F474465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 675 | 406 | 1350 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0680241|Ga0501037_0680241_37_624 |
| Length | 195 |
| Sequence | MLTPLIAKLVWLAGLVGWFVIRYPFQRRAARLKVARATARSGDRVVLAVATLGQFVIPLVYVLTGFPRSANYGFHPWLALVGILVEIAALVLFRATHVQLGRNWSISLETREKHQLVTSGLYGWVRHPMYSSFLLSAVAQVLLLQNWVAGFAGLVGFLVLFLFRVGREEGLMTDTFGEQYRDYSRRTARIVPWLY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 70 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 71 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 72 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 166 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 167 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 202 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 321 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 322 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 328 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 329 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 330 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 331 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 332 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 333 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 334 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 335 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 336 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 337 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 338 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 339 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 340 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 341 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 342 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 343 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 344 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 345 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 346 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 347 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 348 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 349 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 350 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 351 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 352 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 353 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 354 | 2904699407 | |||
| 355 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 356 | 2906610324 | |||
| 357 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 358 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 359 | 2922368715 | |||
| 360 | 2922425934 | |||
| 361 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 362 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 363 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 364 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 365 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 366 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 367 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 368 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 369 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 370 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 371 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 372 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 373 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 374 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 375 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 376 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 377 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 378 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 379 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 380 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 381 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 382 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 383 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 384 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 385 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 386 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 387 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 388 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 389 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 390 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 391 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 392 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 393 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 394 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 395 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 396 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 397 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 398 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 399 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 400 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 401 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 402 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 403 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 404 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 405 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 406 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.66 |
| Metatranscriptomes | 0 |
| Isolates | 11.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.85 |
| Nodule | 9.78 |
| Rhizoplane | 7.7 |
| Rhizosphere | 72.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501037_0680241 | 3300049573 | Bacteria | 686 |
| 2 | 2214903546 | 2209111006 | Bacteria | 1416 |
| 3 | rootL2_10253805 | 3300003322 | Bacteria | 2458 |
| 4 | JGI25404J52841_10000157 | 3300003659 | Bacteria | 7634 |
| 5 | JGI25404J52841_10003760 | 3300003659 | Bacteria | 3025 |
| 6 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 7 | JGI25405J52794_10002634 | 3300003911 | Bacteria | 3103 |
| 8 | Ga0065707_10093537 | 3300005295 | Bacteria | 3615 |
| 9 | Ga0070683_100010101 | 3300005329 | Bacteria | 8099 |
| 10 | Ga0070683_100691745 | 3300005329 | Unclassified | 976 |
| 11 | Ga0068869_100361976 | 3300005334 | Unclassified | 1185 |
| 12 | Ga0070680_100004367 | 3300005336 | Bacteria | 10635 |
| 13 | Ga0070682_100336990 | 3300005337 | Bacteria | 1120 |
| 14 | Ga0070682_100457694 | 3300005337 | Bacteria | 979 |
| 15 | Ga0070661_100103748 | 3300005344 | Bacteria | 2118 |
| 16 | Ga0070661_101085872 | 3300005344 | Unclassified | 666 |
| 17 | Ga0070668_100059496 | 3300005347 | Bacteria | 2957 |
| 18 | Ga0070674_100355665 | 3300005356 | Bacteria | 1184 |
| 19 | Ga0070659_100295845 | 3300005366 | Bacteria | 1349 |
| 20 | Ga0070659_100635326 | 3300005366 | Bacteria | 919 |
| 21 | Ga0070659_100914708 | 3300005366 | Unclassified | 767 |
| 22 | Ga0070709_10041187 | 3300005434 | Bacteria | 2845 |
| 23 | Ga0070709_10047750 | 3300005434 | Bacteria | 2668 |
| 24 | Ga0070709_10068067 | 3300005434 | Bacteria | 2288 |
| 25 | Ga0070709_10193325 | 3300005434 | Bacteria | 1437 |
| 26 | Ga0070714_100023373 | 3300005435 | Bacteria | 5077 |
| 27 | Ga0070714_100112049 | 3300005435 | Bacteria | 2417 |
| 28 | Ga0070713_100100099 | 3300005436 | Bacteria | 2509 |
| 29 | Ga0070713_100149595 | 3300005436 | Bacteria | 2076 |
| 30 | Ga0070710_10010487 | 3300005437 | Bacteria | 4553 |
| 31 | Ga0070710_10095377 | 3300005437 | Bacteria | 1762 |
| 32 | Ga0070710_10866479 | 3300005437 | Bacteria | 650 |
| 33 | Ga0070711_100005899 | 3300005439 | Bacteria | 7352 |
| 34 | Ga0070711_100023728 | 3300005439 | Bacteria | 3993 |
| 35 | Ga0070711_100118870 | 3300005439 | Bacteria | 1951 |
| 36 | Ga0070705_100346017 | 3300005440 | Bacteria | 1082 |
| 37 | Ga0070705_100515256 | 3300005440 | Unclassified | 911 |
| 38 | Ga0070708_100052744 | 3300005445 | Unclassified | 3607 |
| 39 | Ga0070708_100416656 | 3300005445 | Bacteria | 1267 |
| 40 | Ga0070678_100020190 | 3300005456 | Bacteria | 4366 |
| 41 | Ga0070678_100350490 | 3300005456 | Bacteria | 1269 |
| 42 | Ga0070678_100680654 | 3300005456 | Bacteria | 925 |
| 43 | Ga0070662_100360794 | 3300005457 | Bacteria | 1192 |
| 44 | Ga0070662_100398864 | 3300005457 | Bacteria | 1135 |
| 45 | Ga0070681_10054264 | 3300005458 | Bacteria | 3993 |
| 46 | Ga0070681_10520080 | 3300005458 | Bacteria | 1103 |
| 47 | Ga0068867_100339057 | 3300005459 | Bacteria | 1251 |
| 48 | Ga0068867_100668679 | 3300005459 | Bacteria | 913 |
| 49 | Ga0070707_100056954 | 3300005468 | Bacteria | 3750 |
| 50 | Ga0070698_100170504 | 3300005471 | Bacteria | 2117 |
| 51 | Ga0070699_100246437 | 3300005518 | Bacteria | 1596 |
