F474465

General Info

Members Datasets Scaffolds Average Seq Length
675 406 1350 194

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0680241|Ga0501037_0680241_37_624
Length 195
Sequence MLTPLIAKLVWLAGLVGWFVIRYPFQRRAARLKVARATARSGDRVVLAVATLGQFVIPLVYVLTGFPRSANYGFHPWLALVGILVEIAALVLFRATHVQLGRNWSISLETREKHQLVTSGLYGWVRHPMYSSFLLSAVAQVLLLQNWVAGFAGLVGFLVLFLFRVGREEGLMTDTFGEQYRDYSRRTARIVPWLY

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
150 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
167 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
320 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
321 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
322 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
328 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
329 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
330 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
331 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
332 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
333 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
334 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
335 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
336 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
337 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
338 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
339 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
340 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
341 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
342 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
343 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
344 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
345 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
346 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
347 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
348 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
349 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
350 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
351 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
352 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
353 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
354 2904699407
355 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
356 2906610324
357 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
358 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
359 2922368715
360 2922425934
361 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
362 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
363 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
364 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
365 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
366 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
367 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
368 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
369 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
370 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
371 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
372 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
373 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
374 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
375 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
376 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
377 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
378 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
379 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
380 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
381 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
382 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
383 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
384 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
385 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
386 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
387 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
388 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
389 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
390 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
391 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
392 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
393 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
394 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
395 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
396 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
397 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
398 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
399 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
400 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
401 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
402 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
403 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
404 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
405 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
406 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.66
Metatranscriptomes 0
Isolates 11.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 9.78
Rhizoplane 7.7
Rhizosphere 72.59
Stem 0
Stem Tuber 0
Unclassified 14.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0680241 3300049573 Bacteria 686
2 2214903546 2209111006 Bacteria 1416
3 rootL2_10253805 3300003322 Bacteria 2458
4 JGI25404J52841_10000157 3300003659 Bacteria 7634
5 JGI25404J52841_10003760 3300003659 Bacteria 3025
6 Ga0055526_1000017 3300003771 Bacteria 210613
7 JGI25405J52794_10002634 3300003911 Bacteria 3103
8 Ga0065707_10093537 3300005295 Bacteria 3615
9 Ga0070683_100010101 3300005329 Bacteria 8099
10 Ga0070683_100691745 3300005329 Unclassified 976
11 Ga0068869_100361976 3300005334 Unclassified 1185
12 Ga0070680_100004367 3300005336 Bacteria 10635
13 Ga0070682_100336990 3300005337 Bacteria 1120
14 Ga0070682_100457694 3300005337 Bacteria 979
15 Ga0070661_100103748 3300005344 Bacteria 2118
16 Ga0070661_101085872 3300005344 Unclassified 666
17 Ga0070668_100059496 3300005347 Bacteria 2957
18 Ga0070674_100355665 3300005356 Bacteria 1184
19 Ga0070659_100295845 3300005366 Bacteria 1349
20 Ga0070659_100635326 3300005366 Bacteria 919
21 Ga0070659_100914708 3300005366 Unclassified 767
22 Ga0070709_10041187 3300005434 Bacteria 2845
23 Ga0070709_10047750 3300005434 Bacteria 2668
24 Ga0070709_10068067 3300005434 Bacteria 2288
25 Ga0070709_10193325 3300005434 Bacteria 1437
26 Ga0070714_100023373 3300005435 Bacteria 5077
27 Ga0070714_100112049 3300005435 Bacteria 2417
28 Ga0070713_100100099 3300005436 Bacteria 2509
29 Ga0070713_100149595 3300005436 Bacteria 2076
30 Ga0070710_10010487 3300005437 Bacteria 4553
31 Ga0070710_10095377 3300005437 Bacteria 1762
32 Ga0070710_10866479 3300005437 Bacteria 650
33 Ga0070711_100005899 3300005439 Bacteria 7352
34 Ga0070711_100023728 3300005439 Bacteria 3993
35 Ga0070711_100118870 3300005439 Bacteria 1951
36 Ga0070705_100346017 3300005440 Bacteria 1082
37 Ga0070705_100515256 3300005440 Unclassified 911
38 Ga0070708_100052744 3300005445 Unclassified 3607
39 Ga0070708_100416656 3300005445 Bacteria 1267
40 Ga0070678_100020190 3300005456 Bacteria 4366
41 Ga0070678_100350490 3300005456 Bacteria 1269
42 Ga0070678_100680654 3300005456 Bacteria 925
43 Ga0070662_100360794 3300005457 Bacteria 1192
44 Ga0070662_100398864 3300005457 Bacteria 1135
45 Ga0070681_10054264 3300005458 Bacteria 3993
