F474464

General Info

Members Datasets Scaffolds Average Seq Length
675 263 664 388

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0008583|Ga0501031_0008583_482_1792
Length 436
Sequence MTGKLLMNSFGGQKTNNKPVCSSFPVRERKPWYFMAEKHQTQQAKKTAAATSAAKRIAIFGSTGSIGQQALEVIAANSNTLSVEILTAFSNDELLVEQALQYNPHIVVIGDEAKYKKVKEALAATDVKVFAGEKALEEVAGMDCYDLMLAAIVGFAGLKPTIKAIETGKPVALANKETLVVAGDIVMRKAVENRVPVIPVDSEHSAIFQCLIGETRNRIEKIILTASGGPFLGRKPNYLVNVKREHALQHPNWRMGAKISIDSATLMNKGLEMIEAKFLFNLSPEQIQVVIHPQSVIHSMVQFEDGSIKAQMGMPDMRLPIQYALAFPRRVKNDFPRFDFRRFNTLTFEEPDTKTFRNLALAMDALEKGGNLPCIMNAANEIAVYAFLRNRIGFLEMTDVIEKTMQKVAFIAEPTLGEYFDSDAEARNFAADIIKL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
11 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
233 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
234 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
238 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
241 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
242 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
255 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
260 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 0.44
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10003308 3300002459 Bacteria 3247
2 rootH2_10000662 3300003320 Bacteria 21508
3 rootH2_10047594 3300003320 Bacteria 7211
4 rootH2_10055958 3300003320 Bacteria 5068
5 rootL2_10314777 3300003322 Bacteria 1976
6 rootH1_10267761 3300003323 Bacteria 1450
7 JGI25160J50197_1003799 3300003354 Bacteria 6646
8 Ga0065712_10003389 3300005290 Bacteria 8432
9 Ga0065712_10079428 3300005290 Bacteria 3209
10 Ga0065715_10138427 3300005293 Bacteria 1892
11 Ga0065707_10096512 3300005295 Bacteria 3261
12 Ga0070683_100002217 3300005329 Bacteria 15393
13 Ga0070683_100059400 3300005329 Bacteria 3553
14 Ga0070690_100042620 3300005330 Bacteria 2875
15 Ga0070690_100177233 3300005330 Bacteria 1471
16 Ga0070670_100005355 3300005331 Bacteria 10826
17 Ga0070670_100059762 3300005331 Bacteria 3272
18 Ga0070670_100059840 3300005331 Bacteria 3270
19 Ga0070670_100091228 3300005331 Bacteria 2619
20 Ga0070670_100219286 3300005331 Unclassified 1655
21 Ga0068869_100009899 3300005334 Bacteria 6193
22 Ga0068869_100011172 3300005334 Bacteria 5884
23 Ga0068869_100013888 3300005334 Bacteria 5369
24 Ga0068869_100029853 3300005334 Bacteria 3823
25 Ga0068869_100070135 3300005334 Bacteria 2593
26 Ga0068869_100139101 3300005334 Bacteria 1873
27 Ga0070666_10000323 3300005335 Bacteria 30548
28 Ga0070666_10039661 3300005335 Bacteria 3140
29 Ga0070666_10050834 3300005335 Bacteria 2789
30 Ga0070666_10089312 3300005335 Bacteria 2115
31 Ga0070680_100088694 3300005336 Bacteria 2559
32 Ga0070682_100015101 3300005337 Bacteria 4471
33 Ga0068868_100003336 3300005338 Bacteria 11167
34 Ga0068868_100011769 3300005338 Bacteria 6377
35 Ga0068868_100073311 3300005338 Bacteria 2734
36 Ga0068868_100192204 3300005338 Bacteria 1698
37 Ga0070660_100018241 3300005339 Bacteria 5125
38 Ga0070660_100022575 3300005339 Bacteria 4655
39 Ga0070660_100084249 3300005339 Bacteria 2498
40 Ga0070660_100091007 3300005339 Bacteria 2406
41 Ga0070660_100102205 3300005339 Bacteria 2272
42 Ga0070689_100029388 3300005340 Bacteria 4160