| 52 | Ga0070679_100016507 | 3300005530 | Bacteria | 7127 |
| 53 | Ga0070684_100018545 | 3300005535 | Bacteria | 5736 |
| 54 | Ga0070684_100545143 | 3300005535 | Bacteria | 1076 |
| 55 | Ga0070697_100639524 | 3300005536 | Bacteria | 936 |
| 56 | Ga0068853_100967803 | 3300005539 | Bacteria | 819 |
| 57 | Ga0070665_100098986 | 3300005548 | Bacteria | 2920 |
| 58 | Ga0070665_100367653 | 3300005548 | Bacteria | 1445 |
| 59 | Ga0068855_100627281 | 3300005563 | Bacteria | 1157 |
| 60 | Ga0070664_100158216 | 3300005564 | Bacteria | 2003 |
| 61 | Ga0070664_100832765 | 3300005564 | Unclassified | 863 |
| 62 | Ga0070664_101001531 | 3300005564 | Unclassified | 785 |
| 63 | Ga0070702_100354904 | 3300005615 | Bacteria | 1034 |
| 64 | Ga0068852_100216948 | 3300005616 | Bacteria | 1818 |
| 65 | Ga0068852_100227240 | 3300005616 | Bacteria | 1778 |
| 66 | Ga0068859_100039458 | 3300005617 | Plasmid | 4736 |
| 67 | Ga0068864_100620157 | 3300005618 | Bacteria | 1051 |
| 68 | Ga0068866_10218240 | 3300005718 | Bacteria | 1149 |
| 69 | Ga0068861_100079481 | 3300005719 | Bacteria | 2564 |
| 70 | Ga0068863_100110236 | 3300005841 | Bacteria | 2621 |
| 71 | Ga0068858_100054886 | 3300005842 | Bacteria | 3684 |
| 72 | Ga0068858_100203877 | 3300005842 | Bacteria | 1871 |
| 73 | Ga0068858_100586227 | 3300005842 | Bacteria | 1081 |
| 74 | Ga0068860_101094251 | 3300005843 | Bacteria | 816 |
| 75 | Ga0068862_100061041 | 3300005844 | Bacteria | 3240 |
| 76 | Ga0081455_10002775 | 3300005937 | Bacteria | 20627 |
| 77 | Ga0081455_10126164 | 3300005937 | Unclassified | 2008 |
| 78 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 79 | Ga0081540_1002952 | 3300005983 | Bacteria | 13657 |
| 80 | Ga0081540_1008602 | 3300005983 | Bacteria | 7113 |
| 81 | Ga0081540_1024259 | 3300005983 | Bacteria | 3523 |
| 82 | Ga0081540_1031671 | 3300005983 | Bacteria | 2902 |
| 83 | Ga0070717_10101024 | 3300006028 | Bacteria | 2449 |
| 84 | Ga0070717_10262011 | 3300006028 | Bacteria | 1530 |
| 85 | Ga0070717_10286940 | 3300006028 | Bacteria | 1461 |
| 86 | Ga0075432_10049962 | 3300006058 | Bacteria | 1474 |
| 87 | Ga0070715_10052783 | 3300006163 | Bacteria | 1755 |
| 88 | Ga0070716_100029117 | 3300006173 | Bacteria | 2982 |
| 89 | Ga0070716_100032263 | 3300006173 | Bacteria | 2855 |
| 90 | Ga0070716_100072459 | 3300006173 | Bacteria | 2028 |
| 91 | Ga0070716_100079094 | 3300006173 | Bacteria | 1957 |
| 92 | Ga0070716_100123125 | 3300006173 | Bacteria | 1627 |
| 93 | Ga0070712_100018358 | 3300006175 | Bacteria | 4543 |
| 94 | Ga0070712_100057663 | 3300006175 | Bacteria | 2729 |
| 95 | Ga0070712_100071040 | 3300006175 | Bacteria | 2490 |
| 96 | Ga0070712_100092004 | 3300006175 | Bacteria | 2223 |
| 97 | Ga0070712_100242605 | 3300006175 | Bacteria | 1436 |
| 98 | Ga0070712_100387349 | 3300006175 | Bacteria | 1152 |
| 99 | Ga0075362_10037398 | 3300006177 | Bacteria | 2128 |
| 100 | Ga0075367_10014569 | 3300006178 | Bacteria | 4257 |
| 101 | Ga0075367_10128464 | 3300006178 | Bacteria | 1565 |
| 102 | Ga0075427_10000354 | 3300006194 | Bacteria | 5065 |
| 103 | Ga0075366_10104621 | 3300006195 | Bacteria | 1701 |
| 104 | Ga0075366_10142200 | 3300006195 | Bacteria | 1451 |
| 105 | Ga0097621_100279573 | 3300006237 | Bacteria | 1469 |
| 106 | Ga0068871_100355788 | 3300006358 | Bacteria | 1296 |
| 107 | Ga0075428_100048886 | 3300006844 | Bacteria | 4641 |
| 108 | Ga0075428_100803382 | 3300006844 | Bacteria | 1000 |
| 109 | Ga0075430_100048619 | 3300006846 | Bacteria | 3581 |
| 110 | Ga0075430_100168667 | 3300006846 | Bacteria | 1821 |
| 111 | Ga0075430_100222511 | 3300006846 | Bacteria | 1566 |
| 112 | Ga0075431_100018424 | 3300006847 | Bacteria | 7109 |
| 113 | Ga0075431_100355595 | 3300006847 | Bacteria | 1472 |
| 114 | Ga0075431_100503924 | 3300006847 | Unclassified | 1201 |
| 115 | Ga0075433_10001379 | 3300006852 | Bacteria | 17864 |
| 116 | Ga0075434_100000955 | 3300006871 | Bacteria | 23296 |
| 117 | Ga0075434_100386467 | 3300006871 | Bacteria | 1420 |
| 118 | Ga0075434_101429902 | 3300006871 | Bacteria | 701 |
| 119 | Ga0075429_100048486 | 3300006880 | Bacteria | 3694 |
| 120 | Ga0068865_100311159 | 3300006881 | Bacteria | 1264 |
| 121 | Ga0068865_100385645 | 3300006881 | Bacteria | 1144 |
| 122 | Ga0075436_100051988 | 3300006914 | Bacteria | 2827 |
| 123 | Ga0075436_100075126 | 3300006914 | Bacteria | 2340 |
| 124 | Ga0075436_100168326 | 3300006914 | Bacteria | 1547 |
| 125 | Ga0097620_100039461 | 3300006931 | Plasmid | 4736 |
| 126 | Ga0099825_1022943 | 3300006941 | Bacteria | 3917 |
| 127 | Ga0099824_1006697 | 3300006942 | Bacteria | 15679 |
| 128 | Ga0099824_1022677 | 3300006942 | Bacteria | 4080 |
| 129 | Ga0099822_1000400 | 3300006943 | Bacteria | 38677 |
| 130 | Ga0099823_1005442 | 3300006944 | Bacteria | 12711 |
| 131 | Ga0075435_100008603 | 3300007076 | Bacteria | 7334 |
| 132 | Ga0075435_100016634 | 3300007076 | Bacteria | 5546 |
| 133 | Ga0099795_10003062 | 3300007788 | Bacteria | 4078 |
| 134 | Ga0099795_10071224 | 3300007788 | Bacteria | 1312 |
| 135 | Ga0099795_10153749 | 3300007788 | Unclassified | 944 |
| 136 | Ga0105240_10548066 | 3300009093 | Bacteria | 1280 |
| 137 | Ga0111539_10002210 | 3300009094 | Bacteria | 25988 |
| 138 | Ga0111539_10741876 | 3300009094 | Unclassified | 1143 |
| 139 | Ga0111539_10936400 | 3300009094 | Unclassified | 1007 |
| 140 | Ga0105245_10157759 | 3300009098 | Bacteria | 2150 |
| 141 | Ga0105245_10609166 | 3300009098 | Bacteria | 1119 |
| 142 | Ga0105247_10068288 | 3300009101 | Bacteria | 2216 |
| 143 | Ga0105247_10462644 | 3300009101 | Unclassified | 917 |
| 144 | Ga0114129_10004325 | 3300009147 | Bacteria | 20085 |
| 145 | Ga0114129_10090717 | 3300009147 | Unclassified | 4235 |
| 146 | Ga0114129_10288465 | 3300009147 | Unclassified | 2191 |
| 147 | Ga0114129_11559254 | 3300009147 | Unclassified | 810 |
| 148 | Ga0105243_10113349 | 3300009148 | Bacteria | 2273 |
| 149 | Ga0105248_10547560 | 3300009177 | Bacteria | 1305 |
| 150 | Ga0105237_10028665 | 3300009545 | Bacteria | 5668 |
| 151 | Ga0105237_10853728 | 3300009545 | Bacteria | 917 |
| 152 | Ga0105238_10115554 | 3300009551 | Bacteria | 2663 |
| 153 | Ga0105238_10153957 | 3300009551 | Bacteria | 2274 |
| 154 | Ga0105238_10828794 | 3300009551 | Bacteria | 941 |
| 155 | Ga0105249_10141574 | 3300009553 | Bacteria | 2307 |
| 156 | Ga0105249_10370123 | 3300009553 | Bacteria | 1456 |
| 157 | Ga0105249_10382346 | 3300009553 | Bacteria | 1434 |
| 158 | Ga0105249_10956314 | 3300009553 | Bacteria | 925 |
| 159 | Ga0099796_10001301 | 3300010159 | Bacteria | 4939 |
| 160 | Ga0105239_10092223 | 3300010375 | Bacteria | 3343 |
| 161 | Ga0105239_10239833 | 3300010375 | Bacteria | 2035 |
| 162 | Ga0105239_10247552 | 3300010375 | Bacteria | 2002 |
| 163 | Ga0105239_10739286 | 3300010375 | Bacteria | 1126 |
| 164 | Ga0105239_11038631 | 3300010375 | Bacteria | 943 |
| 165 | Ga0105246_10131389 | 3300011119 | Bacteria | 1871 |
| 166 | Ga0105246_10194883 | 3300011119 | Bacteria | 1571 |
| 167 | Ga0105246_10209452 | 3300011119 | Unclassified | 1521 |
| 168 | Ga0105246_10372548 | 3300011119 | Bacteria | 1177 |
| 169 | Ga0157370_10595798 | 3300013104 | Bacteria | 1012 |
| 170 | Ga0157369_10132290 | 3300013105 | Bacteria | 2643 |
| 171 | Ga0157369_10293846 | 3300013105 | Bacteria | 1691 |
| 172 | Ga0157369_10885796 | 3300013105 | Bacteria | 916 |
| 173 | Ga0157374_10081161 | 3300013296 | Bacteria | 3077 |
| 174 | Ga0157374_10131135 | 3300013296 | Bacteria | 2426 |
| 175 | Ga0157378_10241907 | 3300013297 | Bacteria | 1724 |
| 176 | Ga0157378_11008563 | 3300013297 | Bacteria | 867 |
| 177 | Ga0163162_10021405 | 3300013306 | Bacteria | 6368 |
| 178 | Ga0163162_10178978 | 3300013306 | Bacteria | 2246 |
| 179 | Ga0163162_10529058 | 3300013306 | Bacteria | 1308 |
| 180 | Ga0163162_10562090 | 3300013306 | Unclassified | 1268 |
| 181 | Ga0157372_10130526 | 3300013307 | Bacteria | 2891 |
| 182 | Ga0157375_10014997 | 3300013308 | Bacteria | 6931 |
| 183 | Ga0157375_10092513 | 3300013308 | Bacteria | 3088 |
| 184 | Ga0157375_10148119 | 3300013308 | Bacteria | 2480 |
| 185 | Ga0157375_10281430 | 3300013308 | Unclassified | 1826 |
| 186 | Ga0157375_10294598 | 3300013308 | Bacteria | 1786 |
| 187 | Ga0157375_10431450 | 3300013308 | Unclassified | 1484 |
| 188 | Ga0163163_10086658 | 3300014325 | Bacteria | 3141 |
| 189 | Ga0163163_10201610 | 3300014325 | Bacteria | 2038 |
| 190 | Ga0163163_10242843 | 3300014325 | Unclassified | 1851 |
| 191 | Ga0163163_10582566 | 3300014325 | Bacteria | 1182 |
| 192 | Ga0157380_10177448 | 3300014326 | Bacteria | 1868 |
| 193 | Ga0157380_11183254 | 3300014326 | Bacteria | 807 |
| 194 | Ga0157379_10177528 | 3300014968 | Bacteria | 1923 |
| 195 | Ga0157379_10295804 | 3300014968 | Bacteria | 1475 |