46 Ga0070681_10520080 3300005458 Bacteria 1103
47 Ga0068867_100339057 3300005459 Bacteria 1251
48 Ga0068867_100668679 3300005459 Bacteria 913
49 Ga0070707_100056954 3300005468 Bacteria 3750
50 Ga0070698_100170504 3300005471 Bacteria 2117
51 Ga0070699_100246437 3300005518 Bacteria 1596
52 Ga0070679_100016507 3300005530 Bacteria 7127
53 Ga0070684_100018545 3300005535 Bacteria 5736
54 Ga0070684_100545143 3300005535 Bacteria 1076
55 Ga0070697_100639524 3300005536 Bacteria 936
56 Ga0068853_100967803 3300005539 Bacteria 819
57 Ga0070665_100098986 3300005548 Bacteria 2920
58 Ga0070665_100367653 3300005548 Bacteria 1445
59 Ga0068855_100627281 3300005563 Bacteria 1157
60 Ga0070664_100158216 3300005564 Bacteria 2003
61 Ga0070664_100832765 3300005564 Unclassified 863
62 Ga0070664_101001531 3300005564 Unclassified 785
63 Ga0070702_100354904 3300005615 Bacteria 1034
64 Ga0068852_100216948 3300005616 Bacteria 1818
65 Ga0068852_100227240 3300005616 Bacteria 1778
66 Ga0068859_100039458 3300005617 Plasmid 4736
67 Ga0068864_100620157 3300005618 Bacteria 1051
68 Ga0068866_10218240 3300005718 Bacteria 1149
69 Ga0068861_100079481 3300005719 Bacteria 2564
70 Ga0068863_100110236 3300005841 Bacteria 2621
71 Ga0068858_100054886 3300005842 Bacteria 3684
72 Ga0068858_100203877 3300005842 Bacteria 1871
73 Ga0068858_100586227 3300005842 Bacteria 1081
74 Ga0068860_101094251 3300005843 Bacteria 816
75 Ga0068862_100061041 3300005844 Bacteria 3240
76 Ga0081455_10002775 3300005937 Bacteria 20627
77 Ga0081455_10126164 3300005937 Unclassified 2008
78 Ga0081540_1000007 3300005983 Bacteria 205328
79 Ga0081540_1002952 3300005983 Bacteria 13657
80 Ga0081540_1008602 3300005983 Bacteria 7113
81 Ga0081540_1024259 3300005983 Bacteria 3523
82 Ga0081540_1031671 3300005983 Bacteria 2902
83 Ga0070717_10101024 3300006028 Bacteria 2449
84 Ga0070717_10262011 3300006028 Bacteria 1530
85 Ga0070717_10286940 3300006028 Bacteria 1461
86 Ga0075432_10049962 3300006058 Bacteria 1474
87 Ga0070715_10052783 3300006163 Bacteria 1755
88 Ga0070716_100029117 3300006173 Bacteria 2982
89 Ga0070716_100032263 3300006173 Bacteria 2855
90 Ga0070716_100072459 3300006173 Bacteria 2028
91 Ga0070716_100079094 3300006173 Bacteria 1957
92 Ga0070716_100123125 3300006173 Bacteria 1627
93 Ga0070712_100018358 3300006175 Bacteria 4543
94 Ga0070712_100057663 3300006175 Bacteria 2729
95 Ga0070712_100071040 3300006175 Bacteria 2490
96 Ga0070712_100092004 3300006175 Bacteria 2223
97 Ga0070712_100242605 3300006175 Bacteria 1436
98 Ga0070712_100387349 3300006175 Bacteria 1152
99 Ga0075362_10037398 3300006177 Bacteria 2128
100 Ga0075367_10014569 3300006178 Bacteria 4257
101 Ga0075367_10128464 3300006178 Bacteria 1565
102 Ga0075427_10000354 3300006194 Bacteria 5065
103 Ga0075366_10104621 3300006195 Bacteria 1701
104 Ga0075366_10142200 3300006195 Bacteria 1451
105 Ga0097621_100279573 3300006237 Bacteria 1469
106 Ga0068871_100355788 3300006358 Bacteria 1296
107 Ga0075428_100048886 3300006844 Bacteria 4641
108 Ga0075428_100803382 3300006844 Bacteria 1000
109 Ga0075430_100048619 3300006846 Bacteria 3581
110 Ga0075430_100168667 3300006846 Bacteria 1821
111 Ga0075430_100222511 3300006846 Bacteria 1566
112 Ga0075431_100018424 3300006847 Bacteria 7109
113 Ga0075431_100355595 3300006847 Bacteria 1472
114 Ga0075431_100503924 3300006847 Unclassified 1201
115 Ga0075433_10001379 3300006852 Bacteria 17864
116 Ga0075434_100000955 3300006871 Bacteria 23296
117 Ga0075434_100386467 3300006871 Bacteria 1420
118 Ga0075434_101429902 3300006871 Bacteria 701
119 Ga0075429_100048486 3300006880 Bacteria 3694
120 Ga0068865_100311159 3300006881 Bacteria 1264
121 Ga0068865_100385645 3300006881 Bacteria 1144
122 Ga0075436_100051988 3300006914 Bacteria 2827
123 Ga0075436_100075126 3300006914 Bacteria 2340
124 Ga0075436_100168326 3300006914 Bacteria 1547
125 Ga0097620_100039461 3300006931 Plasmid 4736
126 Ga0099825_1022943 3300006941 Bacteria 3917
127 Ga0099824_1006697 3300006942 Bacteria 15679
128 Ga0099824_1022677 3300006942 Bacteria 4080
129 Ga0099822_1000400 3300006943 Bacteria 38677
130 Ga0099823_1005442 3300006944 Bacteria 12711
131 Ga0075435_100008603 3300007076 Bacteria 7334
132 Ga0075435_100016634 3300007076 Bacteria 5546
133 Ga0099795_10003062 3300007788 Bacteria 4078
134 Ga0099795_10071224 3300007788 Bacteria 1312
135 Ga0099795_10153749 3300007788 Unclassified 944
136 Ga0105240_10548066 3300009093 Bacteria 1280
137 Ga0111539_10002210 3300009094 Bacteria 25988
138 Ga0111539_10741876 3300009094 Unclassified 1143
139 Ga0111539_10936400 3300009094 Unclassified 1007
140 Ga0105245_10157759 3300009098 Bacteria 2150
141 Ga0105245_10609166 3300009098 Bacteria 1119
142 Ga0105247_10068288 3300009101 Bacteria 2216
143 Ga0105247_10462644 3300009101 Unclassified 917
144 Ga0114129_10004325 3300009147 Bacteria 20085
145 Ga0114129_10090717 3300009147 Unclassified 4235
146 Ga0114129_10288465 3300009147 Unclassified 2191
147 Ga0114129_11559254 3300009147 Unclassified 810
148 Ga0105243_10113349 3300009148 Bacteria 2273
149 Ga0105248_10547560 3300009177 Bacteria 1305
150 Ga0105237_10028665 3300009545 Bacteria 5668
151 Ga0105237_10853728 3300009545 Bacteria 917
152 Ga0105238_10115554 3300009551 Bacteria 2663
153 Ga0105238_10153957 3300009551 Bacteria 2274
154 Ga0105238_10828794 3300009551 Bacteria 941
155 Ga0105249_10141574 3300009553 Bacteria 2307
156 Ga0105249_10370123 3300009553 Bacteria 1456
157 Ga0105249_10382346 3300009553 Bacteria 1434
158 Ga0105249_10956314 3300009553 Bacteria 925
159 Ga0099796_10001301 3300010159 Bacteria 4939
160 Ga0105239_10092223 3300010375 Bacteria 3343
161 Ga0105239_10239833 3300010375 Bacteria 2035
162 Ga0105239_10247552 3300010375 Bacteria 2002
163 Ga0105239_10739286 3300010375 Bacteria 1126
164 Ga0105239_11038631 3300010375 Bacteria 943
165 Ga0105246_10131389 3300011119 Bacteria 1871
166 Ga0105246_10194883 3300011119 Bacteria 1571
167 Ga0105246_10209452 3300011119 Unclassified 1521
168 Ga0105246_10372548 3300011119 Bacteria 1177
169 Ga0157370_10595798 3300013104 Bacteria 1012
170 Ga0157369_10132290 3300013105 Bacteria 2643
171 Ga0157369_10293846 3300013105 Bacteria 1691
172 Ga0157369_10885796 3300013105 Bacteria 916
173 Ga0157374_10081161 3300013296 Bacteria 3077
174 Ga0157374_10131135 3300013296 Bacteria 2426
175 Ga0157378_10241907 3300013297 Bacteria 1724
176 Ga0157378_11008563 3300013297 Bacteria 867
177 Ga0163162_10021405 3300013306 Bacteria 6368
178 Ga0163162_10178978 3300013306 Bacteria 2246
179 Ga0163162_10529058 3300013306 Bacteria 1308
180 Ga0163162_10562090 3300013306 Unclassified 1268
181 Ga0157372_10130526 3300013307 Bacteria 2891
182 Ga0157375_10014997 3300013308 Bacteria 6931
183 Ga0157375_10092513 3300013308 Bacteria 3088
184 Ga0157375_10148119 3300013308 Bacteria 2480
185 Ga0157375_10281430 3300013308 Unclassified 1826
186 Ga0157375_10294598 3300013308 Bacteria 1786
187 Ga0157375_10431450 3300013308 Unclassified 1484
188 Ga0163163_10086658 3300014325 Bacteria 3141
189 Ga0163163_10201610 3300014325 Bacteria 2038
190 Ga0163163_10242843 3300014325 Unclassified 1851
191 Ga0163163_10582566 3300014325 Bacteria 1182
192 Ga0157380_10177448 3300014326 Bacteria 1868
193 Ga0157380_11183254 3300014326 Bacteria 807
194 Ga0157379_10177528 3300014968 Bacteria 1923
195 Ga0157379_10295804 3300014968 Bacteria 1475
196 Ga0157376_10013260 3300014969 Bacteria 6146
197 Ga0157376_10160664 3300014969 Bacteria 2036
198 Ga0157376_10242462 3300014969 Bacteria 1680
199 Ga0163161_10185932 3300017792 Unclassified 1595
200 Ga0163161_10243896 3300017792 Bacteria 1398