43 Ga0070689_100032832 3300005340 Bacteria 3951
44 Ga0070689_100044422 3300005340 Bacteria 3418
45 Ga0070689_100081519 3300005340 Bacteria 2541
46 Ga0070689_100167422 3300005340 Bacteria 1779
47 Ga0070687_100018802 3300005343 Bacteria 3204
48 Ga0070661_100017392 3300005344 Bacteria 5100
49 Ga0070661_100018414 3300005344 Bacteria 4964
50 Ga0070661_100023003 3300005344 Bacteria 4464
51 Ga0070661_100125671 3300005344 Bacteria 1924
52 Ga0070661_100148562 3300005344 Bacteria 1771
53 Ga0070668_100016410 3300005347 Bacteria 5537
54 Ga0070668_100027498 3300005347 Bacteria 4319
55 Ga0070668_100044169 3300005347 Bacteria 3418
56 Ga0070669_100035696 3300005353 Bacteria 3602
57 Ga0070669_100107719 3300005353 Bacteria 2111
58 Ga0070675_100011046 3300005354 Bacteria 7067
59 Ga0070675_100075487 3300005354 Bacteria 2802
60 Ga0070675_100095534 3300005354 Bacteria 2496
61 Ga0070675_100260120 3300005354 Bacteria 1521
62 Ga0070671_100017656 3300005355 Bacteria 5782
63 Ga0070671_100028756 3300005355 Bacteria 4580
64 Ga0070671_100045574 3300005355 Bacteria 3645
65 Ga0070671_100051054 3300005355 Bacteria 3439
66 Ga0070671_100171340 3300005355 Bacteria 1836
67 Ga0070674_100034090 3300005356 Bacteria 3396
68 Ga0070674_100040391 3300005356 Bacteria 3156
69 Ga0070673_100003881 3300005364 Bacteria 9392
70 Ga0070673_100007833 3300005364 Bacteria 7075
71 Ga0070673_100017291 3300005364 Bacteria 5122
72 Ga0070673_100169166 3300005364 Bacteria 1864
73 Ga0070673_100210247 3300005364 Bacteria 1680
74 Ga0070688_100001020 3300005365 Bacteria 14044
75 Ga0070688_100015259 3300005365 Bacteria 4365
76 Ga0070688_100128996 3300005365 Bacteria 1703
77 Ga0070688_100131620 3300005365 Bacteria 1688
78 Ga0070659_100020130 3300005366 Bacteria 5066
79 Ga0070659_100027199 3300005366 Bacteria 4405
80 Ga0070659_100170706 3300005366 Bacteria 1781
81 Ga0070659_100187531 3300005366 Bacteria 1699
82 Ga0070667_100013727 3300005367 Bacteria 6696
83 Ga0070667_100018635 3300005367 Bacteria 5757
84 Ga0070711_100182489 3300005439 Bacteria 1607
85 Ga0070700_100095785 3300005441 Bacteria 1946
86 Ga0070663_100160268 3300005455 Bacteria 1731
87 Ga0070663_100172448 3300005455 Bacteria 1673
88 Ga0070678_100005562 3300005456 Bacteria 7307
89 Ga0070678_100069065 3300005456 Bacteria 2637
90 Ga0070678_100166679 3300005456 Bacteria 1790
91 Ga0070678_100245311 3300005456 Bacteria 1499
92 Ga0070662_100008210 3300005457 Bacteria 6799
93 Ga0070662_100009369 3300005457 Bacteria 6399
94 Ga0070662_100012225 3300005457 Bacteria 5685
95 Ga0070662_100034475 3300005457 Bacteria 3569
96 Ga0070662_100072463 3300005457 Bacteria 2543
97 Ga0070662_100122478 3300005457 Bacteria 1995
98 Ga0070681_10022539 3300005458 Bacteria 6324
99 Ga0070681_10090546 3300005458 Bacteria 3009
100 Ga0070681_10104078 3300005458 Bacteria 2781
101 Ga0070681_10123837 3300005458 Bacteria 2518
102 Ga0068867_100066917 3300005459 Bacteria 2677
103 Ga0068867_100100906 3300005459 Bacteria 2204
104 Ga0070685_10127139 3300005466 Bacteria 1589
105 Ga0070698_100015928 3300005471 Bacteria 7939
106 Ga0070698_100092573 3300005471 Bacteria 3004
107 Ga0070684_100002271 3300005535 Bacteria 14151
108 Ga0070684_100003761 3300005535 Bacteria 11452
109 Ga0070684_100012134 3300005535 Bacteria 6891