| 196 | Ga0157376_10013260 | 3300014969 | Bacteria | 6146 |
| 197 | Ga0157376_10160664 | 3300014969 | Bacteria | 2036 |
| 198 | Ga0157376_10242462 | 3300014969 | Bacteria | 1680 |
| 199 | Ga0163161_10185932 | 3300017792 | Unclassified | 1595 |
| 200 | Ga0163161_10243896 | 3300017792 | Bacteria | 1398 |
| 201 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 202 | Ga0209758_1054423 | 3300025297 | Bacteria | 1367 |
| 203 | Ga0209256_1032806 | 3300025299 | Bacteria | 1405 |
| 204 | Ga0207692_10022395 | 3300025898 | Bacteria | 2906 |
| 205 | Ga0207692_10132090 | 3300025898 | Bacteria | 1411 |
| 206 | Ga0207642_10019351 | 3300025899 | Bacteria | 2634 |
| 207 | Ga0207642_10088977 | 3300025899 | Unclassified | 1520 |
| 208 | Ga0207710_10003608 | 3300025900 | Bacteria | 6862 |
| 209 | Ga0207688_10048054 | 3300025901 | Bacteria | 2384 |
| 210 | Ga0207688_10314931 | 3300025901 | Unclassified | 959 |
| 211 | Ga0207680_10073650 | 3300025903 | Unclassified | 2124 |
| 212 | Ga0207685_10212805 | 3300025905 | Bacteria | 915 |
| 213 | Ga0207699_10066230 | 3300025906 | Bacteria | 2192 |
| 214 | Ga0207699_10113593 | 3300025906 | Bacteria | 1740 |
| 215 | Ga0207699_10131327 | 3300025906 | Bacteria | 1634 |
| 216 | Ga0207684_10067106 | 3300025910 | Bacteria | 3048 |
| 217 | Ga0207684_10123431 | 3300025910 | Bacteria | 2221 |
| 218 | Ga0207707_10205216 | 3300025912 | Bacteria | 1718 |
| 219 | Ga0207671_10130596 | 3300025914 | Bacteria | 1928 |
| 220 | Ga0207671_10457424 | 3300025914 | Bacteria | 1017 |
| 221 | Ga0207671_10543547 | 3300025914 | Bacteria | 926 |
| 222 | Ga0207693_10040602 | 3300025915 | Bacteria | 3664 |
| 223 | Ga0207693_10059242 | 3300025915 | Bacteria | 2999 |
| 224 | Ga0207693_10060622 | 3300025915 | Bacteria | 2964 |
| 225 | Ga0207693_10143659 | 3300025915 | Bacteria | 1876 |
| 226 | Ga0207663_10004379 | 3300025916 | Bacteria | 7015 |
| 227 | Ga0207663_10015813 | 3300025916 | Bacteria | 4172 |
| 228 | Ga0207663_10018522 | 3300025916 | Bacteria | 3904 |
| 229 | Ga0207663_10028793 | 3300025916 | Bacteria | 3256 |
| 230 | Ga0207660_10086758 | 3300025917 | Bacteria | 2311 |
| 231 | Ga0207649_10537073 | 3300025920 | Bacteria | 893 |
| 232 | Ga0207652_10475212 | 3300025921 | Bacteria | 1126 |
| 233 | Ga0207646_10057827 | 3300025922 | Bacteria | 3465 |
| 234 | Ga0207694_10121111 | 3300025924 | Bacteria | 2089 |
| 235 | Ga0207694_10639635 | 3300025924 | Bacteria | 896 |
| 236 | Ga0207650_10067804 | 3300025925 | Bacteria | 2678 |
| 237 | Ga0207659_10320734 | 3300025926 | Bacteria | 1278 |
| 238 | Ga0207687_10586276 | 3300025927 | Bacteria | 938 |
| 239 | Ga0207687_10689929 | 3300025927 | Bacteria | 866 |
| 240 | Ga0207700_10017216 | 3300025928 | Bacteria | 4823 |
| 241 | Ga0207700_10020087 | 3300025928 | Bacteria | 4528 |
| 242 | Ga0207664_10040596 | 3300025929 | Bacteria | 3620 |
| 243 | Ga0207664_10195771 | 3300025929 | Bacteria | 1742 |
| 244 | Ga0207644_10009440 | 3300025931 | Bacteria | 6406 |
| 245 | Ga0207644_10697634 | 3300025931 | Bacteria | 846 |
| 246 | Ga0207690_10511338 | 3300025932 | Unclassified | 972 |
| 247 | Ga0207706_10144813 | 3300025933 | Bacteria | 2090 |
| 248 | Ga0207706_10164906 | 3300025933 | Bacteria | 1947 |
| 249 | Ga0207706_10220062 | 3300025933 | Unclassified | 1662 |
| 250 | Ga0207709_10775635 | 3300025935 | Bacteria | 772 |
| 251 | Ga0207669_10017711 | 3300025937 | Plasmid | 3662 |
| 252 | Ga0207669_11133205 | 3300025937 | Bacteria | 661 |
| 253 | Ga0207704_10434299 | 3300025938 | Bacteria | 1044 |
| 254 | Ga0207665_10001963 | 3300025939 | Bacteria | 13843 |
| 255 | Ga0207665_10032721 | 3300025939 | Bacteria | 3443 |
| 256 | Ga0207665_10034597 | 3300025939 | Bacteria | 3352 |
| 257 | Ga0207665_10067647 | 3300025939 | Bacteria | 2433 |
| 258 | Ga0207665_10097794 | 3300025939 | Bacteria | 2044 |
| 259 | Ga0207691_10303336 | 3300025940 | Unclassified | 1372 |
| 260 | Ga0207711_10438845 | 3300025941 | Bacteria | 1215 |
| 261 | Ga0207689_10039377 | 3300025942 | Bacteria | 3913 |
| 262 | Ga0207661_10011213 | 3300025944 | Bacteria | 6484 |
| 263 | Ga0207679_10068177 | 3300025945 | Bacteria | 2672 |
| 264 | Ga0207667_10792947 | 3300025949 | Bacteria | 944 |
| 265 | Ga0207712_10238984 | 3300025961 | Bacteria | 1462 |
| 266 | Ga0207668_10408160 | 3300025972 | Bacteria | 1150 |
| 267 | Ga0207668_10806776 | 3300025972 | Unclassified | 831 |
| 268 | Ga0207703_10089041 | 3300026035 | Bacteria | 2592 |
| 269 | Ga0207703_10151218 | 3300026035 | Bacteria | 2024 |
| 270 | Ga0207639_10259398 | 3300026041 | Bacteria | 1519 |
| 271 | Ga0207639_10260032 | 3300026041 | Bacteria | 1518 |
| 272 | Ga0207678_10007287 | 3300026067 | Bacteria | 9802 |
| 273 | Ga0207648_10144013 | 3300026089 | Bacteria | 2102 |
| 274 | Ga0207676_10011889 | 3300026095 | Bacteria | 6228 |
| 275 | Ga0207674_10248745 | 3300026116 | Bacteria | 1725 |
| 276 | Ga0207675_100214659 | 3300026118 | Bacteria | 1852 |
| 277 | Ga0207683_10006102 | 3300026121 | Bacteria | 10317 |
| 278 | Ga0207683_10011399 | 3300026121 | Bacteria | 7585 |
| 279 | Ga0207683_10290693 | 3300026121 | Bacteria | 1494 |
| 280 | Ga0207683_10454822 | 3300026121 | Bacteria | 1180 |
| 281 | Ga0207683_10460508 | 3300026121 | Unclassified | 1173 |
| 282 | Ga0207698_10347042 | 3300026142 | Bacteria | 1400 |
| 283 | Ga0209389_1000230 | 3300027296 | Bacteria | 37484 |
| 284 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 285 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 286 | Ga0209489_102489 | 3300027361 | Bacteria | 37484 |
| 287 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 288 | Ga0209700_102336 | 3300027363 | Bacteria | 38715 |
| 289 | Ga0209179_1000668 | 3300027512 | Bacteria | 3661 |
| 290 | Ga0209813_10009378 | 3300027866 | Bacteria | 2502 |
| 291 | Ga0207428_10000175 | 3300027907 | Bacteria | 89715 |
| 292 | Ga0207428_10273598 | 3300027907 | Unclassified | 1255 |
| 293 | Ga0268266_10019159 | 3300028379 | Bacteria | 5827 |
| 294 | Ga0268266_10446349 | 3300028379 | Bacteria | 1229 |
| 295 | Ga0268265_10940311 | 3300028380 | Unclassified | 851 |
| 296 | Ga0268264_11128136 | 3300028381 | Bacteria | 793 |
| 297 | Ga0307515_10073384 | 3300028794 | Bacteria | 4600 |
| 298 | Ga0265332_10018826 | 3300031238 | Bacteria | 3049 |
| 299 | Ga0265325_10062220 | 3300031241 | Bacteria | 1891 |
| 300 | Ga0265340_10004896 | 3300031247 | Bacteria | 7453 |
| 301 | Ga0265331_10043689 | 3300031250 | Bacteria | 2169 |
| 302 | Ga0265313_10137039 | 3300031595 | Unclassified | 1055 |
| 303 | Ga0316579_10048653 | 3300031691 | Bacteria | 1981 |
| 304 | Ga0316585_10100666 | 3300032137 | Bacteria | 948 |
| 305 | Ga0373950_0003065 | 3300034818 | Unclassified | 2359 |
| 306 | Ga0373926_0123916 | 3300035083 | Bacteria | 975 |
| 307 | Ga0373928_0012919 | 3300035084 | Unclassified | 1671 |
| 308 | Ga0373929_0093477 | 3300035085 | Unclassified | 749 |
| 309 | Ga0373934_0124112 | 3300035086 | Bacteria | 1051 |
| 310 | Ga0373934_0144400 | 3300035086 | Unclassified | 974 |
| 311 | Ga0373944_0017338 | 3300035089 | Bacteria | 2043 |
| 312 | Ga0373944_0055243 | 3300035089 | Unclassified | 1261 |
| 313 | Ga0373951_0001848 | 3300035091 | Bacteria | 5472 |
| 314 | Ga0373952_0092455 | 3300035092 | Unclassified | 787 |
| 315 | Ga0373923_0014643 | 3300035111 | Bacteria | 2950 |
| 316 | Ga0373923_0172325 | 3300035111 | Bacteria | 991 |
| 317 | Ga0373936_0027816 | 3300035113 | Bacteria | 2219 |
| 318 | Ga0373936_0202018 | 3300035113 | Unclassified | 877 |
| 319 | Ga0373939_0004023 | 3300035114 | Bacteria | 3462 |
| 320 | Ga0373941_0046147 | 3300035115 | Bacteria | 1367 |
| 321 | Ga0373945_0104768 | 3300035116 | Bacteria | 1110 |
| 322 | Ga0373953_0040633 | 3300035117 | Bacteria | 1848 |
| 323 | Ga0373953_0349405 | 3300035117 | Unclassified | 648 |
| 324 | Ga0373954_0070128 | 3300035118 | Bacteria | 1665 |
| 325 | Ga0373956_0046703 | 3300035119 | Bacteria | 1936 |
| 326 | Ga0373956_0079733 | 3300035119 | Bacteria | 1501 |
| 327 | Ga0373957_0105222 | 3300035120 | Bacteria | 1133 |
| 328 | Ga0373960_0005831 | 3300035121 | Bacteria | 2866 |
| 329 | Ga0373943_0006001 | 3300035170 | Bacteria | 5452 |
| 330 | Ga0373943_0018913 | 3300035170 | Bacteria | 3167 |
| 331 | Ga0373943_0122973 | 3300035170 | Bacteria | 1381 |
| 332 | Ga0373943_0313718 | 3300035170 | Unclassified | 893 |
| 333 | Ga0373946_0022748 | 3300035171 | Unclassified | 2443 |
| 334 | Ga0373946_0106299 | 3300035171 | Bacteria | 1265 |
| 335 | Ga0373946_0213334 | 3300035171 | Unclassified | 929 |
| 336 | Ga0373955_0047251 | 3300035172 | Bacteria | 2330 |
| 337 | Ga0373961_0055335 | 3300035241 | Unclassified | 1188 |
| 338 | Ga0373962_0015824 | 3300035242 | Bacteria | 1939 |
