ga0373939_0004839
1123 Ga0373939_0019869
1124 Ga0373945_0024158
1125 Ga0373953_0002863
1126 Ga0373953_0022844
1127 Ga0373954_0000856
1128 Ga0373954_0005061
1129 Ga0373954_0012609
1130 Ga0373956_0000246
1131 Ga0373957_0001067
1132 Ga0373946_0008337
1133 Ga0373955_0008525
1134 Ga0373955_0068511
1135 Ga0373961_0038365
1136 Ga0373924_0012450
1137 Ga0373931_0004664
1138 Ga0373931_0009787
1139 Ga0373931_0082057
1140 Ga0373935_0013420
1141 Ga0373935_0042555
1142 Ga0373927_0010821
1143 Ga0373927_0154500
1144 Ga0373933_0001544
1145 Ga0373933_0038117
1146 Ga0373947_0289495
1147 Ga0373937_0000899
1148 Ga0373937_0294764
1149 Ga0395901_0547776
1150 Ga0436363_1718752
1151 Ga0439453_0011353
1152 Ga0451853_2555002
1153 Ga0439443_005701
1154 Ga0439435_0003117
1155 Ga0439460_0001883
1156 Ga0451577_0250017
1157 Ga0451576_0067248
1158 Ga0495592_0026344
1159 Ga0495592_0042269
1160 Ga0495592_0195403
1161 Ga0495629_0015285
1162 Ga0495638_0171446
1163 Ga0495641_0013459
1164 Ga0495651_0000552
1165 Ga0495651_0020745
1166 Ga0495653_0008217
1167 Ga0495580_0016639
1168 Ga0495582_0004753
1169 Ga0495662_0006319
1170 Ga0495594_0025930
1171 Ga0495608_0008199
1172 Ga0495618_0005612
1173 Ga0495628_0017102
1174 Ga0495630_0042299
1175 Ga0495666_0004616
1176 Ga0495642_0104696
1177 Ga0495652_0078639
1178 Ga0495652_0397658
1179 Ga0495665_0045219
1180 Ga0495640_0033596
1181 Ga0495640_0062185
1182 Ga0495586_0013519
1183 Ga0495587_0003287
1184 Ga0495621_0019150
1185 Ga0495621_0074951
1186 Ga0495645_0015788
1187 Ga0495667_0003807
1188 Ga0495634_0013821
1189 Ga0495635_0019458
1190 Ga0495657_0011674
1191 Ga0495657_0265241
1192 Ga0495599_0003950
1193 Ga0495647_0003278
1194 Ga0495658_0003743
1195 Ga0495658_0037236
1196 Ga0495613_0007390
1197 Ga0495600_0000566
1198 Ga0495581_0138404
1199 Ga0495604_0010440
1200 Ga0495636_0016841
1201 Ga0495674_0030703
1202 Ga0495672_0003700
1203 Ga0495672_0084541
1204 Ga0495676_0225043
1205 Ga0495680_0046000
1206 Ga0495675_0009386
1207 Ga0495684_0068783
1208 Ga0496100_0409824
1209 Ga0496101_0014365
1210 Ga0496101_0020920
1211 Ga0496102_0005779
1212 Ga0496102_0047652
1213 Ga0496102_0061432
1214 Ga0496102_0290852
1215 Ga0496103_0014827
1216 Ga0496104_0005199
1217 Ga0496104_0099994
1218 Ga0496104_0118978
1219 Ga0496105_0055389
1220 Ga0496105_0153587
1221 Ga0496106_0072209
1222 Ga0496106_0090847
1223 Ga0496107_0004205
1224 Ga0496107_0018360
1225 Ga0496107_0098911
1226 Ga0496108_0012258
1227 Ga0496108_0024076
1228 Ga0496108_0048517
1229 Ga0496108_0103937
1230 Ga0496108_0203210
1231 Ga0496109_0039916
1232 Ga0496109_0048744
1233 Ga0496109_0060973
1234 Ga0496109_0109569
1235 Ga0496109_0207353
1236 Ga0496109_0394799
1237 Ga0496110_0001255
1238 Ga0496110_0017366
1239 Ga0496110_0070687
1240 Ga0496110_0072935
1241 Ga0496110_0203926
1242 Ga0496110_0240266
1243 Ga0496111_0012671
1244 Ga0496111_0073702
1245 Ga0496111_0076093
1246 Ga0496111_0082045
1247 Ga0496111_0271361
1248 Ga0496112_0041540
1249 Ga0496112_0184333
1250 Ga0496112_0194438
1251 Ga0496112_0498476
1252 Ga0496113_0102786
1253 Ga0496113_0518838
1254 Ga0496114_0039856
1255 Ga0496114_0047004
1256 Ga0496114_0188462
1257 Ga0496115_0002551
1258 Ga0496115_0194331
1259 Ga0496126_0024606
1260 Ga0496126_0164308
1261 Ga0501031_0119309
1262 Ga0501032_0075761
1263 Ga0501034_0028842