110 Ga0070684_100014398 3300005535 Bacteria 6407
111 Ga0070684_100159782 3300005535 Bacteria 2044
112 Ga0068853_100004842 3300005539 Bacteria 10463
113 Ga0068853_100008095 3300005539 Bacteria 8436
114 Ga0070672_100030153 3300005543 Bacteria 4072
115 Ga0070686_100042697 3300005544 Bacteria 2842
116 Ga0070665_100000013 3300005548 Bacteria 484927
117 Ga0070665_100050472 3300005548 Bacteria 4175
118 Ga0070665_100158098 3300005548 Bacteria 2268
119 Ga0068855_100008376 3300005563 Bacteria 12504
120 Ga0068855_100008654 3300005563 Bacteria 12297
121 Ga0068855_100038494 3300005563 Bacteria 5682
122 Ga0068855_100082497 3300005563 Bacteria 3726
123 Ga0068855_100086271 3300005563 Bacteria 3630
124 Ga0068855_100100971 3300005563 Bacteria 3321
125 Ga0068855_100227409 3300005563 Bacteria 2090
126 Ga0070664_100008760 3300005564 Bacteria 8197
127 Ga0070664_100009912 3300005564 Bacteria 7723
128 Ga0070664_100022766 3300005564 Bacteria 5169
129 Ga0070664_100077678 3300005564 Bacteria 2855
130 Ga0070664_100175937 3300005564 Bacteria 1900
131 Ga0070664_100225131 3300005564 Unclassified 1679
132 Ga0070664_100229713 3300005564 Bacteria 1663
133 Ga0068857_100008973 3300005577 Bacteria 8664
134 Ga0068857_100013968 3300005577 Bacteria 6987
135 Ga0068857_100027334 3300005577 Bacteria 5033
136 Ga0068857_100040424 3300005577 Bacteria 4135
137 Ga0068857_100111325 3300005577 Bacteria 2461
138 Ga0068857_100131169 3300005577 Bacteria 2260
139 Ga0068854_100046604 3300005578 Bacteria 3087
140 Ga0068856_100011161 3300005614 Bacteria 8722
141 Ga0068856_100033995 3300005614 Bacteria 4993
142 Ga0068856_100044676 3300005614 Bacteria 4361
143 Ga0068856_100049244 3300005614 Bacteria 4153
144 Ga0068852_100002185 3300005616 Bacteria 13412
145 Ga0068852_100007001 3300005616 Bacteria 8208
146 Ga0068852_100010881 3300005616 Bacteria 6817
147 Ga0068852_100054037 3300005616 Bacteria 3460
148 Ga0068852_100119294 3300005616 Bacteria 2411
149 Ga0068852_100143648 3300005616 Bacteria 2211
150 Ga0068859_100000106 3300005617 Bacteria 78128
151 Ga0068859_100013598 3300005617 Bacteria 8160
152 Ga0068859_100023855 3300005617 Bacteria 6140
153 Ga0068859_100030317 3300005617 Bacteria 5427
154 Ga0068859_100191463 3300005617 Bacteria 2130
155 Ga0068859_100455329 3300005617 Bacteria 1376
156 Ga0068864_100027728 3300005618 Bacteria 4785
157 Ga0068864_100304264 3300005618 Bacteria 1493
158 Ga0068861_100010869 3300005719 Bacteria 6327
159 Ga0068861_100022664 3300005719 Bacteria 4527
160 Ga0068861_100115830 3300005719 Bacteria 2154
161 Ga0068861_100156711 3300005719 Bacteria 1874
162 Ga0068851_10044359 3300005834 Bacteria 2244
163 Ga0068870_10046281 3300005840 Bacteria 2280
164 Ga0068870_10060048 3300005840 Bacteria 2040
165 Ga0068863_100015218 3300005841 Bacteria 7392
166 Ga0068863_100064875 3300005841 Bacteria 3454
167 Ga0068863_100071179 3300005841 Unclassified 3290
168 Ga0068863_100079329 3300005841 Bacteria 3109
169 Ga0068863_100141421 3300005841 Bacteria 2300
170 Ga0068858_100017875 3300005842 Bacteria 6640
171 Ga0068858_100183921 3300005842 Bacteria 1974
172 Ga0068858_100226432 3300005842 Bacteria 1772
173 Ga0068860_100000096 3300005843 Bacteria 147838
174 Ga0068860_100004286 3300005843 Bacteria 14580