201 Ga0209564_1000031 3300025295 Bacteria 494703
202 Ga0209758_1054423 3300025297 Bacteria 1367
203 Ga0209256_1032806 3300025299 Bacteria 1405
204 Ga0207692_10022395 3300025898 Bacteria 2906
205 Ga0207692_10132090 3300025898 Bacteria 1411
206 Ga0207642_10019351 3300025899 Bacteria 2634
207 Ga0207642_10088977 3300025899 Unclassified 1520
208 Ga0207710_10003608 3300025900 Bacteria 6862
209 Ga0207688_10048054 3300025901 Bacteria 2384
210 Ga0207688_10314931 3300025901 Unclassified 959
211 Ga0207680_10073650 3300025903 Unclassified 2124
212 Ga0207685_10212805 3300025905 Bacteria 915
213 Ga0207699_10066230 3300025906 Bacteria 2192
214 Ga0207699_10113593 3300025906 Bacteria 1740
215 Ga0207699_10131327 3300025906 Bacteria 1634
216 Ga0207684_10067106 3300025910 Bacteria 3048
217 Ga0207684_10123431 3300025910 Bacteria 2221
218 Ga0207707_10205216 3300025912 Bacteria 1718
219 Ga0207671_10130596 3300025914 Bacteria 1928
220 Ga0207671_10457424 3300025914 Bacteria 1017
221 Ga0207671_10543547 3300025914 Bacteria 926
222 Ga0207693_10040602 3300025915 Bacteria 3664
223 Ga0207693_10059242 3300025915 Bacteria 2999
224 Ga0207693_10060622 3300025915 Bacteria 2964
225 Ga0207693_10143659 3300025915 Bacteria 1876
226 Ga0207663_10004379 3300025916 Bacteria 7015
227 Ga0207663_10015813 3300025916 Bacteria 4172
228 Ga0207663_10018522 3300025916 Bacteria 3904
229 Ga0207663_10028793 3300025916 Bacteria 3256
230 Ga0207660_10086758 3300025917 Bacteria 2311
231 Ga0207649_10537073 3300025920 Bacteria 893
232 Ga0207652_10475212 3300025921 Bacteria 1126
233 Ga0207646_10057827 3300025922 Bacteria 3465
234 Ga0207694_10121111 3300025924 Bacteria 2089
235 Ga0207694_10639635 3300025924 Bacteria 896
236 Ga0207650_10067804 3300025925 Bacteria 2678
237 Ga0207659_10320734 3300025926 Bacteria 1278
238 Ga0207687_10586276 3300025927 Bacteria 938
239 Ga0207687_10689929 3300025927 Bacteria 866
240 Ga0207700_10017216 3300025928 Bacteria 4823
241 Ga0207700_10020087 3300025928 Bacteria 4528
242 Ga0207664_10040596 3300025929 Bacteria 3620
243 Ga0207664_10195771 3300025929 Bacteria 1742
244 Ga0207644_10009440 3300025931 Bacteria 6406
245 Ga0207644_10697634 3300025931 Bacteria 846
246 Ga0207690_10511338 3300025932 Unclassified 972
247 Ga0207706_10144813 3300025933 Bacteria 2090
248 Ga0207706_10164906 3300025933 Bacteria 1947
249 Ga0207706_10220062 3300025933 Unclassified 1662
250 Ga0207709_10775635 3300025935 Bacteria 772
251 Ga0207669_10017711 3300025937 Plasmid 3662
252 Ga0207669_11133205 3300025937 Bacteria 661
253 Ga0207704_10434299 3300025938 Bacteria 1044
254 Ga0207665_10001963 3300025939 Bacteria 13843
255 Ga0207665_10032721 3300025939 Bacteria 3443
256 Ga0207665_10034597 3300025939 Bacteria 3352
257 Ga0207665_10067647 3300025939 Bacteria 2433
258 Ga0207665_10097794 3300025939 Bacteria 2044
259 Ga0207691_10303336 3300025940 Unclassified 1372
260 Ga0207711_10438845 3300025941 Bacteria 1215
261 Ga0207689_10039377 3300025942 Bacteria 3913
262 Ga0207661_10011213 3300025944 Bacteria 6484
263 Ga0207679_10068177 3300025945 Bacteria 2672
264 Ga0207667_10792947 3300025949 Bacteria 944
265 Ga0207712_10238984 3300025961 Bacteria 1462
266 Ga0207668_10408160 3300025972 Bacteria 1150
267 Ga0207668_10806776 3300025972 Unclassified 831
268 Ga0207703_10089041 3300026035 Bacteria 2592
269 Ga0207703_10151218 3300026035 Bacteria 2024
270 Ga0207639_10259398 3300026041 Bacteria 1519
271 Ga0207639_10260032 3300026041 Bacteria 1518
272 Ga0207678_10007287 3300026067 Bacteria 9802
273 Ga0207648_10144013 3300026089 Bacteria 2102
274 Ga0207676_10011889 3300026095 Bacteria 6228
275 Ga0207674_10248745 3300026116 Bacteria 1725
276 Ga0207675_100214659 3300026118 Bacteria 1852
277 Ga0207683_10006102 3300026121 Bacteria 10317
278 Ga0207683_10011399 3300026121 Bacteria 7585
279 Ga0207683_10290693 3300026121 Bacteria 1494
280 Ga0207683_10454822 3300026121 Bacteria 1180
281 Ga0207683_10460508 3300026121 Unclassified 1173
282 Ga0207698_10347042 3300026142 Bacteria 1400
283 Ga0209389_1000230 3300027296 Bacteria 37484
284 Ga0209589_1000030 3300027357 Bacteria 147457
285 Ga0209489_100056 3300027361 Bacteria 147457
286 Ga0209489_102489 3300027361 Bacteria 37484
287 Ga0209700_100059 3300027363 Bacteria 147457
288 Ga0209700_102336 3300027363 Bacteria 38715
289 Ga0209179_1000668 3300027512 Bacteria 3661
290 Ga0209813_10009378 3300027866 Bacteria 2502
291 Ga0207428_10000175 3300027907 Bacteria 89715
292 Ga0207428_10273598 3300027907 Unclassified 1255
293 Ga0268266_10019159 3300028379 Bacteria 5827
294 Ga0268266_10446349 3300028379 Bacteria 1229
295 Ga0268265_10940311 3300028380 Unclassified 851
296 Ga0268264_11128136 3300028381 Bacteria 793
297 Ga0307515_10073384 3300028794 Bacteria 4600
298 Ga0265332_10018826 3300031238 Bacteria 3049
299 Ga0265325_10062220 3300031241 Bacteria 1891
300 Ga0265340_10004896 3300031247 Bacteria 7453
301 Ga0265331_10043689 3300031250 Bacteria 2169
302 Ga0265313_10137039 3300031595 Unclassified 1055
303 Ga0316579_10048653 3300031691 Bacteria 1981
304 Ga0316585_10100666 3300032137 Bacteria 948
305 Ga0373950_0003065 3300034818 Unclassified 2359
306 Ga0373926_0123916 3300035083 Bacteria 975
307 Ga0373928_0012919 3300035084 Unclassified 1671
308 Ga0373929_0093477 3300035085 Unclassified 749
309 Ga0373934_0124112 3300035086 Bacteria 1051
310 Ga0373934_0144400 3300035086 Unclassified 974
311 Ga0373944_0017338 3300035089 Bacteria 2043
312 Ga0373944_0055243 3300035089 Unclassified 1261
313 Ga0373951_0001848 3300035091 Bacteria 5472
314 Ga0373952_0092455 3300035092 Unclassified 787
315 Ga0373923_0014643 3300035111 Bacteria 2950
316 Ga0373923_0172325 3300035111 Bacteria 991
317 Ga0373936_0027816 3300035113 Bacteria 2219
318 Ga0373936_0202018 3300035113 Unclassified 877
319 Ga0373939_0004023 3300035114 Bacteria 3462
320 Ga0373941_0046147 3300035115 Bacteria 1367
321 Ga0373945_0104768 3300035116 Bacteria 1110
322 Ga0373953_0040633 3300035117 Bacteria 1848
323 Ga0373953_0349405 3300035117 Unclassified 648
324 Ga0373954_0070128 3300035118 Bacteria 1665
325 Ga0373956_0046703 3300035119 Bacteria 1936
326 Ga0373956_0079733 3300035119 Bacteria 1501
327 Ga0373957_0105222 3300035120 Bacteria 1133
328 Ga0373960_0005831 3300035121 Bacteria 2866
329 Ga0373943_0006001 3300035170 Bacteria 5452
330 Ga0373943_0018913 3300035170 Bacteria 3167
331 Ga0373943_0122973 3300035170 Bacteria 1381
332 Ga0373943_0313718 3300035170 Unclassified 893
333 Ga0373946_0022748 3300035171 Unclassified 2443
334 Ga0373946_0106299 3300035171 Bacteria 1265
335 Ga0373946_0213334 3300035171 Unclassified 929
336 Ga0373955_0047251 3300035172 Bacteria 2330
337 Ga0373961_0055335 3300035241 Unclassified 1188
338 Ga0373962_0015824 3300035242 Bacteria 1939
339 Ga0316574_0002113 3300035398 Bacteria 9858
340 Ga0373924_0047382 3300035410 Bacteria 1773
341 Ga0373924_0346146 3300035410 Unclassified 662
342 Ga0373931_0103125 3300035691 Bacteria 1607
343 Ga0373931_0125032 3300035691 Unclassified 1474
344 Ga0373931_0315127 3300035691 Bacteria 970
345 Ga0373931_0696751 3300035691 Unclassified 671
346 Ga0373935_0009442 3300035692 Bacteria 5836
347 Ga0373935_0009482 3300035692 Bacteria 5824
348 Ga0373927_0035553 3300035695 Bacteria 3239
349 Ga0373927_0035641 3300035695 Bacteria 3235
350 Ga0373927_0092247 3300035695 Bacteria 1967
351 Ga0373927_0151119 3300035695 Bacteria 1520
352 Ga0373927_0151907 3300035695 Unclassified 1516
353 Ga0373933_0067278 3300035724 Bacteria 2173
354 Ga0373933_0258833 3300035724 Unclassified 1122
355 Ga0373947_0003160 3300035725 Bacteria 9805