| 339 | Ga0316574_0002113 | 3300035398 | Bacteria | 9858 |
| 340 | Ga0373924_0047382 | 3300035410 | Bacteria | 1773 |
| 341 | Ga0373924_0346146 | 3300035410 | Unclassified | 662 |
| 342 | Ga0373931_0103125 | 3300035691 | Bacteria | 1607 |
| 343 | Ga0373931_0125032 | 3300035691 | Unclassified | 1474 |
| 344 | Ga0373931_0315127 | 3300035691 | Bacteria | 970 |
| 345 | Ga0373931_0696751 | 3300035691 | Unclassified | 671 |
| 346 | Ga0373935_0009442 | 3300035692 | Bacteria | 5836 |
| 347 | Ga0373935_0009482 | 3300035692 | Bacteria | 5824 |
| 348 | Ga0373927_0035553 | 3300035695 | Bacteria | 3239 |
| 349 | Ga0373927_0035641 | 3300035695 | Bacteria | 3235 |
| 350 | Ga0373927_0092247 | 3300035695 | Bacteria | 1967 |
| 351 | Ga0373927_0151119 | 3300035695 | Bacteria | 1520 |
| 352 | Ga0373927_0151907 | 3300035695 | Unclassified | 1516 |
| 353 | Ga0373933_0067278 | 3300035724 | Bacteria | 2173 |
| 354 | Ga0373933_0258833 | 3300035724 | Unclassified | 1122 |
| 355 | Ga0373947_0003160 | 3300035725 | Bacteria | 9805 |
| 356 | Ga0373947_0056730 | 3300035725 | Bacteria | 2368 |
| 357 | Ga0373947_0120325 | 3300035725 | Bacteria | 1667 |
| 358 | Ga0373937_0080281 | 3300036401 | Bacteria | 3016 |
| 359 | Ga0373925_0003762 | 3300037068 | Bacteria | 11659 |
| 360 | Ga0373925_0039828 | 3300037068 | Bacteria | 3477 |
| 361 | Ga0373925_0331326 | 3300037068 | Bacteria | 1233 |
| 362 | Ga0395905_0037866 | 3300037471 | Bacteria | 4526 |
| 363 | Ga0395905_0119480 | 3300037471 | Bacteria | 2477 |
| 364 | Ga0395905_1254591 | 3300037471 | Unclassified | 645 |
| 365 | Ga0436365_0818135 | 3300039437 | Bacteria | 1535 |
| 366 | Ga0436360_0119969 | 3300039438 | Bacteria | 3712 |
| 367 | Ga0436361_1079311 | 3300039447 | Bacteria | 2511 |
| 368 | Ga0436363_0520046 | 3300039450 | Bacteria | 5596 |
| 369 | Ga0453684_0613583 | 3300044712 | Bacteria | 1191 |
| 370 | Ga0466967_0721292 | 3300045976 | Unclassified | 988 |
| 371 | Ga0495592_0072780 | 3300046454 | Unclassified | 2500 |
| 372 | Ga0495592_0135377 | 3300046454 | Bacteria | 1719 |
| 373 | Ga0495603_0003383 | 3300046455 | Bacteria | 9499 |
| 374 | Ga0495603_0058755 | 3300046455 | Unclassified | 2273 |
| 375 | Ga0495603_0274436 | 3300046455 | Unclassified | 969 |
| 376 | Ga0495591_082145 | 3300046458 | Unclassified | 820 |
| 377 | Ga0495629_0003887 | 3300046459 | Bacteria | 11254 |
| 378 | Ga0495629_0049074 | 3300046459 | Unclassified | 2959 |
| 379 | Ga0495629_0106392 | 3300046459 | Bacteria | 1957 |
| 380 | Ga0495629_0147664 | 3300046459 | Bacteria | 1635 |
| 381 | Ga0495641_0025447 | 3300046461 | Bacteria | 2905 |
| 382 | Ga0495651_0279060 | 3300046462 | Bacteria | 1130 |
| 383 | Ga0495653_0011422 | 3300046463 | Bacteria | 7258 |
| 384 | Ga0495580_0022700 | 3300046472 | Bacteria | 4614 |
| 385 | Ga0495580_0125171 | 3300046472 | Bacteria | 1784 |
| 386 | Ga0495580_0156975 | 3300046472 | Bacteria | 1575 |
| 387 | Ga0495582_0006191 | 3300046473 | Bacteria | 6662 |
| 388 | Ga0495582_0196669 | 3300046473 | Bacteria | 1151 |
| 389 | Ga0495582_0374330 | 3300046473 | Unclassified | 820 |
| 390 | Ga0495605_0231228 | 3300046474 | Unclassified | 796 |
| 391 | Ga0495639_0196149 | 3300046475 | Bacteria | 987 |
| 392 | Ga0495662_0128880 | 3300046476 | Unclassified | 1243 |
| 393 | Ga0495664_0052425 | 3300046477 | Bacteria | 2424 |
| 394 | Ga0495664_0135490 | 3300046477 | Bacteria | 1492 |
| 395 | Ga0495664_0142123 | 3300046477 | Unclassified | 1455 |
| 396 | Ga0495664_0169067 | 3300046477 | Bacteria | 1326 |
| 397 | Ga0495664_0246569 | 3300046477 | Bacteria | 1080 |
| 398 | Ga0495585_0100951 | 3300046492 | Unclassified | 1543 |
| 399 | Ga0495585_0209636 | 3300046492 | Bacteria | 988 |
| 400 | Ga0495594_0014908 | 3300046499 | Bacteria | 4079 |
| 401 | Ga0495594_0160602 | 3300046499 | Unclassified | 1277 |
| 402 | Ga0495596_0108178 | 3300046500 | Bacteria | 1080 |
| 403 | Ga0495583_0066676 | 3300046506 | Bacteria | 1592 |
| 404 | Ga0495583_0090081 | 3300046506 | Unclassified | 1322 |
| 405 | Ga0495606_0000960 | 3300046507 | Bacteria | 42272 |
| 406 | Ga0495606_0030301 | 3300046507 | Bacteria | 3782 |
| 407 | Ga0495608_0039225 | 3300046511 | Unclassified | 3176 |
| 408 | Ga0495616_0165634 | 3300046513 | Unclassified | 991 |
| 409 | Ga0495618_0124214 | 3300046514 | Unclassified | 1652 |
| 410 | Ga0495628_0063408 | 3300046516 | Bacteria | 2896 |
| 411 | Ga0495630_0168654 | 3300046517 | Bacteria | 1667 |
| 412 | Ga0495630_0197117 | 3300046517 | Unclassified | 1536 |
| 413 | Ga0495643_0063003 | 3300046522 | Bacteria | 1962 |
| 414 | Ga0495643_0098258 | 3300046522 | Bacteria | 1503 |
| 415 | Ga0495644_0001216 | 3300046523 | Bacteria | 10533 |
| 416 | Ga0495663_0065779 | 3300046525 | Unclassified | 1146 |
| 417 | Ga0495666_0075316 | 3300046526 | Bacteria | 1600 |
| 418 | Ga0495666_0141410 | 3300046526 | Bacteria | 1122 |
| 419 | Ga0495652_0027986 | 3300046529 | Unclassified | 4964 |
| 420 | Ga0495652_0469079 | 3300046529 | Bacteria | 878 |
| 421 | Ga0495654_0166804 | 3300046530 | Bacteria | 963 |
| 422 | Ga0495665_0162786 | 3300046531 | Unclassified | 1162 |
| 423 | Ga0495665_0233958 | 3300046531 | Bacteria | 948 |
| 424 | Ga0495586_0141950 | 3300046535 | Unclassified | 1348 |
| 425 | Ga0495586_0299897 | 3300046535 | Bacteria | 921 |
| 426 | Ga0495645_0006752 | 3300046543 | Bacteria | 7974 |
| 427 | Ga0495622_0002104 | 3300046557 | Bacteria | 9729 |
| 428 | Ga0495622_0034099 | 3300046557 | Unclassified | 2375 |
| 429 | Ga0495667_0032377 | 3300046559 | Bacteria | 3504 |
| 430 | Ga0495656_0000452 | 3300046615 | Bacteria | 13375 |
| 431 | Ga0495668_0560110 | 3300046616 | Bacteria | 631 |
| 432 | Ga0495634_0104007 | 3300046642 | Bacteria | 1832 |
| 433 | Ga0495611_0013498 | 3300046648 | Bacteria | 3479 |
| 434 | Ga0495625_0035962 | 3300046660 | Bacteria | 3645 |
| 435 | Ga0495625_0532690 | 3300046660 | Bacteria | 714 |
| 436 | Ga0495635_0028895 | 3300046663 | Bacteria | 3854 |
| 437 | Ga0495635_0769755 | 3300046663 | Bacteria | 621 |
| 438 | Ga0495659_0074239 | 3300046664 | Unclassified | 1279 |
| 439 | Ga0495661_0148113 | 3300046665 | Bacteria | 1270 |
| 440 | Ga0495588_0105081 | 3300046674 | Bacteria | 1485 |
| 441 | Ga0495588_0222611 | 3300046674 | Unclassified | 996 |
| 442 | Ga0495588_0379107 | 3300046674 | Bacteria | 743 |
| 443 | Ga0495588_0457965 | 3300046674 | Unclassified | 669 |
| 444 | Ga0495657_0120262 | 3300046675 | Bacteria | 1655 |
| 445 | Ga0495599_0093393 | 3300046678 | Unclassified | 1877 |
| 446 | Ga0495646_0127090 | 3300046680 | Bacteria | 1438 |
| 447 | Ga0495646_0177250 | 3300046680 | Unclassified | 1171 |
| 448 | Ga0495647_0017683 | 3300046681 | Bacteria | 2526 |
| 449 | Ga0495647_0025807 | 3300046681 | Unclassified | 2149 |
| 450 | Ga0495658_0000152 | 3300046683 | Bacteria | 38860 |
| 451 | Ga0495658_0060968 | 3300046683 | Bacteria | 2165 |
| 452 | Ga0495658_0164776 | 3300046683 | Bacteria | 1369 |
| 453 | Ga0495669_0163447 | 3300046684 | Unclassified | 1057 |
| 454 | Ga0495613_0035612 | 3300046689 | Bacteria | 3693 |
| 455 | Ga0495613_0080390 | 3300046689 | Unclassified | 2369 |
| 456 | Ga0495624_0109447 | 3300046690 | Bacteria | 1699 |
| 457 | Ga0495670_0002048 | 3300046691 | Bacteria | 9938 |
| 458 | Ga0495670_0522110 | 3300046691 | Bacteria | 645 |
| 459 | Ga0495671_0051859 | 3300046692 | Bacteria | 2040 |
| 460 | Ga0495649_0029075 | 3300046694 | Bacteria | 3061 |
| 461 | Ga0495589_0085264 | 3300046794 | Bacteria | 1535 |
| 462 | Ga0495589_0140828 | 3300046794 | Unclassified | 1155 |
| 463 | Ga0495600_0000371 | 3300046809 | Bacteria | 23444 |
| 464 | Ga0495581_0041117 | 3300047315 | Bacteria | 2675 |
| 465 | Ga0495581_0190812 | 3300047315 | Unclassified | 1198 |
| 466 | Ga0495604_0100204 | 3300047317 | Bacteria | 2130 |
| 467 | Ga0495674_0067393 | 3300047319 | Bacteria | 3101 |
| 468 | Ga0495676_0096964 | 3300047321 | Bacteria | 2191 |
| 469 | Ga0495676_0202754 | 3300047321 | Unclassified | 1377 |
| 470 | Ga0495680_0015678 | 3300047322 | Bacteria | 6528 |
| 471 | Ga0495680_0032529 | 3300047322 | Bacteria | 4232 |
| 472 | Ga0495683_0082848 | 3300047323 | Bacteria | 1562 |
| 473 | Ga0495683_0144586 | 3300047323 | Unclassified | 1112 |
| 474 | Ga0495679_057236 | 3300047446 | Unclassified | 1153 |
| 475 | Ga0495673_0027237 | 3300047469 | Bacteria | 2723 |
| 476 | Ga0495684_0000833 | 3300047471 | Bacteria | 24987 |
| 477 | Ga0495686_0052729 | 3300047472 | Bacteria | 2550 |
| 478 | Ga0495593_0012351 | 3300047673 | Bacteria | 4881 |
| 479 | Ga0495593_0044713 | 3300047673 | Bacteria | 2367 |
| 480 | Ga0495593_0151254 | 3300047673 | Bacteria | 1174 |
| 481 | Ga0495602_0147759 | 3300048088 | Unclassified | 1852 |
| 482 | Ga0495614_0032444 | 3300048089 | Bacteria | 2248 |