175 Ga0068860_100009655 3300005843 Bacteria 9585
176 Ga0068860_100027668 3300005843 Bacteria 5459
177 Ga0068860_100097597 3300005843 Bacteria 2801
178 Ga0068860_100098239 3300005843 Bacteria 2792
179 Ga0068860_100104977 3300005843 Bacteria 2698
180 Ga0068860_100138830 3300005843 Bacteria 2335
181 Ga0068862_100017036 3300005844 Bacteria 6046
182 Ga0081539_10001810 3300005985 Bacteria 33775
183 Ga0075366_10014315 3300006195 Bacteria 4530
184 Ga0097621_100000254 3300006237 Bacteria 36129
185 Ga0097621_100024141 3300006237 Bacteria 4744
186 Ga0097621_100039323 3300006237 Bacteria 3799
187 Ga0097621_100044843 3300006237 Bacteria 3569
188 Ga0097621_100113512 3300006237 Bacteria 2292
189 Ga0097621_100154876 3300006237 Bacteria 1967
190 Ga0068871_100013263 3300006358 Bacteria 6112
191 Ga0068871_100034272 3300006358 Bacteria 4028
192 Ga0068871_100046702 3300006358 Bacteria 3489
193 Ga0068871_100090633 3300006358 Bacteria 2547
194 Ga0068871_100093741 3300006358 Bacteria 2505
195 Ga0068871_100148846 3300006358 Bacteria 1995
196 Ga0075428_100062734 3300006844 Bacteria 4068
197 Ga0075430_100003255 3300006846 Bacteria 13602
198 Ga0075430_100204478 3300006846 Bacteria 1639
199 Ga0075431_100100167 3300006847 Bacteria 2989
200 Ga0075431_100183200 3300006847 Bacteria 2149
201 Ga0075431_100321865 3300006847 Bacteria 1559
202 Ga0075434_100139355 3300006871 Bacteria 2445
203 Ga0075429_100008852 3300006880 Bacteria 8749
204 Ga0075429_100033538 3300006880 Bacteria 4462
205 Ga0068865_100066772 3300006881 Bacteria 2538
206 Ga0068865_100077616 3300006881 Bacteria 2374
207 Ga0097620_100000106 3300006931 Bacteria 78128
208 Ga0097620_100013598 3300006931 Bacteria 8160
209 Ga0097620_100023855 3300006931 Bacteria 6140
210 Ga0097620_100030315 3300006931 Bacteria 5427
211 Ga0097620_100191456 3300006931 Bacteria 2130
212 Ga0097620_100455334 3300006931 Bacteria 1376
213 Ga0105240_10001307 3300009093 Bacteria 42958
214 Ga0105240_10002094 3300009093 Bacteria 32639
215 Ga0105240_10017759 3300009093 Bacteria 9575
216 Ga0105240_10037223 3300009093 Bacteria 6254
217 Ga0105240_10039925 3300009093 Bacteria 6007
218 Ga0105240_10068789 3300009093 Bacteria 4385
219 Ga0105240_10258372 3300009093 Bacteria 2011
220 Ga0111539_10034031 3300009094 Bacteria 6182
221 Ga0111539_10036677 3300009094 Bacteria 5925
222 Ga0111539_10077353 3300009094 Bacteria 3916
223 Ga0105247_10008461 3300009101 Bacteria 6266
224 Ga0105247_10067079 3300009101 Bacteria 2235
225 Ga0114129_10007516 3300009147 Bacteria 15523
226 Ga0105241_10000450 3300009174 Bacteria 30958
227 Ga0105241_10001462 3300009174 Bacteria 18113
228 Ga0105241_10042941 3300009174 Bacteria 3423
229 Ga0105242_10011128 3300009176 Bacteria 6914
230 Ga0105248_10280292 3300009177 Bacteria 1876
231 Ga0105237_10003093 3300009545 Bacteria 20049
232 Ga0105237_10031679 3300009545 Bacteria 5355
233 Ga0105237_10039228 3300009545 Bacteria 4781
234 Ga0105237_10040944 3300009545 Bacteria 4673
235 Ga0105237_10052084 3300009545 Bacteria 4110
236 Ga0105237_10083882 3300009545 Bacteria 3177
237 Ga0105237_10112593 3300009545 Bacteria 2713
238 Ga0105237_10126638 3300009545 Bacteria 2548
239 Ga0105238_10027049 3300009551 Bacteria 5846
240 Ga0105238_10031092 3300009551 Bacteria 5435