356 Ga0373947_0056730 3300035725 Bacteria 2368
357 Ga0373947_0120325 3300035725 Bacteria 1667
358 Ga0373937_0080281 3300036401 Bacteria 3016
359 Ga0373925_0003762 3300037068 Bacteria 11659
360 Ga0373925_0039828 3300037068 Bacteria 3477
361 Ga0373925_0331326 3300037068 Bacteria 1233
362 Ga0395905_0037866 3300037471 Bacteria 4526
363 Ga0395905_0119480 3300037471 Bacteria 2477
364 Ga0395905_1254591 3300037471 Unclassified 645
365 Ga0436365_0818135 3300039437 Bacteria 1535
366 Ga0436360_0119969 3300039438 Bacteria 3712
367 Ga0436361_1079311 3300039447 Bacteria 2511
368 Ga0436363_0520046 3300039450 Bacteria 5596
369 Ga0453684_0613583 3300044712 Bacteria 1191
370 Ga0466967_0721292 3300045976 Unclassified 988
371 Ga0495592_0072780 3300046454 Unclassified 2500
372 Ga0495592_0135377 3300046454 Bacteria 1719
373 Ga0495603_0003383 3300046455 Bacteria 9499
374 Ga0495603_0058755 3300046455 Unclassified 2273
375 Ga0495603_0274436 3300046455 Unclassified 969
376 Ga0495591_082145 3300046458 Unclassified 820
377 Ga0495629_0003887 3300046459 Bacteria 11254
378 Ga0495629_0049074 3300046459 Unclassified 2959
379 Ga0495629_0106392 3300046459 Bacteria 1957
380 Ga0495629_0147664 3300046459 Bacteria 1635
381 Ga0495641_0025447 3300046461 Bacteria 2905
382 Ga0495651_0279060 3300046462 Bacteria 1130
383 Ga0495653_0011422 3300046463 Bacteria 7258
384 Ga0495580_0022700 3300046472 Bacteria 4614
385 Ga0495580_0125171 3300046472 Bacteria 1784
386 Ga0495580_0156975 3300046472 Bacteria 1575
387 Ga0495582_0006191 3300046473 Bacteria 6662
388 Ga0495582_0196669 3300046473 Bacteria 1151
389 Ga0495582_0374330 3300046473 Unclassified 820
390 Ga0495605_0231228 3300046474 Unclassified 796
391 Ga0495639_0196149 3300046475 Bacteria 987
392 Ga0495662_0128880 3300046476 Unclassified 1243
393 Ga0495664_0052425 3300046477 Bacteria 2424
394 Ga0495664_0135490 3300046477 Bacteria 1492
395 Ga0495664_0142123 3300046477 Unclassified 1455
396 Ga0495664_0169067 3300046477 Bacteria 1326
397 Ga0495664_0246569 3300046477 Bacteria 1080
398 Ga0495585_0100951 3300046492 Unclassified 1543
399 Ga0495585_0209636 3300046492 Bacteria 988
400 Ga0495594_0014908 3300046499 Bacteria 4079
401 Ga0495594_0160602 3300046499 Unclassified 1277
402 Ga0495596_0108178 3300046500 Bacteria 1080
403 Ga0495583_0066676 3300046506 Bacteria 1592
404 Ga0495583_0090081 3300046506 Unclassified 1322
405 Ga0495606_0000960 3300046507 Bacteria 42272
406 Ga0495606_0030301 3300046507 Bacteria 3782
407 Ga0495608_0039225 3300046511 Unclassified 3176
408 Ga0495616_0165634 3300046513 Unclassified 991
409 Ga0495618_0124214 3300046514 Unclassified 1652
410 Ga0495628_0063408 3300046516 Bacteria 2896
411 Ga0495630_0168654 3300046517 Bacteria 1667
412 Ga0495630_0197117 3300046517 Unclassified 1536
413 Ga0495643_0063003 3300046522 Bacteria 1962
414 Ga0495643_0098258 3300046522 Bacteria 1503
415 Ga0495644_0001216 3300046523 Bacteria 10533
416 Ga0495663_0065779 3300046525 Unclassified 1146
417 Ga0495666_0075316 3300046526 Bacteria 1600
418 Ga0495666_0141410 3300046526 Bacteria 1122
419 Ga0495652_0027986 3300046529 Unclassified 4964
420 Ga0495652_0469079 3300046529 Bacteria 878
421 Ga0495654_0166804 3300046530 Bacteria 963
422 Ga0495665_0162786 3300046531 Unclassified 1162
423 Ga0495665_0233958 3300046531 Bacteria 948
424 Ga0495586_0141950 3300046535 Unclassified 1348
425 Ga0495586_0299897 3300046535 Bacteria 921
426 Ga0495645_0006752 3300046543 Bacteria 7974
427 Ga0495622_0002104 3300046557 Bacteria 9729
428 Ga0495622_0034099 3300046557 Unclassified 2375
429 Ga0495667_0032377 3300046559 Bacteria 3504
430 Ga0495656_0000452 3300046615 Bacteria 13375
431 Ga0495668_0560110 3300046616 Bacteria 631
432 Ga0495634_0104007 3300046642 Bacteria 1832
433 Ga0495611_0013498 3300046648 Bacteria 3479
434 Ga0495625_0035962 3300046660 Bacteria 3645
435 Ga0495625_0532690 3300046660 Bacteria 714
436 Ga0495635_0028895 3300046663 Bacteria 3854
437 Ga0495635_0769755 3300046663 Bacteria 621
438 Ga0495659_0074239 3300046664 Unclassified 1279
439 Ga0495661_0148113 3300046665 Bacteria 1270
440 Ga0495588_0105081 3300046674 Bacteria 1485
441 Ga0495588_0222611 3300046674 Unclassified 996
442 Ga0495588_0379107 3300046674 Bacteria 743
443 Ga0495588_0457965 3300046674 Unclassified 669
444 Ga0495657_0120262 3300046675 Bacteria 1655
445 Ga0495599_0093393 3300046678 Unclassified 1877
446 Ga0495646_0127090 3300046680 Bacteria 1438
447 Ga0495646_0177250 3300046680 Unclassified 1171
448 Ga0495647_0017683 3300046681 Bacteria 2526
449 Ga0495647_0025807 3300046681 Unclassified 2149
450 Ga0495658_0000152 3300046683 Bacteria 38860
451 Ga0495658_0060968 3300046683 Bacteria 2165
452 Ga0495658_0164776 3300046683 Bacteria 1369
453 Ga0495669_0163447 3300046684 Unclassified 1057
454 Ga0495613_0035612 3300046689 Bacteria 3693
455 Ga0495613_0080390 3300046689 Unclassified 2369
456 Ga0495624_0109447 3300046690 Bacteria 1699
457 Ga0495670_0002048 3300046691 Bacteria 9938
458 Ga0495670_0522110 3300046691 Bacteria 645
459 Ga0495671_0051859 3300046692 Bacteria 2040
460 Ga0495649_0029075 3300046694 Bacteria 3061
461 Ga0495589_0085264 3300046794 Bacteria 1535
462 Ga0495589_0140828 3300046794 Unclassified 1155
463 Ga0495600_0000371 3300046809 Bacteria 23444
464 Ga0495581_0041117 3300047315 Bacteria 2675
465 Ga0495581_0190812 3300047315 Unclassified 1198
466 Ga0495604_0100204 3300047317 Bacteria 2130
467 Ga0495674_0067393 3300047319 Bacteria 3101
468 Ga0495676_0096964 3300047321 Bacteria 2191
469 Ga0495676_0202754 3300047321 Unclassified 1377
470 Ga0495680_0015678 3300047322 Bacteria 6528
471 Ga0495680_0032529 3300047322 Bacteria 4232
472 Ga0495683_0082848 3300047323 Bacteria 1562
473 Ga0495683_0144586 3300047323 Unclassified 1112
474 Ga0495679_057236 3300047446 Unclassified 1153
475 Ga0495673_0027237 3300047469 Bacteria 2723
476 Ga0495684_0000833 3300047471 Bacteria 24987
477 Ga0495686_0052729 3300047472 Bacteria 2550
478 Ga0495593_0012351 3300047673 Bacteria 4881
479 Ga0495593_0044713 3300047673 Bacteria 2367
480 Ga0495593_0151254 3300047673 Bacteria 1174
481 Ga0495602_0147759 3300048088 Unclassified 1852
482 Ga0495614_0032444 3300048089 Bacteria 2248
483 Ga0496100_0023884 3300048903 Bacteria 3722
484 Ga0496100_0046287 3300048903 Bacteria 2796
485 Ga0496100_0533881 3300048903 Bacteria 906
486 Ga0496100_0668278 3300048903 Bacteria 810
487 Ga0496101_0002683 3300048904 Bacteria 10925
488 Ga0496101_0027147 3300048904 Bacteria 3985
489 Ga0496101_0378532 3300048904 Bacteria 1114
490 Ga0496102_0029585 3300048905 Bacteria 4902
491 Ga0496102_0173288 3300048905 Bacteria 2031
492 Ga0496102_0296113 3300048905 Bacteria 1525
493 Ga0496102_0442623 3300048905 Bacteria 1219
494 Ga0496102_0486477 3300048905 Bacteria 1156
495 Ga0496103_0551204 3300048906 Bacteria 736
496 Ga0496104_0020954 3300048907 Bacteria 5997
497 Ga0496104_0021918 3300048907 Bacteria 5867
498 Ga0496104_0056665 3300048907 Plasmid 3707
499 Ga0496104_0148552 3300048907 Unclassified 2250
500 Ga0496104_0273433 3300048907 Bacteria 1602
501 Ga0496104_0277393 3300048907 Bacteria 1589
502 Ga0496105_0011493 3300048908 Bacteria 6997
503 Ga0496105_0252132 3300048908 Unclassified 1429
504 Ga0496105_0258336 3300048908 Bacteria 1409
505 Ga0496105_0683295 3300048908 Bacteria 789
506 Ga0496106_0035505 3300048909 Bacteria 3728
507 Ga0496106_0226033 3300048909 Unclassified 1493
508 Ga0496106_0270586 3300048909 Bacteria 1360
509 Ga0496106_0369412 3300048909 Bacteria 1152
510 Ga0496107_0014897 3300048910 Bacteria 5444
511 Ga0496107_0094909 3300048910 Bacteria 2182
512 Ga0496107_0162424 3300048910 Bacteria 1655