1264 Ga0501036_0146888
1265 Ga0501036_0183430
1266 Ga0501039_0001748
1267 Ga0501039_0107636
1268 Ga0501040_0128124
1269 Ga0501041_0101947
1270 Ga0501042_0308464
1271 Ga0501043_0047897
1272 Ga0501046_0006925
1273 Ga0501046_0266157
1274 Ga0501048_0002288
1275 Ga0501067_0025528
1276 Ga0501068_0027403
1277 Ga0501068_0183285
1278 Ga0501069_0056742
1279 Ga0501071_0015531
1280 Ga0501071_0153152
1281 Ga0501072_0039838
1282 Ga0501072_0071886
1283 Ga0501073_0047177
1284 Ga0501074_0003219
1285 Ga0501075_0037945
1286 Ga0501075_0079517
1287 Ga0501075_0192825
1288 Ga0501076_0057360
1289 Ga0501076_0095793
1290 Ga0501076_0118586
1291 Ga0501077_0110535
1292 Ga0501079_0029518
1293 Ga0501079_0036884
1294 Ga0501080_0026877
1295 Ga0501081_0066166
1296 Ga0501081_0148924
1297 Ga0501083_0012910
1298 Ga0501035_0018019
1299 Ga0501035_0131342
1300 Ga0501044_0127577
1301 Ga0501045_0013355
1302 Ga0501045_0015489
1303 nmdc:mga03683_10099_c1
1304 nmdc:mga0k408_109427_c1
1305 nmdc:mga06z11_165460_c1
1306 nmdc:mga05p37_368148_c1
1307 nmdc:mga05p37_55116_c1
1308 nmdc:mga05p37_95_c1
1309 nmdc:mga0qj67_14081_c1
1310 nmdc:mga06r32_114_c1
1311 nmdc:mga08y16_48_c1
1312 nmdc:mga08y16_91556_c1
1313 nmdc:mga0n895_52774_c1
1314 nmdc:mga0n895_74948_c1
1315 nmdc:mga0rr50_343067_c1
1316 nmdc:mga0rr50_346809_c1
1317 nmdc:mga0rr50_71465_c1
1318 nmdc:mga08x19_141488_c1
1319 nmdc:mga0sz30_70712_c1
1320 Ga0495601_0051878
1321 Ga0495601_0054107
1322 Ga0495601_0122016
1323 Ga0500635_0056375
1324 Ga0495655_0041675
1325 Ga0495595_0002682
1326 Ga0495595_0137990
1327 Ga0495619_0005430
1328 Ga0500595_009206
1329 Ga0500559_0018866
1330 Ga0500573_0066250
1331 Ga0500590_009020
1332 Ga0500603_007763
1333 Ga0500603_028839
1334 Ga0500616_0027338
1335 Ga0500616_0045691
1336 Ga0500619_104408
1337 Ga0500636_0010129
1338 Ga0500636_0083612
1339 Ga0500637_0000176
1340 Ga0501084_0019616
1341 Ga0501084_0151867
1342 Ga0500661_000053
1343 Ga0501082_0026406
1344 Ga0530510_0012300
1345 Ga0530510_0079679
1346 2513230407
1347 2842776801
1348 2891633768
1349 2894775129
1350 2904548896
1351 2929166685
1352 2939631380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

81

354

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9625 29 325
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9582 29 327
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9578 33 327
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9521 29 327
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.95 29 325
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9616 129 251 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9466 129 251 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9454 129 247 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9409 29 327 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9329 129 251 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536U479-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.995 140 226
AF-A0A4Q1HI92-F1-model_v4 NADH:flavin oxidoreductase 0.9845 29 327 GO:0009056
GO:0010181
GO:0016491
AF-A0A849MZ44-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.979 30 327
AF-A0A6N8ISF6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9767 29 328
AF-A0A5N7RZ89-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9765 29 327

Map