241 Ga0105238_10091341 3300009551 Bacteria 3032
242 Ga0105249_10008661 3300009553 Bacteria 8863
243 Ga0105249_10010512 3300009553 Bacteria 8133
244 Ga0105249_10045730 3300009553 Bacteria 3982
245 Ga0105249_10047197 3300009553 Bacteria 3924
246 Ga0105249_10051875 3300009553 Bacteria 3744
247 Ga0105249_10234681 3300009553 Bacteria 1810
248 Ga0105239_10001895 3300010375 Bacteria 27349
249 Ga0105239_10005006 3300010375 Bacteria 15641
250 Ga0105239_10014148 3300010375 Bacteria 8852
251 Ga0105239_10018442 3300010375 Bacteria 7707
252 Ga0105239_10059843 3300010375 Bacteria 4180
253 Ga0105239_10088533 3300010375 Bacteria 3414
254 Ga0105239_10286601 3300010375 Bacteria 1854
255 Ga0105246_10006635 3300011119 Bacteria 7078
256 Ga0105246_10057011 3300011119 Bacteria 2702
257 Ga0157373_10007993 3300013100 Bacteria 7864
258 Ga0157373_10018991 3300013100 Bacteria 5004
259 Ga0157373_10036744 3300013100 Bacteria 3513
260 Ga0157371_10000232 3300013102 Bacteria 79717
261 Ga0157371_10000741 3300013102 Bacteria 38124
262 Ga0157371_10010793 3300013102 Bacteria 7091
263 Ga0157371_10012606 3300013102 Bacteria 6453
264 Ga0157371_10013699 3300013102 Bacteria 6151
265 Ga0157371_10027523 3300013102 Bacteria 4123
266 Ga0157371_10028986 3300013102 Bacteria 4008
267 Ga0157371_10052339 3300013102 Bacteria 2900
268 Ga0157371_10054756 3300013102 Bacteria 2832
269 Ga0157371_10081797 3300013102 Bacteria 2287
270 Ga0157370_10007033 3300013104 Bacteria 12285
271 Ga0157370_10019629 3300013104 Bacteria 6770
272 Ga0157370_10072220 3300013104 Bacteria 3257
273 Ga0157370_10133879 3300013104 Bacteria 2311
274 Ga0157369_10016652 3300013105 Bacteria 8265
275 Ga0157369_10049312 3300013105 Bacteria 4566
276 Ga0157369_10278709 3300013105 Bacteria 1741
277 Ga0157374_10000004 3300013296 Bacteria 759774
278 Ga0157374_10001709 3300013296 Bacteria 18416
279 Ga0157374_10011096 3300013296 Bacteria 7787
280 Ga0157374_10018319 3300013296 Bacteria 6177
281 Ga0157374_10024479 3300013296 Bacteria 5414
282 Ga0157374_10037610 3300013296 Bacteria 4443
283 Ga0157374_10269884 3300013296 Bacteria 1677
284 Ga0157378_10004824 3300013297 Bacteria 11816
285 Ga0157378_10010095 3300013297 Bacteria 8232
286 Ga0157378_10012713 3300013297 Bacteria 7365
287 Ga0157378_10012980 3300013297 Bacteria 7287
288 Ga0157378_10028220 3300013297 Bacteria 4950
289 Ga0157378_10225749 3300013297 Bacteria 1782
290 Ga0163162_10000339 3300013306 Bacteria 42518
291 Ga0163162_10004808 3300013306 Bacteria 13032
292 Ga0163162_10018015 3300013306 Bacteria 6910
293 Ga0163162_10024454 3300013306 Bacteria 5963
294 Ga0163162_10029916 3300013306 Bacteria 5393
295 Ga0163162_10103211 3300013306 Bacteria 2945
296 Ga0157372_10002019 3300013307 Bacteria 22064
297 Ga0157372_10004225 3300013307 Bacteria 15360
298 Ga0157372_10014606 3300013307 Bacteria 8400
299 Ga0157372_10032724 3300013307 Bacteria 5704
300 Ga0157372_10057014 3300013307 Bacteria 4366
301 Ga0157372_10057045 3300013307 Bacteria 4365
302 Ga0157372_10075567 3300013307 Bacteria 3802
303 Ga0157372_10188376 3300013307 Bacteria 2389
304 Ga0157372_10195802 3300013307 Bacteria 2341
305 Ga0157372_10206650 3300013307 Bacteria 2275
306 Ga0157372_10275781 3300013307 Bacteria 1955