513 Ga0496108_0211722 3300048911 Bacteria 1683
514 Ga0496108_0264707 3300048911 Bacteria 1496
515 Ga0496109_0121636 3300048912 Bacteria 2432
516 Ga0496109_0372815 3300048912 Bacteria 1348
517 Ga0496111_0126533 3300048914 Bacteria 1889
518 Ga0496111_0233245 3300048914 Bacteria 1367
519 Ga0496112_0002652 3300048915 Bacteria 14459
520 Ga0496112_0006924 3300048915 Bacteria 10006
521 Ga0496112_0007055 3300048915 Bacteria 9926
522 Ga0496112_0085311 3300048915 Bacteria 3124
523 Ga0496112_0200299 3300048915 Bacteria 1956
524 Ga0496112_0290949 3300048915 Bacteria 1579
525 Ga0496113_0203589 3300048916 Bacteria 1574
526 Ga0496113_0205113 3300048916 Bacteria 1568
527 Ga0496113_0240322 3300048916 Bacteria 1445
528 Ga0496114_0005717 3300048917 Bacteria 9754
529 Ga0496114_0175993 3300048917 Bacteria 1867
530 Ga0496114_0211103 3300048917 Bacteria 1703
531 Ga0496114_0659092 3300048917 Bacteria 920
532 Ga0496115_0042702 3300048918 Bacteria 3613
533 Ga0496115_0134648 3300048918 Unclassified 2037
534 Ga0496115_0504219 3300048918 Bacteria 972
535 Ga0496119_0084552 3300048922 Bacteria 1819
536 Ga0496120_0145935 3300048923 Bacteria 1195
537 Ga0496121_0037996 3300048924 Bacteria 4270
538 Ga0496124_0453135 3300048927 Bacteria 874
539 Ga0496125_0055070 3300048928 Bacteria 3244
540 Ga0496126_0018206 3300048929 Bacteria 6970
541 Ga0496126_0018910 3300048929 Bacteria 6806
542 Ga0496126_0029391 3300048929 Bacteria 5222
543 Ga0496126_0039680 3300048929 Bacteria 4366
544 Ga0496126_0074468 3300048929 Bacteria 3015
545 Ga0496126_0790014 3300048929 Bacteria 729
546 Ga0495682_0072095 3300049460 Bacteria 1243
547 Ga0501043_0291534 3300049579 Bacteria 1249
548 Ga0501035_0192343 3300049822 Bacteria 1754
549 Ga0501044_0278618 3300049823 Bacteria 1606
550 nmdc:mga00v17_12557_c1 3300050491 Bacteria 4678
551 nmdc:mga0yw44_186409_c1 3300050492 Bacteria 1367
552 nmdc:mga0yw44_222972_c1 3300050492 Bacteria 1250
553 nmdc:mga0yw44_24303_c1 3300050492 Bacteria 3428
554 nmdc:mga0k408_137259_c1 3300050493 Bacteria 1453
555 nmdc:mga05p37_1144820_c1 3300050507 Unclassified 810
556 nmdc:mga05p37_680_c1 3300050507 Bacteria 37674
557 nmdc:mga09592_1311_c1 3300050508 Bacteria 19973
558 nmdc:mga0qj67_486890_c1 3300050509 Bacteria 992
559 nmdc:mga0qj67_720594_c1 3300050509 Bacteria 793
560 nmdc:mga0qj67_875_c1 3300050509 Bacteria 20656
561 nmdc:mga06r32_3262_c1 3300050510 Bacteria 14521
562 nmdc:mga08y16_101911_c1 3300050511 Bacteria 2989
563 nmdc:mga08y16_532777_c1 3300050511 Bacteria 1190
564 nmdc:mga0n895_2135_c1 3300050512 Bacteria 15275
565 nmdc:mga0n895_3658_c1 3300050512 Bacteria 12435
566 nmdc:mga0rr50_125025_c1 3300050513 Bacteria 2052
567 nmdc:mga0rr50_63553_c1 3300050513 Plasmid 2788
568 nmdc:mga0rr50_9668_c1 3300050513 Bacteria 6079
569 nmdc:mga08x19_140157_c1 3300050514 Unclassified 1633
570 nmdc:mga08x19_215326_c1 3300050514 Bacteria 1319
571 nmdc:mga0a205_40976_c1 3300050515 Bacteria 4460
572 nmdc:mga0sz30_33709_c1 3300050516 Bacteria 2129
573 Ga0495601_0066618 3300053077 Unclassified 2292
574 Ga0495601_0687118 3300053077 Bacteria 653
575 Ga0495612_0021507 3300053078 Bacteria 2588
576 Ga0495612_0079469 3300053078 Bacteria 1377
577 Ga0495612_0167445 3300053078 Unclassified 961
578 Ga0495655_0098803 3300053083 Bacteria 861
579 Ga0495595_0001947 3300053084 Bacteria 8016
580 Ga0495619_0000226 3300053085 Bacteria 40937
581 Ga0495619_0002788 3300053085 Bacteria 11403
582 Ga0495619_0030303 3300053085 Plasmid 3502
583 Ga0495619_0124427 3300053085 Unclassified 1769
584 Ga0495619_0186193 3300053085 Bacteria 1437
585 Ga0500651_0159063 3300053093 Bacteria 1352
586 Ga0500569_018798 3300053109 Bacteria 1790
587 Ga0500569_141263 3300053109 Bacteria 810
588 Ga0500642_0120475 3300053130 Archaea 1227
589 Ga0500652_173064 3300053131 Bacteria 888
590 Ga0500561_0019450 3300053137 Bacteria 1573
591 Ga0500616_0072837 3300053153 Bacteria 1746
592 Ga0500622_0015411 3300053156 Bacteria 4093
593 Ga0500636_0022085 3300053177 Bacteria 3765
594 Ga0500645_012587 3300053730 Bacteria 2733
595 2513679847 2513237098 Bacteria 9902361
596 2513705672 2513237102 Bacteria 7703324
597 2524438971 2524023205 Bacteria 8918781
598 2524463541 2524023210 Bacteria 9029266
599 2524538267 2524023228 Bacteria 10118060
600 2528857730 2528768022 Bacteria 10457665
601 2728755197 2728368998 Bacteria 8720350
602 2745078918 2744054633 Bacteria 8678936
603 2824604322 2824600985 Bacteria 8488197
604 2824614205 2824609381 Bacteria 8672835
605 2824624448 2824617872 Bacteria 8814715
606 2824634231 2824626560 Bacteria 8813858
607 2824640900 2824635225 Bacteria 8785348
608 2824649150 2824644064 Bacteria 8743947
609 2824658343 2824653114 Bacteria 8493680
610 2824662980 2824661429 Bacteria 9877870
611 2824709205 2824704595 Bacteria 9667483
612 2824718934 2824714736 Bacteria 8717648
613 2824728870 2824723954 Bacteria 8758240
614 2824757784 2824753945 Bacteria 9787441
615 2824768704 2824763712 Bacteria 9792355
616 2879100953 2879099564 Bacteria 10442239
617 2885390646 2885383462 Bacteria 9473874
618 2885412335 2885409591 Bacteria 9235467
619 2888421514 2888419890 Bacteria 7857137
620 2903758756 2903748898 Bacteria 9972761
621 2903772880 2903768456 Bacteria 9749579
622 2904706689
623 2904710398
624 2904711632 2904711408 Bacteria 9771557
625 2906612083
626 2906642613 2906635258 Bacteria 8601019
627 2906668066 2906660503 Bacteria 8595048
628 2922371642
629 2922427212
630 2929616986 2929615660 Bacteria 9193770
631 2929625729 2929624759 Bacteria 9339455
632 2932790724 2932784394 Bacteria 9704911
633 2932811910 2932809354 Bacteria 9135765
634 2932822604 2932818245 Bacteria 9955613
635 2932831189 2932828146 Bacteria 9745859
636 2933577732 2933577622 Bacteria 9116884
637 2935624774 2935616580 Bacteria 9032984
638 2935645999 2935638405 Bacteria 10015038
639 2935670662 2935665750 Bacteria 9571747
640 2935679588 2935675223 Bacteria 9928132
641 2935691396 2935684952 Bacteria 9590419
642 2935701957 2935694250 Bacteria 9291695
643 2935704582 2935703347 Bacteria 10242284
644 2935719230 2935713505 Bacteria 9608509
645 2935729170 2935722832 Bacteria 9608746
646 2935737589 2935732158 Bacteria 9706831
647 2935746965 2935741537 Bacteria 9707219
648 2935758236 2935750917 Bacteria 9590372
649 2935768913 2935760218 Bacteria 9817913
650 2935807980 2935801545 Bacteria 9301974
651 2935816432 2935810662 Bacteria 9401221
652 2935835279 2935827899 Bacteria 10038562
653 2935842827 2935837841 Bacteria 9454360
654 2935863404 2935855204 Bacteria 9035059
655 2935871515 2935864058 Bacteria 9784707
656 2935881764 2935873716 Bacteria 9632195
657 2935963819 2935959822 Bacteria 7869783
658 2935991718 2935984226 Bacteria 8302647
659 2935993817 2935992306 Bacteria 9802711
660 2936010407 2936002035 Bacteria 9362176
661 2936042616 2936037263 Bacteria 9446081
662 2940563854 2940556831 Bacteria 9590747
663 2941512873 2941507105 Bacteria 8166816
664 2941520825 2941515067 Bacteria 8166720
665 2941528840 2941523033 Bacteria 8169134
666 2941547577 2941538514 Bacteria 9402094
667 3005476390 3005474847 Bacteria 9259049
668 8006977941 8006973647 Bacteria 10679141
669 8016516121 8016511872 Bacteria 9921665
670 8019560905 8019555841 Bacteria 9642137
671 8019570988 8019565922 Bacteria 9639779
672 8019579874 8019576017 Bacteria 10049540
673 8019587584 8019586578 Bacteria 10212056
674 8019603748 8019597564 Bacteria 10041141
675 8055748632 8055742211 Bacteria 9226248
676 Ga0501037_0680241
677 2214903546
678 rootL2_10253805
679 JGI25404J52841_10000157
680 JGI25404J52841_10003760
681 Ga0055526_1000017