| 483 | Ga0496100_0023884 | 3300048903 | Bacteria | 3722 |
| 484 | Ga0496100_0046287 | 3300048903 | Bacteria | 2796 |
| 485 | Ga0496100_0533881 | 3300048903 | Bacteria | 906 |
| 486 | Ga0496100_0668278 | 3300048903 | Bacteria | 810 |
| 487 | Ga0496101_0002683 | 3300048904 | Bacteria | 10925 |
| 488 | Ga0496101_0027147 | 3300048904 | Bacteria | 3985 |
| 489 | Ga0496101_0378532 | 3300048904 | Bacteria | 1114 |
| 490 | Ga0496102_0029585 | 3300048905 | Bacteria | 4902 |
| 491 | Ga0496102_0173288 | 3300048905 | Bacteria | 2031 |
| 492 | Ga0496102_0296113 | 3300048905 | Bacteria | 1525 |
| 493 | Ga0496102_0442623 | 3300048905 | Bacteria | 1219 |
| 494 | Ga0496102_0486477 | 3300048905 | Bacteria | 1156 |
| 495 | Ga0496103_0551204 | 3300048906 | Bacteria | 736 |
| 496 | Ga0496104_0020954 | 3300048907 | Bacteria | 5997 |
| 497 | Ga0496104_0021918 | 3300048907 | Bacteria | 5867 |
| 498 | Ga0496104_0056665 | 3300048907 | Plasmid | 3707 |
| 499 | Ga0496104_0148552 | 3300048907 | Unclassified | 2250 |
| 500 | Ga0496104_0273433 | 3300048907 | Bacteria | 1602 |
| 501 | Ga0496104_0277393 | 3300048907 | Bacteria | 1589 |
| 502 | Ga0496105_0011493 | 3300048908 | Bacteria | 6997 |
| 503 | Ga0496105_0252132 | 3300048908 | Unclassified | 1429 |
| 504 | Ga0496105_0258336 | 3300048908 | Bacteria | 1409 |
| 505 | Ga0496105_0683295 | 3300048908 | Bacteria | 789 |
| 506 | Ga0496106_0035505 | 3300048909 | Bacteria | 3728 |
| 507 | Ga0496106_0226033 | 3300048909 | Unclassified | 1493 |
| 508 | Ga0496106_0270586 | 3300048909 | Bacteria | 1360 |
| 509 | Ga0496106_0369412 | 3300048909 | Bacteria | 1152 |
| 510 | Ga0496107_0014897 | 3300048910 | Bacteria | 5444 |
| 511 | Ga0496107_0094909 | 3300048910 | Bacteria | 2182 |
| 512 | Ga0496107_0162424 | 3300048910 | Bacteria | 1655 |
| 513 | Ga0496108_0211722 | 3300048911 | Bacteria | 1683 |
| 514 | Ga0496108_0264707 | 3300048911 | Bacteria | 1496 |
| 515 | Ga0496109_0121636 | 3300048912 | Bacteria | 2432 |
| 516 | Ga0496109_0372815 | 3300048912 | Bacteria | 1348 |
| 517 | Ga0496111_0126533 | 3300048914 | Bacteria | 1889 |
| 518 | Ga0496111_0233245 | 3300048914 | Bacteria | 1367 |
| 519 | Ga0496112_0002652 | 3300048915 | Bacteria | 14459 |
| 520 | Ga0496112_0006924 | 3300048915 | Bacteria | 10006 |
| 521 | Ga0496112_0007055 | 3300048915 | Bacteria | 9926 |
| 522 | Ga0496112_0085311 | 3300048915 | Bacteria | 3124 |
| 523 | Ga0496112_0200299 | 3300048915 | Bacteria | 1956 |
| 524 | Ga0496112_0290949 | 3300048915 | Bacteria | 1579 |
| 525 | Ga0496113_0203589 | 3300048916 | Bacteria | 1574 |
| 526 | Ga0496113_0205113 | 3300048916 | Bacteria | 1568 |
| 527 | Ga0496113_0240322 | 3300048916 | Bacteria | 1445 |
| 528 | Ga0496114_0005717 | 3300048917 | Bacteria | 9754 |
| 529 | Ga0496114_0175993 | 3300048917 | Bacteria | 1867 |
| 530 | Ga0496114_0211103 | 3300048917 | Bacteria | 1703 |
| 531 | Ga0496114_0659092 | 3300048917 | Bacteria | 920 |
| 532 | Ga0496115_0042702 | 3300048918 | Bacteria | 3613 |
| 533 | Ga0496115_0134648 | 3300048918 | Unclassified | 2037 |
| 534 | Ga0496115_0504219 | 3300048918 | Bacteria | 972 |
| 535 | Ga0496119_0084552 | 3300048922 | Bacteria | 1819 |
| 536 | Ga0496120_0145935 | 3300048923 | Bacteria | 1195 |
| 537 | Ga0496121_0037996 | 3300048924 | Bacteria | 4270 |
| 538 | Ga0496124_0453135 | 3300048927 | Bacteria | 874 |
| 539 | Ga0496125_0055070 | 3300048928 | Bacteria | 3244 |
| 540 | Ga0496126_0018206 | 3300048929 | Bacteria | 6970 |
| 541 | Ga0496126_0018910 | 3300048929 | Bacteria | 6806 |
| 542 | Ga0496126_0029391 | 3300048929 | Bacteria | 5222 |
| 543 | Ga0496126_0039680 | 3300048929 | Bacteria | 4366 |
| 544 | Ga0496126_0074468 | 3300048929 | Bacteria | 3015 |
| 545 | Ga0496126_0790014 | 3300048929 | Bacteria | 729 |
| 546 | Ga0495682_0072095 | 3300049460 | Bacteria | 1243 |
| 547 | Ga0501043_0291534 | 3300049579 | Bacteria | 1249 |
| 548 | Ga0501035_0192343 | 3300049822 | Bacteria | 1754 |
| 549 | Ga0501044_0278618 | 3300049823 | Bacteria | 1606 |
| 550 | nmdc:mga00v17_12557_c1 | 3300050491 | Bacteria | 4678 |
| 551 | nmdc:mga0yw44_186409_c1 | 3300050492 | Bacteria | 1367 |
| 552 | nmdc:mga0yw44_222972_c1 | 3300050492 | Bacteria | 1250 |
| 553 | nmdc:mga0yw44_24303_c1 | 3300050492 | Bacteria | 3428 |
| 554 | nmdc:mga0k408_137259_c1 | 3300050493 | Bacteria | 1453 |
| 555 | nmdc:mga05p37_1144820_c1 | 3300050507 | Unclassified | 810 |
| 556 | nmdc:mga05p37_680_c1 | 3300050507 | Bacteria | 37674 |
| 557 | nmdc:mga09592_1311_c1 | 3300050508 | Bacteria | 19973 |
| 558 | nmdc:mga0qj67_486890_c1 | 3300050509 | Bacteria | 992 |
| 559 | nmdc:mga0qj67_720594_c1 | 3300050509 | Bacteria | 793 |
| 560 | nmdc:mga0qj67_875_c1 | 3300050509 | Bacteria | 20656 |
| 561 | nmdc:mga06r32_3262_c1 | 3300050510 | Bacteria | 14521 |
| 562 | nmdc:mga08y16_101911_c1 | 3300050511 | Bacteria | 2989 |
| 563 | nmdc:mga08y16_532777_c1 | 3300050511 | Bacteria | 1190 |
| 564 | nmdc:mga0n895_2135_c1 | 3300050512 | Bacteria | 15275 |
| 565 | nmdc:mga0n895_3658_c1 | 3300050512 | Bacteria | 12435 |
| 566 | nmdc:mga0rr50_125025_c1 | 3300050513 | Bacteria | 2052 |
| 567 | nmdc:mga0rr50_63553_c1 | 3300050513 | Plasmid | 2788 |
| 568 | nmdc:mga0rr50_9668_c1 | 3300050513 | Bacteria | 6079 |
| 569 | nmdc:mga08x19_140157_c1 | 3300050514 | Unclassified | 1633 |
| 570 | nmdc:mga08x19_215326_c1 | 3300050514 | Bacteria | 1319 |
| 571 | nmdc:mga0a205_40976_c1 | 3300050515 | Bacteria | 4460 |
| 572 | nmdc:mga0sz30_33709_c1 | 3300050516 | Bacteria | 2129 |
| 573 | Ga0495601_0066618 | 3300053077 | Unclassified | 2292 |
| 574 | Ga0495601_0687118 | 3300053077 | Bacteria | 653 |
| 575 | Ga0495612_0021507 | 3300053078 | Bacteria | 2588 |
| 576 | Ga0495612_0079469 | 3300053078 | Bacteria | 1377 |
| 577 | Ga0495612_0167445 | 3300053078 | Unclassified | 961 |
| 578 | Ga0495655_0098803 | 3300053083 | Bacteria | 861 |
| 579 | Ga0495595_0001947 | 3300053084 | Bacteria | 8016 |
| 580 | Ga0495619_0000226 | 3300053085 | Bacteria | 40937 |
| 581 | Ga0495619_0002788 | 3300053085 | Bacteria | 11403 |
| 582 | Ga0495619_0030303 | 3300053085 | Plasmid | 3502 |
| 583 | Ga0495619_0124427 | 3300053085 | Unclassified | 1769 |
| 584 | Ga0495619_0186193 | 3300053085 | Bacteria | 1437 |
| 585 | Ga0500651_0159063 | 3300053093 | Bacteria | 1352 |
| 586 | Ga0500569_018798 | 3300053109 | Bacteria | 1790 |
| 587 | Ga0500569_141263 | 3300053109 | Bacteria | 810 |
| 588 | Ga0500642_0120475 | 3300053130 | Archaea | 1227 |
| 589 | Ga0500652_173064 | 3300053131 | Bacteria | 888 |
| 590 | Ga0500561_0019450 | 3300053137 | Bacteria | 1573 |
| 591 | Ga0500616_0072837 | 3300053153 | Bacteria | 1746 |
| 592 | Ga0500622_0015411 | 3300053156 | Bacteria | 4093 |
| 593 | Ga0500636_0022085 | 3300053177 | Bacteria | 3765 |
| 594 | Ga0500645_012587 | 3300053730 | Bacteria | 2733 |
| 595 | 2513679847 | 2513237098 | Bacteria | 9902361 |
| 596 | 2513705672 | 2513237102 | Bacteria | 7703324 |
| 597 | 2524438971 | 2524023205 | Bacteria | 8918781 |
| 598 | 2524463541 | 2524023210 | Bacteria | 9029266 |
| 599 | 2524538267 | 2524023228 | Bacteria | 10118060 |
| 600 | 2528857730 | 2528768022 | Bacteria | 10457665 |
| 601 | 2728755197 | 2728368998 | Bacteria | 8720350 |
| 602 | 2745078918 | 2744054633 | Bacteria | 8678936 |
| 603 | 2824604322 | 2824600985 | Bacteria | 8488197 |
| 604 | 2824614205 | 2824609381 | Bacteria | 8672835 |
| 605 | 2824624448 | 2824617872 | Bacteria | 8814715 |
| 606 | 2824634231 | 2824626560 | Bacteria | 8813858 |
| 607 | 2824640900 | 2824635225 | Bacteria | 8785348 |
| 608 | 2824649150 | 2824644064 | Bacteria | 8743947 |
| 609 | 2824658343 | 2824653114 | Bacteria | 8493680 |
| 610 | 2824662980 | 2824661429 | Bacteria | 9877870 |
| 611 | 2824709205 | 2824704595 | Bacteria | 9667483 |
| 612 | 2824718934 | 2824714736 | Bacteria | 8717648 |
| 613 | 2824728870 | 2824723954 | Bacteria | 8758240 |
| 614 | 2824757784 | 2824753945 | Bacteria | 9787441 |
| 615 | 2824768704 | 2824763712 | Bacteria | 9792355 |
| 616 | 2879100953 | 2879099564 | Bacteria | 10442239 |
| 617 | 2885390646 | 2885383462 | Bacteria | 9473874 |
| 618 | 2885412335 | 2885409591 | Bacteria | 9235467 |
| 619 | 2888421514 | 2888419890 | Bacteria | 7857137 |
| 620 | 2903758756 | 2903748898 | Bacteria | 9972761 |
| 621 | 2903772880 | 2903768456 | Bacteria | 9749579 |
| 622 | 2904706689 | |||
| 623 | 2904710398 | |||
| 624 | 2904711632 | 2904711408 | Bacteria | 9771557 |
| 625 | 2906612083 | |||
| 626 | 2906642613 | 2906635258 | Bacteria | 8601019 |
| 627 | 2906668066 | 2906660503 | Bacteria | 8595048 |
| 628 | 2922371642 | |||
| 629 | 2922427212 | |||
| 630 | 2929616986 | 2929615660 | Bacteria | 9193770 |
| 631 | 2929625729 | 2929624759 | Bacteria | 9339455 |