307 Ga0157372_10354855 3300013307 Bacteria 1709
308 Ga0157372_10429964 3300013307 Bacteria 1539
309 Ga0157375_10005268 3300013308 Bacteria 11232
310 Ga0157375_10006234 3300013308 Bacteria 10386
311 Ga0157375_10017257 3300013308 Bacteria 6509
312 Ga0157375_10032468 3300013308 Bacteria 4952
313 Ga0157375_10095733 3300013308 Bacteria 3040
314 Ga0157375_10202026 3300013308 Bacteria 2144
315 Ga0157375_10229737 3300013308 Bacteria 2014
316 Ga0157375_10262152 3300013308 Bacteria 1890
317 Ga0157375_10298543 3300013308 Bacteria 1774
318 Ga0163163_10001534 3300014325 Bacteria 19476
319 Ga0163163_10001692 3300014325 Bacteria 18633
320 Ga0163163_10003221 3300014325 Bacteria 13829
321 Ga0163163_10135567 3300014325 Bacteria 2503
322 Ga0157380_10000368 3300014326 Bacteria 27181
323 Ga0157380_10001833 3300014326 Bacteria 14038
324 Ga0157380_10009627 3300014326 Bacteria 6929
325 Ga0157380_10011442 3300014326 Bacteria 6412
326 Ga0157380_10034973 3300014326 Bacteria 3878
327 Ga0157380_10120399 3300014326 Bacteria 2223
328 Ga0157380_10257058 3300014326 Bacteria 1584
329 Ga0157377_10019611 3300014745 Bacteria 3534
330 Ga0157377_10022247 3300014745 Bacteria 3344
331 Ga0157377_10030614 3300014745 Bacteria 2917
332 Ga0157377_10145367 3300014745 Bacteria 1461
333 Ga0157379_10011015 3300014968 Bacteria 7884
334 Ga0157379_10012914 3300014968 Bacteria 7306
335 Ga0157379_10047082 3300014968 Bacteria 3847
336 Ga0157376_10002772 3300014969 Bacteria 11969
337 Ga0157376_10005827 3300014969 Bacteria 8638
338 Ga0157376_10024576 3300014969 Bacteria 4734
339 Ga0157376_10039865 3300014969 Bacteria 3834
340 Ga0157376_10073056 3300014969 Bacteria 2920
341 Ga0182005_1000131 3300015265 Bacteria 53401
342 Ga0163161_10009040 3300017792 Bacteria 6891
343 Ga0163161_10050012 3300017792 Bacteria 3023
344 Ga0163161_10152538 3300017792 Bacteria 1757
345 Ga0213876_10001699 3300021384 Bacteria 13405
346 Ga0209258_100219 3300025242 Bacteria 108974
347 Ga0209646_1002107 3300025246 Bacteria 4644
348 Ga0209148_1000543 3300025254 Bacteria 36269
349 Ga0209130_1001419 3300025284 Bacteria 15964
350 Ga0207426_1000089 3300025302 Bacteria 281224
351 Ga0207426_1000412 3300025302 Bacteria 71401
352 Ga0207426_1021857 3300025302 Bacteria 2205
353 Ga0207697_10093545 3300025315 Bacteria 1275
354 Ga0207697_10094465 3300025315 Bacteria 1269
355 Ga0207682_10010850 3300025893 Bacteria 3567
356 Ga0207682_10015655 3300025893 Bacteria 2954
357 Ga0207710_10006690 3300025900 Bacteria 4911
358 Ga0207688_10032238 3300025901 Bacteria 2895
359 Ga0207680_10000958 3300025903 Bacteria 13597
360 Ga0207680_10077165 3300025903 Bacteria 2083
361 Ga0207680_10122344 3300025903 Bacteria 1703
362 Ga0207647_10010225 3300025904 Bacteria 6629
363 Ga0207647_10031308 3300025904 Bacteria 3423
364 Ga0207645_10000175 3300025907 Bacteria 51325
365 Ga0207645_10005660 3300025907 Bacteria 9028
366 Ga0207643_10012638 3300025908 Bacteria 4560
367 Ga0207643_10096974 3300025908 Bacteria 1725
368 Ga0207705_10010075 3300025909 Bacteria 6879
369 Ga0207705_10013815 3300025909 Bacteria 5823
370 Ga0207705_10104291 3300025909 Bacteria 2089
371 Ga0207654_10006887 3300025911 Bacteria 5722
372 Ga0207654_10008121 3300025911 Bacteria 5293