682 JGI25405J52794_10002634
683 Ga0065707_10093537
684 Ga0070683_100010101
685 Ga0070683_100691745
686 Ga0068869_100361976
687 Ga0070680_100004367
688 Ga0070682_100336990
689 Ga0070682_100457694
690 Ga0070661_100103748
691 Ga0070661_101085872
692 Ga0070668_100059496
693 Ga0070674_100355665
694 Ga0070659_100295845
695 Ga0070659_100635326
696 Ga0070659_100914708
697 Ga0070709_10041187
698 Ga0070709_10047750
699 Ga0070709_10068067
700 Ga0070709_10193325
701 Ga0070714_100023373
702 Ga0070714_100112049
703 Ga0070713_100100099
704 Ga0070713_100149595
705 Ga0070710_10010487
706 Ga0070710_10095377
707 Ga0070710_10866479
708 Ga0070711_100005899
709 Ga0070711_100023728
710 Ga0070711_100118870
711 Ga0070705_100346017
712 Ga0070705_100515256
713 Ga0070708_100052744
714 Ga0070708_100416656
715 Ga0070678_100020190
716 Ga0070678_100350490
717 Ga0070678_100680654
718 Ga0070662_100360794
719 Ga0070662_100398864
720 Ga0070681_10054264
721 Ga0070681_10520080
722 Ga0068867_100339057
723 Ga0068867_100668679
724 Ga0070707_100056954
725 Ga0070698_100170504
726 Ga0070699_100246437
727 Ga0070679_100016507
728 Ga0070684_100018545
729 Ga0070684_100545143
730 Ga0070697_100639524
731 Ga0068853_100967803
732 Ga0070665_100098986
733 Ga0070665_100367653
734 Ga0068855_100627281
735 Ga0070664_100158216
736 Ga0070664_100832765
737 Ga0070664_101001531
738 Ga0070702_100354904
739 Ga0068852_100216948
740 Ga0068852_100227240
741 Ga0068859_100039458
742 Ga0068864_100620157
743 Ga0068866_10218240
744 Ga0068861_100079481
745 Ga0068863_100110236
746 Ga0068858_100054886
747 Ga0068858_100203877
748 Ga0068858_100586227
749 Ga0068860_101094251
750 Ga0068862_100061041
751 Ga0081455_10002775
752 Ga0081455_10126164
753 Ga0081540_1000007
754 Ga0081540_1002952
755 Ga0081540_1008602
756 Ga0081540_1024259
757 Ga0081540_1031671
758 Ga0070717_10101024
759 Ga0070717_10262011
760 Ga0070717_10286940
761 Ga0075432_10049962
762 Ga0070715_10052783
763 Ga0070716_100029117
764 Ga0070716_100032263
765 Ga0070716_100072459
766 Ga0070716_100079094
767 Ga0070716_100123125
768 Ga0070712_100018358
769 Ga0070712_100057663
770 Ga0070712_100071040
771 Ga0070712_100092004
772 Ga0070712_100242605
773 Ga0070712_100387349
774 Ga0075362_10037398
775 Ga0075367_10014569
776 Ga0075367_10128464
777 Ga0075427_10000354
778 Ga0075366_10104621
779 Ga0075366_10142200
780 Ga0097621_100279573
781 Ga0068871_100355788
782 Ga0075428_100048886
783 Ga0075428_100803382
784 Ga0075430_100048619
785 Ga0075430_100168667
786 Ga0075430_100222511
787 Ga0075431_100018424
788 Ga0075431_100355595
789 Ga0075431_100503924
790 Ga0075433_10001379
791 Ga0075434_100000955
792 Ga0075434_100386467
793 Ga0075434_101429902
794 Ga0075429_100048486
795 Ga0068865_100311159
796 Ga0068865_100385645
797 Ga0075436_100051988
798 Ga0075436_100075126
799 Ga0075436_100168326
800 Ga0097620_100039461
801 Ga0099825_1022943
802 Ga0099824_1006697
803 Ga0099824_1022677
804 Ga0099822_1000400
805 Ga0099823_1005442
806 Ga0075435_100008603
807 Ga0075435_100016634
808 Ga0099795_10003062
809 Ga0099795_10071224
810 Ga0099795_10153749
811 Ga0105240_10548066
812 Ga0111539_10002210
813 Ga0111539_10741876
814 Ga0111539_10936400
815 Ga0105245_10157759
816 Ga0105245_10609166
817 Ga0105247_10068288
818 Ga0105247_10462644
819 Ga0114129_10004325
820 Ga0114129_10090717
821 Ga0114129_10288465
822 Ga0114129_11559254
823 Ga0105243_10113349
824 Ga0105248_10547560
825 Ga0105237_10028665
826 Ga0105237_10853728
827 Ga0105238_10115554
828 Ga0105238_10153957
829 Ga0105238_10828794
830 Ga0105249_10141574
831 Ga0105249_10370123
832 Ga0105249_10382346
833 Ga0105249_10956314
834 Ga0099796_10001301
835 Ga0105239_10092223
836 Ga0105239_10239833
837 Ga0105239_10247552
838 Ga0105239_10739286
839 Ga0105239_11038631
840 Ga0105246_10131389
841 Ga0105246_10194883
842 Ga0105246_10209452
843 Ga0105246_10372548
844 Ga0157370_10595798
845 Ga0157369_10132290
846 Ga0157369_10293846
847 Ga0157369_10885796
848 Ga0157374_10081161
849 Ga0157374_10131135
850 Ga0157378_10241907
851 Ga0157378_11008563
852 Ga0163162_10021405
853 Ga0163162_10178978
854 Ga0163162_10529058
855 Ga0163162_10562090
856 Ga0157372_10130526
857 Ga0157375_10014997
858 Ga0157375_10092513
859 Ga0157375_10148119
860 Ga0157375_10281430
861 Ga0157375_10294598
862 Ga0157375_10431450
863 Ga0163163_10086658
864 Ga0163163_10201610
865 Ga0163163_10242843
866 Ga0163163_10582566
867 Ga0157380_10177448
868 Ga0157380_11183254
869 Ga0157379_10177528
870 Ga0157379_10295804
871 Ga0157376_10013260
872 Ga0157376_10160664
873 Ga0157376_10242462
874 Ga0163161_10185932
875 Ga0163161_10243896
876 Ga0209564_1000031
877 Ga0209758_1054423
878 Ga0209256_1032806
879 Ga0207692_10022395
880 Ga0207692_10132090
881 Ga0207642_10019351
882 Ga0207642_10088977
883 Ga0207710_10003608
884 Ga0207688_10048054
885 Ga0207688_10314931
886 Ga0207680_10073650
887 Ga0207685_10212805
888 Ga0207699_10066230
889 Ga0207699_10113593
890 Ga0207699_10131327
891 Ga0207684_10067106
892 Ga0207684_10123431
893 Ga0207707_10205216
894 Ga0207671_10130596
895 Ga0207671_10457424
896 Ga0207671_10543547
897 Ga0207693_10040602
898 Ga0207693_10059242
899 Ga0207693_10060622
900 Ga0207693_10143659
901 Ga0207663_10004379
902 Ga0207663_10015813
903 Ga0207663_10018522
904 Ga0207663_10028793
905 Ga0207660_10086758
906 Ga0207649_10537073
907 Ga0207652_10475212
908 Ga0207646_10057827
909 Ga0207694_10121111
910 Ga0207694_10639635
911 Ga0207650_10067804
912 Ga0207659_10320734
913 Ga0207687_10586276
914 Ga0207687_10689929
915 Ga0207700_10017216
916 Ga0207700_10020087
917 Ga0207664_10040596
918 Ga0207664_10195771
919 Ga0207644_10009440
920 Ga0207644_10697634
921 Ga0207690_10511338
922 Ga0207706_10144813
923 Ga0207706_10164906
924 Ga0207706_10220062
925 Ga0207709_10775635
926 Ga0207669_10017711
927 Ga0207669_11133205
928 Ga0207704_10434299
929 Ga0207665_10001963
930 Ga0207665_10032721
931 Ga0207665_10034597
932 Ga0207665_10067647
933 Ga0207665_10097794
934 Ga0207691_10303336
935 Ga0207711_10438845
936 Ga0207689_10039377
937 Ga0207661_10011213
938 Ga0207679_10068177
939 Ga0207667_10792947
940 Ga0207712_10238984
941 Ga0207668_10408160
942 Ga0207668_10806776
943 Ga0207703_10089041
944 Ga0207703_10151218
945 Ga0207639_10259398
946 Ga0207639_10260032
947 Ga0207678_10007287
948 Ga0207648_10144013
949 Ga0207676_10011889
950 Ga0207674_10248745
951 Ga0207675_100214659
952 Ga0207683_10006102
953 Ga0207683_10011399
954 Ga0207683_10290693
955 Ga0207683_10454822
956 Ga0207683_10460508
957 Ga0207698_10347042
958 Ga0209389_1000230
959 Ga0209589_1000030
960 Ga0209489_100056
961 Ga0209489_102489
962 Ga0209700_100059
963 Ga0209700_102336
964 Ga0209179_1000668
965 Ga0209813_10009378
966 Ga0207428_10000175
967 Ga0207428_10273598
968 Ga0268266_10019159
969 Ga0268266_10446349
970 Ga0268265_10940311
971 Ga0268264_11128136
972 Ga0307515_10073384
973 Ga0265332_10018826
974 Ga0265325_10062220
975 Ga0265340_10004896
976 Ga0265331_10043689
977 Ga0265313_10137039
978 Ga0316579_10048653
979 Ga0316585_10100666
980 Ga0373950_0003065
981 Ga0373926_0123916
982 Ga0373928_0012919
983 Ga0373929_0093477
984 Ga0373934_0124112
985 Ga0373934_0144400
986 Ga0373944_0017338
987 Ga0373944_0055243
988 Ga0373951_0001848
989 Ga0373952_0092455
990 Ga0373923_0014643
991 Ga0373923_0172325
992 Ga0373936_0027816
993 Ga0373936_0202018
994 Ga0373939_0004023
995 Ga0373941_0046147
996 Ga0373945_0104768
997 Ga0373953_0040633
998 Ga0373953_0349405
999 Ga0373954_0070128
1000 Ga0373956_0046703
1001 Ga0373956_0079733
1002 Ga0373957_0105222
1003 Ga0373960_0005831
1004 Ga0373943_0006001