| 632 | 2932790724 | 2932784394 | Bacteria | 9704911 |
| 633 | 2932811910 | 2932809354 | Bacteria | 9135765 |
| 634 | 2932822604 | 2932818245 | Bacteria | 9955613 |
| 635 | 2932831189 | 2932828146 | Bacteria | 9745859 |
| 636 | 2933577732 | 2933577622 | Bacteria | 9116884 |
| 637 | 2935624774 | 2935616580 | Bacteria | 9032984 |
| 638 | 2935645999 | 2935638405 | Bacteria | 10015038 |
| 639 | 2935670662 | 2935665750 | Bacteria | 9571747 |
| 640 | 2935679588 | 2935675223 | Bacteria | 9928132 |
| 641 | 2935691396 | 2935684952 | Bacteria | 9590419 |
| 642 | 2935701957 | 2935694250 | Bacteria | 9291695 |
| 643 | 2935704582 | 2935703347 | Bacteria | 10242284 |
| 644 | 2935719230 | 2935713505 | Bacteria | 9608509 |
| 645 | 2935729170 | 2935722832 | Bacteria | 9608746 |
| 646 | 2935737589 | 2935732158 | Bacteria | 9706831 |
| 647 | 2935746965 | 2935741537 | Bacteria | 9707219 |
| 648 | 2935758236 | 2935750917 | Bacteria | 9590372 |
| 649 | 2935768913 | 2935760218 | Bacteria | 9817913 |
| 650 | 2935807980 | 2935801545 | Bacteria | 9301974 |
| 651 | 2935816432 | 2935810662 | Bacteria | 9401221 |
| 652 | 2935835279 | 2935827899 | Bacteria | 10038562 |
| 653 | 2935842827 | 2935837841 | Bacteria | 9454360 |
| 654 | 2935863404 | 2935855204 | Bacteria | 9035059 |
| 655 | 2935871515 | 2935864058 | Bacteria | 9784707 |
| 656 | 2935881764 | 2935873716 | Bacteria | 9632195 |
| 657 | 2935963819 | 2935959822 | Bacteria | 7869783 |
| 658 | 2935991718 | 2935984226 | Bacteria | 8302647 |
| 659 | 2935993817 | 2935992306 | Bacteria | 9802711 |
| 660 | 2936010407 | 2936002035 | Bacteria | 9362176 |
| 661 | 2936042616 | 2936037263 | Bacteria | 9446081 |
| 662 | 2940563854 | 2940556831 | Bacteria | 9590747 |
| 663 | 2941512873 | 2941507105 | Bacteria | 8166816 |
| 664 | 2941520825 | 2941515067 | Bacteria | 8166720 |
| 665 | 2941528840 | 2941523033 | Bacteria | 8169134 |
| 666 | 2941547577 | 2941538514 | Bacteria | 9402094 |
| 667 | 3005476390 | 3005474847 | Bacteria | 9259049 |
| 668 | 8006977941 | 8006973647 | Bacteria | 10679141 |
| 669 | 8016516121 | 8016511872 | Bacteria | 9921665 |
| 670 | 8019560905 | 8019555841 | Bacteria | 9642137 |
| 671 | 8019570988 | 8019565922 | Bacteria | 9639779 |
| 672 | 8019579874 | 8019576017 | Bacteria | 10049540 |
| 673 | 8019587584 | 8019586578 | Bacteria | 10212056 |
| 674 | 8019603748 | 8019597564 | Bacteria | 10041141 |
| 675 | 8055748632 | 8055742211 | Bacteria | 9226248 |
| 676 | Ga0501037_0680241 | |||
| 677 | 2214903546 | |||
| 678 | rootL2_10253805 | |||
| 679 | JGI25404J52841_10000157 | |||
| 680 | JGI25404J52841_10003760 | |||
| 681 | Ga0055526_1000017 | |||
| 682 | JGI25405J52794_10002634 | |||
| 683 | Ga0065707_10093537 | |||
| 684 | Ga0070683_100010101 | |||
| 685 | Ga0070683_100691745 | |||
| 686 | Ga0068869_100361976 | |||
| 687 | Ga0070680_100004367 | |||
| 688 | Ga0070682_100336990 | |||
| 689 | Ga0070682_100457694 | |||
| 690 | Ga0070661_100103748 | |||
| 691 | Ga0070661_101085872 | |||
| 692 | Ga0070668_100059496 | |||
| 693 | Ga0070674_100355665 | |||
| 694 | Ga0070659_100295845 | |||
| 695 | Ga0070659_100635326 | |||
| 696 | Ga0070659_100914708 | |||
| 697 | Ga0070709_10041187 | |||
| 698 | Ga0070709_10047750 | |||
| 699 | Ga0070709_10068067 | |||
| 700 | Ga0070709_10193325 | |||
| 701 | Ga0070714_100023373 | |||
| 702 | Ga0070714_100112049 | |||
| 703 | Ga0070713_100100099 | |||
| 704 | Ga0070713_100149595 | |||
| 705 | Ga0070710_10010487 | |||
| 706 | Ga0070710_10095377 | |||
| 707 | Ga0070710_10866479 | |||
| 708 | Ga0070711_100005899 | |||
| 709 | Ga0070711_100023728 | |||
| 710 | Ga0070711_100118870 | |||
| 711 | Ga0070705_100346017 | |||
| 712 | Ga0070705_100515256 | |||
| 713 | Ga0070708_100052744 | |||
| 714 | Ga0070708_100416656 | |||
| 715 | Ga0070678_100020190 | |||
| 716 | Ga0070678_100350490 | |||
| 717 | Ga0070678_100680654 | |||
| 718 | Ga0070662_100360794 | |||
| 719 | Ga0070662_100398864 | |||
| 720 | Ga0070681_10054264 | |||
| 721 | Ga0070681_10520080 | |||
| 722 | Ga0068867_100339057 | |||
| 723 | Ga0068867_100668679 | |||
| 724 | Ga0070707_100056954 | |||
| 725 | Ga0070698_100170504 | |||
| 726 | Ga0070699_100246437 | |||
| 727 | Ga0070679_100016507 | |||
| 728 | Ga0070684_100018545 | |||
| 729 | Ga0070684_100545143 | |||
| 730 | Ga0070697_100639524 | |||
| 731 | Ga0068853_100967803 | |||
| 732 | Ga0070665_100098986 | |||
| 733 | Ga0070665_100367653 | |||
| 734 | Ga0068855_100627281 | |||
| 735 | Ga0070664_100158216 | |||
| 736 | Ga0070664_100832765 | |||
| 737 | Ga0070664_101001531 | |||
| 738 | Ga0070702_100354904 | |||
| 739 | Ga0068852_100216948 | |||
| 740 | Ga0068852_100227240 | |||
| 741 | Ga0068859_100039458 | |||
| 742 | Ga0068864_100620157 | |||
| 743 | Ga0068866_10218240 | |||
| 744 | Ga0068861_100079481 | |||
| 745 | Ga0068863_100110236 | |||
| 746 | Ga0068858_100054886 | |||
| 747 | Ga0068858_100203877 | |||
| 748 | Ga0068858_100586227 | |||
| 749 | Ga0068860_101094251 | |||
| 750 | Ga0068862_100061041 | |||
| 751 | Ga0081455_10002775 | |||
| 752 | Ga0081455_10126164 | |||
| 753 | Ga0081540_1000007 | |||
| 754 | Ga0081540_1002952 | |||
| 755 | Ga0081540_1008602 | |||
| 756 | Ga0081540_1024259 | |||
| 757 | Ga0081540_1031671 | |||
| 758 | Ga0070717_10101024 | |||
| 759 | Ga0070717_10262011 | |||
| 760 | Ga0070717_10286940 | |||
| 761 | Ga0075432_10049962 | |||
| 762 | Ga0070715_10052783 | |||
| 763 | Ga0070716_100029117 | |||
| 764 | Ga0070716_100032263 | |||
| 765 | Ga0070716_100072459 | |||
| 766 | Ga0070716_100079094 | |||
| 767 | Ga0070716_100123125 | |||
| 768 | Ga0070712_100018358 | |||
| 769 | Ga0070712_100057663 | |||
| 770 | Ga0070712_100071040 | |||
| 771 | Ga0070712_100092004 | |||
| 772 | Ga0070712_100242605 | |||
| 773 | Ga0070712_100387349 | |||
| 774 | Ga0075362_10037398 | |||
| 775 | Ga0075367_10014569 | |||
| 776 | Ga0075367_10128464 | |||
| 777 | Ga0075427_10000354 | |||
| 778 | Ga0075366_10104621 | |||
| 779 | Ga0075366_10142200 | |||
| 780 | Ga0097621_100279573 | |||
| 781 | Ga0068871_100355788 | |||
| 782 | Ga0075428_100048886 | |||
| 783 | Ga0075428_100803382 | |||
| 784 | Ga0075430_100048619 | |||
| 785 | Ga0075430_100168667 | |||
| 786 | Ga0075430_100222511 | |||
| 787 | Ga0075431_100018424 | |||
| 788 | Ga0075431_100355595 | |||
| 789 | Ga0075431_100503924 | |||
| 790 | Ga0075433_10001379 | |||
| 791 | Ga0075434_100000955 | |||
| 792 | Ga0075434_100386467 | |||
| 793 | Ga0075434_101429902 | |||
| 794 | Ga0075429_100048486 | |||
| 795 | Ga0068865_100311159 | |||
| 796 | Ga0068865_100385645 | |||
| 797 | Ga0075436_100051988 | |||
| 798 | Ga0075436_100075126 | |||
| 799 | Ga0075436_100168326 | |||
| 800 | Ga0097620_100039461 | |||
| 801 | Ga0099825_1022943 | |||
| 802 | Ga0099824_1006697 | |||
| 803 | Ga0099824_1022677 | |||
| 804 | Ga0099822_1000400 | |||
| 805 | Ga0099823_1005442 | |||
| 806 | Ga0075435_100008603 | |||
| 807 | Ga0075435_100016634 | |||
| 808 | Ga0099795_10003062 | |||
| 809 | Ga0099795_10071224 | |||
| 810 | Ga0099795_10153749 | |||
| 811 | Ga0105240_10548066 | |||
| 812 | Ga0111539_10002210 | |||
| 813 | Ga0111539_10741876 | |||
| 814 | Ga0111539_10936400 | |||
| 815 | Ga0105245_10157759 | |||
| 816 | Ga0105245_10609166 | |||
| 817 | Ga0105247_10068288 | |||
| 818 | Ga0105247_10462644 | |||
| 819 | Ga0114129_10004325 | |||
| 820 | Ga0114129_10090717 | |||
| 821 | Ga0114129_10288465 | |||
| 822 | Ga0114129_11559254 | |||
| 823 | Ga0105243_10113349 | |||
| 824 | Ga0105248_10547560 | |||
| 825 | Ga0105237_10028665 | |||
| 826 | Ga0105237_10853728 | |||
| 827 | Ga0105238_10115554 | |||
| 828 | Ga0105238_10153957 | |||
| 829 | Ga0105238_10828794 | |||
| 830 | Ga0105249_10141574 | |||
| 831 | Ga0105249_10370123 | |||
| 832 | Ga0105249_10382346 | |||
| 833 | Ga0105249_10956314 | |||
| 834 | Ga0099796_10001301 | |||
| 835 | Ga0105239_10092223 | |||
| 836 | Ga0105239_10239833 | |||
| 837 | Ga0105239_10247552 | |||
| 838 | Ga0105239_10739286 | |||
| 839 | Ga0105239_11038631 | |||
| 840 | Ga0105246_10131389 | |||
| 841 | Ga0105246_10194883 | |||
| 842 | Ga0105246_10209452 | |||
| 843 | Ga0105246_10372548 | |||
| 844 | Ga0157370_10595798 | |||
| 845 | Ga0157369_10132290 | |||
| 846 | Ga0157369_10293846 | |||
| 847 | Ga0157369_10885796 | |||
| 848 | Ga0157374_10081161 | |||
| 849 | Ga0157374_10131135 | |||
| 850 | Ga0157378_10241907 | |||
| 851 | Ga0157378_11008563 | |||
| 852 | Ga0163162_10021405 | |||
| 853 | Ga0163162_10178978 | |||
| 854 | Ga0163162_10529058 | |||
| 855 | Ga0163162_10562090 | |||
| 856 | Ga0157372_10130526 | |||
| 857 | Ga0157375_10014997 | |||
| 858 | Ga0157375_10092513 | |||
| 859 | Ga0157375_10148119 | |||
| 860 | Ga0157375_10281430 | |||
| 861 | Ga0157375_10294598 | |||