373 Ga0207707_10041904 3300025912 Bacteria 3998
374 Ga0207707_10135100 3300025912 Bacteria 2156
375 Ga0207695_10000027 3300025913 Bacteria 612456
376 Ga0207695_10000076 3300025913 Bacteria 307969
377 Ga0207695_10000090 3300025913 Bacteria 272143
378 Ga0207695_10000247 3300025913 Bacteria 140966
379 Ga0207695_10000545 3300025913 Bacteria 78409
380 Ga0207695_10025810 3300025913 Bacteria 6568
381 Ga0207671_10002087 3300025914 Bacteria 21865
382 Ga0207671_10007498 3300025914 Bacteria 9463
383 Ga0207671_10020034 3300025914 Bacteria 5102
384 Ga0207671_10022383 3300025914 Bacteria 4780
385 Ga0207671_10024538 3300025914 Bacteria 4531
386 Ga0207671_10102575 3300025914 Bacteria 2168
387 Ga0207660_10030214 3300025917 Bacteria 3723
388 Ga0207662_10013999 3300025918 Bacteria 4493
389 Ga0207657_10013358 3300025919 Bacteria 8056
390 Ga0207657_10104244 3300025919 Bacteria 2350
391 Ga0207657_10224742 3300025919 Bacteria 1503
392 Ga0207657_10234266 3300025919 Bacteria 1467
393 Ga0207649_10005455 3300025920 Bacteria 6885
394 Ga0207649_10035280 3300025920 Bacteria 3005
395 Ga0207649_10072800 3300025920 Bacteria 2200
396 Ga0207652_10000115 3300025921 Bacteria 87927
397 Ga0207652_10091840 3300025921 Bacteria 2670
398 Ga0207652_10095020 3300025921 Bacteria 2625
399 Ga0207681_10079869 3300025923 Bacteria 2306
400 Ga0207681_10218189 3300025923 Bacteria 1474
401 Ga0207694_10016251 3300025924 Bacteria 5616
402 Ga0207650_10003564 3300025925 Bacteria 10683
403 Ga0207650_10059793 3300025925 Bacteria 2842
404 Ga0207650_10062627 3300025925 Bacteria 2779
405 Ga0207650_10068012 3300025925 Bacteria 2674
406 Ga0207650_10091357 3300025925 Bacteria 2327
407 Ga0207650_10159880 3300025925 Bacteria 1784
408 Ga0207650_10215374 3300025925 Bacteria 1544
409 Ga0207659_10012168 3300025926 Bacteria 5459
410 Ga0207659_10013090 3300025926 Bacteria 5303
411 Ga0207659_10105320 3300025926 Bacteria 2134
412 Ga0207659_10210408 3300025926 Bacteria 1558
413 Ga0207644_10120679 3300025931 Unclassified 1995
414 Ga0207690_10017335 3300025932 Bacteria 4395
415 Ga0207690_10034224 3300025932 Bacteria 3272
416 Ga0207706_10002398 3300025933 Bacteria 18273
417 Ga0207706_10015809 3300025933 Bacteria 6823
418 Ga0207706_10015825 3300025933 Bacteria 6820
419 Ga0207706_10079679 3300025933 Bacteria 2880
420 Ga0207670_10043917 3300025936 Bacteria 2955
421 Ga0207670_10182166 3300025936 Bacteria 1583
422 Ga0207704_10053192 3300025938 Bacteria 2459
423 Ga0207704_10093476 3300025938 Bacteria 1982
424 Ga0207704_10184496 3300025938 Bacteria 1511
425 Ga0207691_10027498 3300025940 Bacteria 5332
426 Ga0207691_10032612 3300025940 Bacteria 4856
427 Ga0207691_10036560 3300025940 Bacteria 4551
428 Ga0207689_10000360 3300025942 Bacteria 42854
429 Ga0207689_10002588 3300025942 Bacteria 16745
430 Ga0207689_10013538 3300025942 Bacteria 6964
431 Ga0207689_10013879 3300025942 Bacteria 6862
432 Ga0207689_10029544 3300025942 Bacteria 4576
433 Ga0207689_10034013 3300025942 Bacteria 4233
434 Ga0207689_10109872 3300025942 Bacteria 2266
435 Ga0207661_10006134 3300025944 Bacteria 8493
436 Ga0207661_10027550 3300025944 Bacteria 4341
437 Ga0207661_10043244 3300025944 Bacteria 3555
438 Ga0207679_10003352 3300025945 Bacteria 9886
439 Ga0207679_10029202 3300025945 Bacteria 3837