1005 Ga0373943_0018913
1006 Ga0373943_0122973
1007 Ga0373943_0313718
1008 Ga0373946_0022748
1009 Ga0373946_0106299
1010 Ga0373946_0213334
1011 Ga0373955_0047251
1012 Ga0373961_0055335
1013 Ga0373962_0015824
1014 Ga0316574_0002113
1015 Ga0373924_0047382
1016 Ga0373924_0346146
1017 Ga0373931_0103125
1018 Ga0373931_0125032
1019 Ga0373931_0315127
1020 Ga0373931_0696751
1021 Ga0373935_0009442
1022 Ga0373935_0009482
1023 Ga0373927_0035553
1024 Ga0373927_0035641
1025 Ga0373927_0092247
1026 Ga0373927_0151119
1027 Ga0373927_0151907
1028 Ga0373933_0067278
1029 Ga0373933_0258833
1030 Ga0373947_0003160
1031 Ga0373947_0056730
1032 Ga0373947_0120325
1033 Ga0373937_0080281
1034 Ga0373925_0003762
1035 Ga0373925_0039828
1036 Ga0373925_0331326
1037 Ga0395905_0037866
1038 Ga0395905_0119480
1039 Ga0395905_1254591
1040 Ga0436365_0818135
1041 Ga0436360_0119969
1042 Ga0436361_1079311
1043 Ga0436363_0520046
1044 Ga0453684_0613583
1045 Ga0466967_0721292
1046 Ga0495592_0072780
1047 Ga0495592_0135377
1048 Ga0495603_0003383
1049 Ga0495603_0058755
1050 Ga0495603_0274436
1051 Ga0495591_082145
1052 Ga0495629_0003887
1053 Ga0495629_0049074
1054 Ga0495629_0106392
1055 Ga0495629_0147664
1056 Ga0495641_0025447
1057 Ga0495651_0279060
1058 Ga0495653_0011422
1059 Ga0495580_0022700
1060 Ga0495580_0125171
1061 Ga0495580_0156975
1062 Ga0495582_0006191
1063 Ga0495582_0196669
1064 Ga0495582_0374330
1065 Ga0495605_0231228
1066 Ga0495639_0196149
1067 Ga0495662_0128880
1068 Ga0495664_0052425
1069 Ga0495664_0135490
1070 Ga0495664_0142123
1071 Ga0495664_0169067
1072 Ga0495664_0246569
1073 Ga0495585_0100951
1074 Ga0495585_0209636
1075 Ga0495594_0014908
1076 Ga0495594_0160602
1077 Ga0495596_0108178
1078 Ga0495583_0066676
1079 Ga0495583_0090081
1080 Ga0495606_0000960
1081 Ga0495606_0030301
1082 Ga0495608_0039225
1083 Ga0495616_0165634
1084 Ga0495618_0124214
1085 Ga0495628_0063408
1086 Ga0495630_0168654
1087 Ga0495630_0197117
1088 Ga0495643_0063003
1089 Ga0495643_0098258
1090 Ga0495644_0001216
1091 Ga0495663_0065779
1092 Ga0495666_0075316
1093 Ga0495666_0141410
1094 Ga0495652_0027986
1095 Ga0495652_0469079
1096 Ga0495654_0166804
1097 Ga0495665_0162786
1098 Ga0495665_0233958
1099 Ga0495586_0141950
1100 Ga0495586_0299897
1101 Ga0495645_0006752
1102 Ga0495622_0002104
1103 Ga0495622_0034099
1104 Ga0495667_0032377
1105 Ga0495656_0000452
1106 Ga0495668_0560110
1107 Ga0495634_0104007
1108 Ga0495611_0013498
1109 Ga0495625_0035962
1110 Ga0495625_0532690
1111 Ga0495635_0028895
1112 Ga0495635_0769755
1113 Ga0495659_0074239
1114 Ga0495661_0148113
1115 Ga0495588_0105081
1116 Ga0495588_0222611
1117 Ga0495588_0379107
1118 Ga0495588_0457965
1119 Ga0495657_0120262
1120 Ga0495599_0093393
1121 Ga0495646_0127090
1122 Ga0495646_0177250
1123 Ga0495647_0017683
1124 Ga0495647_0025807
1125 Ga0495658_0000152
1126 Ga0495658_0060968
1127 Ga0495658_0164776
1128 Ga0495669_0163447
1129 Ga0495613_0035612
1130 Ga0495613_0080390
1131 Ga0495624_0109447
1132 Ga0495670_0002048
1133 Ga0495670_0522110
1134 Ga0495671_0051859
1135 Ga0495649_0029075
1136 Ga0495589_0085264
1137 Ga0495589_0140828
1138 Ga0495600_0000371
1139 Ga0495581_0041117
1140 Ga0495581_0190812
1141 Ga0495604_0100204
1142 Ga0495674_0067393
1143 Ga0495676_0096964
1144 Ga0495676_0202754
1145 Ga0495680_0015678
1146 Ga0495680_0032529
1147 Ga0495683_0082848
1148 Ga0495683_0144586
1149 Ga0495679_057236
1150 Ga0495673_0027237
1151 Ga0495684_0000833
1152 Ga0495686_0052729
1153 Ga0495593_0012351
1154 Ga0495593_0044713
1155 Ga0495593_0151254
1156 Ga0495602_0147759
1157 Ga0495614_0032444
1158 Ga0496100_0023884
1159 Ga0496100_0046287
1160 Ga0496100_0533881
1161 Ga0496100_0668278
1162 Ga0496101_0002683
1163 Ga0496101_0027147
1164 Ga0496101_0378532
1165 Ga0496102_0029585
1166 Ga0496102_0173288
1167 Ga0496102_0296113
1168 Ga0496102_0442623
1169 Ga0496102_0486477
1170 Ga0496103_0551204
1171 Ga0496104_0020954
1172 Ga0496104_0021918
1173 Ga0496104_0056665
1174 Ga0496104_0148552
1175 Ga0496104_0273433
1176 Ga0496104_0277393
1177 Ga0496105_0011493
1178 Ga0496105_0252132
1179 Ga0496105_0258336
1180 Ga0496105_0683295
1181 Ga0496106_0035505
1182 Ga0496106_0226033
1183 Ga0496106_0270586
1184 Ga0496106_0369412
1185 Ga0496107_0014897
1186 Ga0496107_0094909
1187 Ga0496107_0162424
1188 Ga0496108_0211722
1189 Ga0496108_0264707
1190 Ga0496109_0121636
1191 Ga0496109_0372815
1192 Ga0496111_0126533
1193 Ga0496111_0233245
1194 Ga0496112_0002652
1195 Ga0496112_0006924
1196 Ga0496112_0007055
1197 Ga0496112_0085311
1198 Ga0496112_0200299
1199 Ga0496112_0290949
1200 Ga0496113_0203589
1201 Ga0496113_0205113
1202 Ga0496113_0240322
1203 Ga0496114_0005717
1204 Ga0496114_0175993
1205 Ga0496114_0211103
1206 Ga0496114_0659092
1207 Ga0496115_0042702
1208 Ga0496115_0134648
1209 Ga0496115_0504219
1210 Ga0496119_0084552
1211 Ga0496120_0145935
1212 Ga0496121_0037996
1213 Ga0496124_0453135
1214 Ga0496125_0055070
1215 Ga0496126_0018206
1216 Ga0496126_0018910
1217 Ga0496126_0029391
1218 Ga0496126_0039680
1219 Ga0496126_0074468
1220 Ga0496126_0790014
1221 Ga0495682_0072095
1222 Ga0501043_0291534
1223 Ga0501035_0192343
1224 Ga0501044_0278618
1225 nmdc:mga00v17_12557_c1
1226 nmdc:mga0yw44_186409_c1
1227 nmdc:mga0yw44_222972_c1
1228 nmdc:mga0yw44_24303_c1
1229 nmdc:mga0k408_137259_c1
1230 nmdc:mga05p37_1144820_c1
1231 nmdc:mga05p37_680_c1
1232 nmdc:mga09592_1311_c1
1233 nmdc:mga0qj67_486890_c1
1234 nmdc:mga0qj67_720594_c1
1235 nmdc:mga0qj67_875_c1
1236 nmdc:mga06r32_3262_c1
1237 nmdc:mga08y16_101911_c1
1238 nmdc:mga08y16_532777_c1
1239 nmdc:mga0n895_2135_c1
1240 nmdc:mga0n895_3658_c1
1241 nmdc:mga0rr50_125025_c1
1242 nmdc:mga0rr50_63553_c1
1243 nmdc:mga0rr50_9668_c1
1244 nmdc:mga08x19_140157_c1
1245 nmdc:mga08x19_215326_c1
1246 nmdc:mga0a205_40976_c1
1247 nmdc:mga0sz30_33709_c1
1248 Ga0495601_0066618
1249 Ga0495601_0687118
1250 Ga0495612_0021507
1251 Ga0495612_0079469
1252 Ga0495612_0167445
1253 Ga0495655_0098803
1254 Ga0495595_0001947
1255 Ga0495619_0000226
1256 Ga0495619_0002788
1257 Ga0495619_0030303
1258 Ga0495619_0124427
1259 Ga0495619_0186193
1260 Ga0500651_0159063
1261 Ga0500569_018798
1262 Ga0500569_141263
1263 Ga0500642_0120475
1264 Ga0500652_173064
1265 Ga0500561_0019450
1266 Ga0500616_0072837
1267 Ga0500622_0015411
1268 Ga0500636_0022085
1269 Ga0500645_012587
1270 2513679847
1271 2513705672
1272 2524438971
1273 2524463541
1274 2524538267
1275 2528857730
1276 2728755197
1277 2745078918
1278 2824604322
1279 2824614205
1280 2824624448
1281 2824634231
1282 2824640900
1283 2824649150
1284 2824658343
1285 2824662980
1286 2824709205
1287 2824718934
1288 2824728870
1289 2824757784
1290 2824768704
1291 2879100953
1292 2885390646
1293 2885412335
1294 2888421514
1295 2903758756
1296 2903772880
1297 2904706689
1298 2904710398
1299 2904711632
1300 2906612083
1301 2906642613
1302 2906668066
1303 2922371642
1304 2922427212
1305 2929616986
1306 2929625729
1307 2932790724
1308 2932811910
1309 2932822604
1310 2932831189
1311 2933577732
1312 2935624774
1313 2935645999
1314 2935670662
1315 2935679588
1316 2935691396
1317 2935701957
1318 2935704582
1319 2935719230
1320 2935729170
1321 2935737589
1322 2935746965
1323 2935758236
1324 2935768913
1325 2935807980
1326 2935816432
1327 2935835279
1328 2935842827
1329 2935863404
1330 2935871515
1331 2935881764
1332 2935963819
1333 2935991718
1334 2935993817
1335 2936010407
1336 2936042616
1337 2940563854
1338 2941512873
1339 2941520825
1340 2941528840
1341 2941547577
1342 3005476390
1343 8006977941
1344 8016516121
1345 8019560905
1346 8019570988
1347 8019579874
1348 8019587584
1349 8019603748
1350 8055748632