| 862 | Ga0157375_10431450 | |||
| 863 | Ga0163163_10086658 | |||
| 864 | Ga0163163_10201610 | |||
| 865 | Ga0163163_10242843 | |||
| 866 | Ga0163163_10582566 | |||
| 867 | Ga0157380_10177448 | |||
| 868 | Ga0157380_11183254 | |||
| 869 | Ga0157379_10177528 | |||
| 870 | Ga0157379_10295804 | |||
| 871 | Ga0157376_10013260 | |||
| 872 | Ga0157376_10160664 | |||
| 873 | Ga0157376_10242462 | |||
| 874 | Ga0163161_10185932 | |||
| 875 | Ga0163161_10243896 | |||
| 876 | Ga0209564_1000031 | |||
| 877 | Ga0209758_1054423 | |||
| 878 | Ga0209256_1032806 | |||
| 879 | Ga0207692_10022395 | |||
| 880 | Ga0207692_10132090 | |||
| 881 | Ga0207642_10019351 | |||
| 882 | Ga0207642_10088977 | |||
| 883 | Ga0207710_10003608 | |||
| 884 | Ga0207688_10048054 | |||
| 885 | Ga0207688_10314931 | |||
| 886 | Ga0207680_10073650 | |||
| 887 | Ga0207685_10212805 | |||
| 888 | Ga0207699_10066230 | |||
| 889 | Ga0207699_10113593 | |||
| 890 | Ga0207699_10131327 | |||
| 891 | Ga0207684_10067106 | |||
| 892 | Ga0207684_10123431 | |||
| 893 | Ga0207707_10205216 | |||
| 894 | Ga0207671_10130596 | |||
| 895 | Ga0207671_10457424 | |||
| 896 | Ga0207671_10543547 | |||
| 897 | Ga0207693_10040602 | |||
| 898 | Ga0207693_10059242 | |||
| 899 | Ga0207693_10060622 | |||
| 900 | Ga0207693_10143659 | |||
| 901 | Ga0207663_10004379 | |||
| 902 | Ga0207663_10015813 | |||
| 903 | Ga0207663_10018522 | |||
| 904 | Ga0207663_10028793 | |||
| 905 | Ga0207660_10086758 | |||
| 906 | Ga0207649_10537073 | |||
| 907 | Ga0207652_10475212 | |||
| 908 | Ga0207646_10057827 | |||
| 909 | Ga0207694_10121111 | |||
| 910 | Ga0207694_10639635 | |||
| 911 | Ga0207650_10067804 | |||
| 912 | Ga0207659_10320734 | |||
| 913 | Ga0207687_10586276 | |||
| 914 | Ga0207687_10689929 | |||
| 915 | Ga0207700_10017216 | |||
| 916 | Ga0207700_10020087 | |||
| 917 | Ga0207664_10040596 | |||
| 918 | Ga0207664_10195771 | |||
| 919 | Ga0207644_10009440 | |||
| 920 | Ga0207644_10697634 | |||
| 921 | Ga0207690_10511338 | |||
| 922 | Ga0207706_10144813 | |||
| 923 | Ga0207706_10164906 | |||
| 924 | Ga0207706_10220062 | |||
| 925 | Ga0207709_10775635 | |||
| 926 | Ga0207669_10017711 | |||
| 927 | Ga0207669_11133205 | |||
| 928 | Ga0207704_10434299 | |||
| 929 | Ga0207665_10001963 | |||
| 930 | Ga0207665_10032721 | |||
| 931 | Ga0207665_10034597 | |||
| 932 | Ga0207665_10067647 | |||
| 933 | Ga0207665_10097794 | |||
| 934 | Ga0207691_10303336 | |||
| 935 | Ga0207711_10438845 | |||
| 936 | Ga0207689_10039377 | |||
| 937 | Ga0207661_10011213 | |||
| 938 | Ga0207679_10068177 | |||
| 939 | Ga0207667_10792947 | |||
| 940 | Ga0207712_10238984 | |||
| 941 | Ga0207668_10408160 | |||
| 942 | Ga0207668_10806776 | |||
| 943 | Ga0207703_10089041 | |||
| 944 | Ga0207703_10151218 | |||
| 945 | Ga0207639_10259398 | |||
| 946 | Ga0207639_10260032 | |||
| 947 | Ga0207678_10007287 | |||
| 948 | Ga0207648_10144013 | |||
| 949 | Ga0207676_10011889 | |||
| 950 | Ga0207674_10248745 | |||
| 951 | Ga0207675_100214659 | |||
| 952 | Ga0207683_10006102 | |||
| 953 | Ga0207683_10011399 | |||
| 954 | Ga0207683_10290693 | |||
| 955 | Ga0207683_10454822 | |||
| 956 | Ga0207683_10460508 | |||
| 957 | Ga0207698_10347042 | |||
| 958 | Ga0209389_1000230 | |||
| 959 | Ga0209589_1000030 | |||
| 960 | Ga0209489_100056 | |||
| 961 | Ga0209489_102489 | |||
| 962 | Ga0209700_100059 | |||
| 963 | Ga0209700_102336 | |||
| 964 | Ga0209179_1000668 | |||
| 965 | Ga0209813_10009378 | |||
| 966 | Ga0207428_10000175 | |||
| 967 | Ga0207428_10273598 | |||
| 968 | Ga0268266_10019159 | |||
| 969 | Ga0268266_10446349 | |||
| 970 | Ga0268265_10940311 | |||
| 971 | Ga0268264_11128136 | |||
| 972 | Ga0307515_10073384 | |||
| 973 | Ga0265332_10018826 | |||
| 974 | Ga0265325_10062220 | |||
| 975 | Ga0265340_10004896 | |||
| 976 | Ga0265331_10043689 | |||
| 977 | Ga0265313_10137039 | |||
| 978 | Ga0316579_10048653 | |||
| 979 | Ga0316585_10100666 | |||
| 980 | Ga0373950_0003065 | |||
| 981 | Ga0373926_0123916 | |||
| 982 | Ga0373928_0012919 | |||
| 983 | Ga0373929_0093477 | |||
| 984 | Ga0373934_0124112 | |||
| 985 | Ga0373934_0144400 | |||
| 986 | Ga0373944_0017338 | |||
| 987 | Ga0373944_0055243 | |||
| 988 | Ga0373951_0001848 | |||
| 989 | Ga0373952_0092455 | |||
| 990 | Ga0373923_0014643 | |||
| 991 | Ga0373923_0172325 | |||
| 992 | Ga0373936_0027816 | |||
| 993 | Ga0373936_0202018 | |||
| 994 | Ga0373939_0004023 | |||
| 995 | Ga0373941_0046147 | |||
| 996 | Ga0373945_0104768 | |||
| 997 | Ga0373953_0040633 | |||
| 998 | Ga0373953_0349405 | |||
| 999 | Ga0373954_0070128 | |||
| 1000 | Ga0373956_0046703 | |||
| 1001 | Ga0373956_0079733 | |||
| 1002 | Ga0373957_0105222 | |||
| 1003 | Ga0373960_0005831 | |||
| 1004 | Ga0373943_0006001 | |||
| 1005 | Ga0373943_0018913 | |||
| 1006 | Ga0373943_0122973 | |||
| 1007 | Ga0373943_0313718 | |||
| 1008 | Ga0373946_0022748 | |||
| 1009 | Ga0373946_0106299 | |||
| 1010 | Ga0373946_0213334 | |||
| 1011 | Ga0373955_0047251 | |||
| 1012 | Ga0373961_0055335 | |||
| 1013 | Ga0373962_0015824 | |||
| 1014 | Ga0316574_0002113 | |||
| 1015 | Ga0373924_0047382 | |||
| 1016 | Ga0373924_0346146 | |||
| 1017 | Ga0373931_0103125 | |||
| 1018 | Ga0373931_0125032 | |||
| 1019 | Ga0373931_0315127 | |||
| 1020 | Ga0373931_0696751 | |||
| 1021 | Ga0373935_0009442 | |||
| 1022 | Ga0373935_0009482 | |||
| 1023 | Ga0373927_0035553 | |||
| 1024 | Ga0373927_0035641 | |||
| 1025 | Ga0373927_0092247 | |||
| 1026 | Ga0373927_0151119 | |||
| 1027 | Ga0373927_0151907 | |||
| 1028 | Ga0373933_0067278 | |||
| 1029 | Ga0373933_0258833 | |||
| 1030 | Ga0373947_0003160 | |||
| 1031 | Ga0373947_0056730 | |||
| 1032 | Ga0373947_0120325 | |||
| 1033 | Ga0373937_0080281 | |||
| 1034 | Ga0373925_0003762 | |||
| 1035 | Ga0373925_0039828 | |||
| 1036 | Ga0373925_0331326 | |||
| 1037 | Ga0395905_0037866 | |||
| 1038 | Ga0395905_0119480 | |||
| 1039 | Ga0395905_1254591 | |||
| 1040 | Ga0436365_0818135 | |||
| 1041 | Ga0436360_0119969 | |||
| 1042 | Ga0436361_1079311 | |||
| 1043 | Ga0436363_0520046 | |||
| 1044 | Ga0453684_0613583 | |||
| 1045 | Ga0466967_0721292 | |||
| 1046 | Ga0495592_0072780 | |||
| 1047 | Ga0495592_0135377 | |||
| 1048 | Ga0495603_0003383 | |||
| 1049 | Ga0495603_0058755 | |||
| 1050 | Ga0495603_0274436 | |||
| 1051 | Ga0495591_082145 | |||
| 1052 | Ga0495629_0003887 | |||
| 1053 | Ga0495629_0049074 | |||
| 1054 | Ga0495629_0106392 | |||
| 1055 | Ga0495629_0147664 | |||
| 1056 | Ga0495641_0025447 | |||
| 1057 | Ga0495651_0279060 | |||
| 1058 | Ga0495653_0011422 | |||
| 1059 | Ga0495580_0022700 | |||
| 1060 | Ga0495580_0125171 | |||
| 1061 | Ga0495580_0156975 | |||
| 1062 | Ga0495582_0006191 | |||
| 1063 | Ga0495582_0196669 | |||
| 1064 | Ga0495582_0374330 | |||
| 1065 | Ga0495605_0231228 | |||
| 1066 | Ga0495639_0196149 | |||
| 1067 | Ga0495662_0128880 | |||
| 1068 | Ga0495664_0052425 | |||
| 1069 | Ga0495664_0135490 | |||
| 1070 | Ga0495664_0142123 | |||
| 1071 | Ga0495664_0169067 | |||
| 1072 | Ga0495664_0246569 | |||
| 1073 | Ga0495585_0100951 | |||
| 1074 | Ga0495585_0209636 | |||
| 1075 | Ga0495594_0014908 | |||
| 1076 | Ga0495594_0160602 | |||
| 1077 | Ga0495596_0108178 | |||
| 1078 | Ga0495583_0066676 | |||
| 1079 | Ga0495583_0090081 | |||
| 1080 | Ga0495606_0000960 | |||
| 1081 | Ga0495606_0030301 | |||
| 1082 | Ga0495608_0039225 | |||
| 1083 | Ga0495616_0165634 | |||
| 1084 | Ga0495618_0124214 | |||
| 1085 | Ga0495628_0063408 | |||
| 1086 | Ga0495630_0168654 | |||
| 1087 | Ga0495630_0197117 | |||
| 1088 | Ga0495643_0063003 | |||
| 1089 | Ga0495643_0098258 | |||
| 1090 | Ga0495644_0001216 | |||
| 1091 | Ga0495663_0065779 | |||
| 1092 | Ga0495666_0075316 | |||
| 1093 | Ga0495666_0141410 | |||
| 1094 | Ga0495652_0027986 | |||
| 1095 | Ga0495652_0469079 | |||
| 1096 | Ga0495654_0166804 | |||
| 1097 | Ga0495665_0162786 | |||
| 1098 | Ga0495665_0233958 | |||
| 1099 | Ga0495586_0141950 | |||
| 1100 | Ga0495586_0299897 | |||
| 1101 | Ga0495645_0006752 | |||
| 1102 | Ga0495622_0002104 | |||
| 1103 | Ga0495622_0034099 | |||
| 1104 | Ga0495667_0032377 | |||
| 1105 | Ga0495656_0000452 | |||
| 1106 | Ga0495668_0560110 | |||
| 1107 | Ga0495634_0104007 | |||
| 1108 | Ga0495611_0013498 | |||
| 1109 | Ga0495625_0035962 | |||
| 1110 | Ga0495625_0532690 | |||
| 1111 | Ga0495635_0028895 | |||
| 1112 | Ga0495635_0769755 | |||
| 1113 | Ga0495659_0074239 | |||
| 1114 | Ga0495661_0148113 | |||
| 1115 | Ga0495588_0105081 | |||
| 1116 | Ga0495588_0222611 | |||
| 1117 | Ga0495588_0379107 | |||
| 1118 | Ga0495588_0457965 | |||
| 1119 | Ga0495657_0120262 | |||
| 1120 | Ga0495599_0093393 | |||
| 1121 | Ga0495646_0127090 | |||
| 1122 | Ga0495646_0177250 | |||
| 1123 | Ga0495647_0017683 | |||
| 1124 | Ga0495647_0025807 | |||