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

77

179

0.89

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

77

174

0.76

PF06966

DUF1295

Protein of unknown function (DUF1295)

5

187

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.9519 1 191
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.9424 1 191
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.6703 33 193
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.6097 9 193
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.5829 9 193
ID Description Score Start End Superfamily
4a2nB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9519 1 191 1.20.120.1630
4a2nB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9424 1 191 1.20.120.1630
af_Q8I555_347_506_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8438 76 192 1.20.120.1630
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8247 74 192 1.20.120.1630
af_Q4D7B7_120_287_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7467 49 192 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A7Y6T3J4-F1-model_v4 deleted 0.9776 1 155
AF-C0G9J4-F1-model_v4 Farnesyl cysteine carboxyl-methyltransferase 0.9771 1 191 GO:0004671
GO:0016020
GO:0032259
AF-A0A7R7T828-F1-model_v4 Farnesyl cysteine carboxyl-methyltransferase 0.9694 1 194 GO:0004671
GO:0016020
GO:0032259
AF-A0A0G3BLN1-F1-model_v4 Farnesyl cysteine carboxyl-methyltransferase 0.9669 6 191 GO:0004671
GO:0016020
GO:0032259
AF-A0A7C7WRW1-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9661 1 191 GO:0004671
GO:0016020
GO:0032259

Map