| 1125 | Ga0495658_0000152 | |||
| 1126 | Ga0495658_0060968 | |||
| 1127 | Ga0495658_0164776 | |||
| 1128 | Ga0495669_0163447 | |||
| 1129 | Ga0495613_0035612 | |||
| 1130 | Ga0495613_0080390 | |||
| 1131 | Ga0495624_0109447 | |||
| 1132 | Ga0495670_0002048 | |||
| 1133 | Ga0495670_0522110 | |||
| 1134 | Ga0495671_0051859 | |||
| 1135 | Ga0495649_0029075 | |||
| 1136 | Ga0495589_0085264 | |||
| 1137 | Ga0495589_0140828 | |||
| 1138 | Ga0495600_0000371 | |||
| 1139 | Ga0495581_0041117 | |||
| 1140 | Ga0495581_0190812 | |||
| 1141 | Ga0495604_0100204 | |||
| 1142 | Ga0495674_0067393 | |||
| 1143 | Ga0495676_0096964 | |||
| 1144 | Ga0495676_0202754 | |||
| 1145 | Ga0495680_0015678 | |||
| 1146 | Ga0495680_0032529 | |||
| 1147 | Ga0495683_0082848 | |||
| 1148 | Ga0495683_0144586 | |||
| 1149 | Ga0495679_057236 | |||
| 1150 | Ga0495673_0027237 | |||
| 1151 | Ga0495684_0000833 | |||
| 1152 | Ga0495686_0052729 | |||
| 1153 | Ga0495593_0012351 | |||
| 1154 | Ga0495593_0044713 | |||
| 1155 | Ga0495593_0151254 | |||
| 1156 | Ga0495602_0147759 | |||
| 1157 | Ga0495614_0032444 | |||
| 1158 | Ga0496100_0023884 | |||
| 1159 | Ga0496100_0046287 | |||
| 1160 | Ga0496100_0533881 | |||
| 1161 | Ga0496100_0668278 | |||
| 1162 | Ga0496101_0002683 | |||
| 1163 | Ga0496101_0027147 | |||
| 1164 | Ga0496101_0378532 | |||
| 1165 | Ga0496102_0029585 | |||
| 1166 | Ga0496102_0173288 | |||
| 1167 | Ga0496102_0296113 | |||
| 1168 | Ga0496102_0442623 | |||
| 1169 | Ga0496102_0486477 | |||
| 1170 | Ga0496103_0551204 | |||
| 1171 | Ga0496104_0020954 | |||
| 1172 | Ga0496104_0021918 | |||
| 1173 | Ga0496104_0056665 | |||
| 1174 | Ga0496104_0148552 | |||
| 1175 | Ga0496104_0273433 | |||
| 1176 | Ga0496104_0277393 | |||
| 1177 | Ga0496105_0011493 | |||
| 1178 | Ga0496105_0252132 | |||
| 1179 | Ga0496105_0258336 | |||
| 1180 | Ga0496105_0683295 | |||
| 1181 | Ga0496106_0035505 | |||
| 1182 | Ga0496106_0226033 | |||
| 1183 | Ga0496106_0270586 | |||
| 1184 | Ga0496106_0369412 | |||
| 1185 | Ga0496107_0014897 | |||
| 1186 | Ga0496107_0094909 | |||
| 1187 | Ga0496107_0162424 | |||
| 1188 | Ga0496108_0211722 | |||
| 1189 | Ga0496108_0264707 | |||
| 1190 | Ga0496109_0121636 | |||
| 1191 | Ga0496109_0372815 | |||
| 1192 | Ga0496111_0126533 | |||
| 1193 | Ga0496111_0233245 | |||
| 1194 | Ga0496112_0002652 | |||
| 1195 | Ga0496112_0006924 | |||
| 1196 | Ga0496112_0007055 | |||
| 1197 | Ga0496112_0085311 | |||
| 1198 | Ga0496112_0200299 | |||
| 1199 | Ga0496112_0290949 | |||
| 1200 | Ga0496113_0203589 | |||
| 1201 | Ga0496113_0205113 | |||
| 1202 | Ga0496113_0240322 | |||
| 1203 | Ga0496114_0005717 | |||
| 1204 | Ga0496114_0175993 | |||
| 1205 | Ga0496114_0211103 | |||
| 1206 | Ga0496114_0659092 | |||
| 1207 | Ga0496115_0042702 | |||
| 1208 | Ga0496115_0134648 | |||
| 1209 | Ga0496115_0504219 | |||
| 1210 | Ga0496119_0084552 | |||
| 1211 | Ga0496120_0145935 | |||
| 1212 | Ga0496121_0037996 | |||
| 1213 | Ga0496124_0453135 | |||
| 1214 | Ga0496125_0055070 | |||
| 1215 | Ga0496126_0018206 | |||
| 1216 | Ga0496126_0018910 | |||
| 1217 | Ga0496126_0029391 | |||
| 1218 | Ga0496126_0039680 | |||
| 1219 | Ga0496126_0074468 | |||
| 1220 | Ga0496126_0790014 | |||
| 1221 | Ga0495682_0072095 | |||
| 1222 | Ga0501043_0291534 | |||
| 1223 | Ga0501035_0192343 | |||
| 1224 | Ga0501044_0278618 | |||
| 1225 | nmdc:mga00v17_12557_c1 | |||
| 1226 | nmdc:mga0yw44_186409_c1 | |||
| 1227 | nmdc:mga0yw44_222972_c1 | |||
| 1228 | nmdc:mga0yw44_24303_c1 | |||
| 1229 | nmdc:mga0k408_137259_c1 | |||
| 1230 | nmdc:mga05p37_1144820_c1 | |||
| 1231 | nmdc:mga05p37_680_c1 | |||
| 1232 | nmdc:mga09592_1311_c1 | |||
| 1233 | nmdc:mga0qj67_486890_c1 | |||
| 1234 | nmdc:mga0qj67_720594_c1 | |||
| 1235 | nmdc:mga0qj67_875_c1 | |||
| 1236 | nmdc:mga06r32_3262_c1 | |||
| 1237 | nmdc:mga08y16_101911_c1 | |||
| 1238 | nmdc:mga08y16_532777_c1 | |||
| 1239 | nmdc:mga0n895_2135_c1 | |||
| 1240 | nmdc:mga0n895_3658_c1 | |||
| 1241 | nmdc:mga0rr50_125025_c1 | |||
| 1242 | nmdc:mga0rr50_63553_c1 | |||
| 1243 | nmdc:mga0rr50_9668_c1 | |||
| 1244 | nmdc:mga08x19_140157_c1 | |||
| 1245 | nmdc:mga08x19_215326_c1 | |||
| 1246 | nmdc:mga0a205_40976_c1 | |||
| 1247 | nmdc:mga0sz30_33709_c1 | |||
| 1248 | Ga0495601_0066618 | |||
| 1249 | Ga0495601_0687118 | |||
| 1250 | Ga0495612_0021507 | |||
| 1251 | Ga0495612_0079469 | |||
| 1252 | Ga0495612_0167445 | |||
| 1253 | Ga0495655_0098803 | |||
| 1254 | Ga0495595_0001947 | |||
| 1255 | Ga0495619_0000226 | |||
| 1256 | Ga0495619_0002788 | |||
| 1257 | Ga0495619_0030303 | |||
| 1258 | Ga0495619_0124427 | |||
| 1259 | Ga0495619_0186193 | |||
| 1260 | Ga0500651_0159063 | |||
| 1261 | Ga0500569_018798 | |||
| 1262 | Ga0500569_141263 | |||
| 1263 | Ga0500642_0120475 | |||
| 1264 | Ga0500652_173064 | |||
| 1265 | Ga0500561_0019450 | |||
| 1266 | Ga0500616_0072837 | |||
| 1267 | Ga0500622_0015411 | |||
| 1268 | Ga0500636_0022085 | |||
| 1269 | Ga0500645_012587 | |||
| 1270 | 2513679847 | |||
| 1271 | 2513705672 | |||
| 1272 | 2524438971 | |||
| 1273 | 2524463541 | |||
| 1274 | 2524538267 | |||
| 1275 | 2528857730 | |||
| 1276 | 2728755197 | |||
| 1277 | 2745078918 | |||
| 1278 | 2824604322 | |||
| 1279 | 2824614205 | |||
| 1280 | 2824624448 | |||
| 1281 | 2824634231 | |||
| 1282 | 2824640900 | |||
| 1283 | 2824649150 | |||
| 1284 | 2824658343 | |||
| 1285 | 2824662980 | |||
| 1286 | 2824709205 | |||
| 1287 | 2824718934 | |||
| 1288 | 2824728870 | |||
| 1289 | 2824757784 | |||
| 1290 | 2824768704 | |||
| 1291 | 2879100953 | |||
| 1292 | 2885390646 | |||
| 1293 | 2885412335 | |||
| 1294 | 2888421514 | |||
| 1295 | 2903758756 | |||
| 1296 | 2903772880 | |||
| 1297 | 2904706689 | |||
| 1298 | 2904710398 | |||
| 1299 | 2904711632 | |||
| 1300 | 2906612083 | |||
| 1301 | 2906642613 | |||
| 1302 | 2906668066 | |||
| 1303 | 2922371642 | |||
| 1304 | 2922427212 | |||
| 1305 | 2929616986 | |||
| 1306 | 2929625729 | |||
| 1307 | 2932790724 | |||
| 1308 | 2932811910 | |||
| 1309 | 2932822604 | |||
| 1310 | 2932831189 | |||
| 1311 | 2933577732 | |||
| 1312 | 2935624774 | |||
| 1313 | 2935645999 | |||
| 1314 | 2935670662 | |||
| 1315 | 2935679588 | |||
| 1316 | 2935691396 | |||
| 1317 | 2935701957 | |||
| 1318 | 2935704582 | |||
| 1319 | 2935719230 | |||
| 1320 | 2935729170 | |||
| 1321 | 2935737589 | |||
| 1322 | 2935746965 | |||
| 1323 | 2935758236 | |||
| 1324 | 2935768913 | |||
| 1325 | 2935807980 | |||
| 1326 | 2935816432 | |||
| 1327 | 2935835279 | |||
| 1328 | 2935842827 | |||
| 1329 | 2935863404 | |||
| 1330 | 2935871515 | |||
| 1331 | 2935881764 | |||
| 1332 | 2935963819 | |||
| 1333 | 2935991718 | |||
| 1334 | 2935993817 | |||
| 1335 | 2936010407 | |||
| 1336 | 2936042616 | |||
| 1337 | 2940563854 | |||
| 1338 | 2941512873 | |||
| 1339 | 2941520825 | |||
| 1340 | 2941528840 | |||
| 1341 | 2941547577 | |||
| 1342 | 3005476390 | |||
| 1343 | 8006977941 | |||
| 1344 | 8016516121 | |||
| 1345 | 8019560905 | |||
| 1346 | 8019570988 | |||
| 1347 | 8019579874 | |||
| 1348 | 8019587584 | |||
| 1349 | 8019603748 | |||
| 1350 | 8055748632 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a2n-assembly1.cif.gz_B | crystal structure of ma-icmt | 0.9519 | 1 | 191 |
| 4a2n-assembly1.cif.gz_B | crystal structure of ma-icmt | 0.9424 | 1 | 191 |
| 5vg9-assembly1.cif.gz_A | structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody | 0.6703 | 33 | 193 |
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.6097 | 9 | 193 |
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.5829 | 9 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a2nB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9519 | 1 | 191 | 1.20.120.1630 |
| 4a2nB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9424 | 1 | 191 | 1.20.120.1630 |
| af_Q8I555_347_506_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8438 | 76 | 192 | 1.20.120.1630 |
| af_P71912_2_135_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8247 | 74 | 192 | 1.20.120.1630 |
| af_Q4D7B7_120_287_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7467 | 49 | 192 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6T3J4-F1-model_v4 | deleted | 0.9776 | 1 | 155 |
|
| AF-C0G9J4-F1-model_v4 | Farnesyl cysteine carboxyl-methyltransferase | 0.9771 | 1 | 191 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A7R7T828-F1-model_v4 | Farnesyl cysteine carboxyl-methyltransferase | 0.9694 | 1 | 194 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A0G3BLN1-F1-model_v4 | Farnesyl cysteine carboxyl-methyltransferase | 0.9669 | 6 | 191 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A7C7WRW1-F1-model_v4 | Isoprenylcysteine carboxylmethyltransferase family protein | 0.9661 | 1 | 191 |
GO:0004671
GO:0016020 GO:0032259 |