440 Ga0207679_10035501 3300025945 Bacteria 3528
441 Ga0207679_10038962 3300025945 Bacteria 3391
442 Ga0207679_10072333 3300025945 Bacteria 2604
443 Ga0207679_10246152 3300025945 Bacteria 1517
444 Ga0207667_10001637 3300025949 Bacteria 28194
445 Ga0207667_10007749 3300025949 Bacteria 12835
446 Ga0207667_10011285 3300025949 Bacteria 10390
447 Ga0207667_10028760 3300025949 Bacteria 6034
448 Ga0207667_10033269 3300025949 Bacteria 5545
449 Ga0207667_10099407 3300025949 Bacteria 3002
450 Ga0207651_10004229 3300025960 Bacteria 7198
451 Ga0207651_10030986 3300025960 Bacteria 3413
452 Ga0207651_10144900 3300025960 Bacteria 1840
453 Ga0207712_10001164 3300025961 Bacteria 18264
454 Ga0207712_10001647 3300025961 Bacteria 15026
455 Ga0207712_10011854 3300025961 Bacteria 5557
456 Ga0207712_10028757 3300025961 Bacteria 3720
457 Ga0207712_10047068 3300025961 Bacteria 2993
458 Ga0207712_10094131 3300025961 Bacteria 2212
459 Ga0207640_10125095 3300025981 Bacteria 1850
460 Ga0207658_10004542 3300025986 Bacteria 9637
461 Ga0207658_10044243 3300025986 Bacteria 3241
462 Ga0207658_10182884 3300025986 Bacteria 1736
463 Ga0207677_10006746 3300026023 Bacteria 6305
464 Ga0207677_10066685 3300026023 Bacteria 2518
465 Ga0207677_10087964 3300026023 Bacteria 2251
466 Ga0207703_10001922 3300026035 Bacteria 18410
467 Ga0207703_10079248 3300026035 Bacteria 2732
468 Ga0207639_10020021 3300026041 Bacteria 4784
469 Ga0207639_10052568 3300026041 Bacteria 3105
470 Ga0207639_10073538 3300026041 Bacteria 2680
471 Ga0207678_10030180 3300026067 Bacteria 4733
472 Ga0207678_10177572 3300026067 Bacteria 1818
473 Ga0207678_10226588 3300026067 Bacteria 1600
474 Ga0207708_10037700 3300026075 Bacteria 3682
475 Ga0207708_10078812 3300026075 Bacteria 2530
476 Ga0207702_10035596 3300026078 Bacteria 4163
477 Ga0207702_10062840 3300026078 Bacteria 3173
478 Ga0207641_10000082 3300026088 Bacteria 138385
479 Ga0207641_10014751 3300026088 Bacteria 6405
480 Ga0207641_10124557 3300026088 Bacteria 2305
481 Ga0207641_10159138 3300026088 Bacteria 2052
482 Ga0207641_10279671 3300026088 Bacteria 1569
483 Ga0207648_10001610 3300026089 Bacteria 24733
484 Ga0207648_10007104 3300026089 Bacteria 11049
485 Ga0207648_10017728 3300026089 Bacteria 6465
486 Ga0207648_10023556 3300026089 Bacteria 5513
487 Ga0207648_10050419 3300026089 Bacteria 3640
488 Ga0207648_10070046 3300026089 Bacteria 3057
489 Ga0207648_10083796 3300026089 Bacteria 2781
490 Ga0207676_10021921 3300026095 Bacteria 4692
491 Ga0207676_10030817 3300026095 Bacteria 4029
492 Ga0207676_10044339 3300026095 Bacteria 3431
493 Ga0207676_10048871 3300026095 Bacteria 3287
494 Ga0207676_10182494 3300026095 Bacteria 1839
495 Ga0207674_10011604 3300026116 Bacteria 9898
496 Ga0207674_10029392 3300026116 Bacteria 5786
497 Ga0207674_10045603 3300026116 Bacteria 4508
498 Ga0207674_10094181 3300026116 Bacteria 2982
499 Ga0207674_10094840 3300026116 Bacteria 2970
500 Ga0207674_10131541 3300026116 Bacteria 2465
501 Ga0207675_100002684 3300026118 Bacteria 17556
502 Ga0207675_100028740 3300026118 Bacteria 5180
503 Ga0207675_100060987 3300026118 Bacteria 3521
504 Ga0207675_100144583 3300026118 Bacteria 2261
505 Ga0207675_100204740 3300026118 Bacteria 1896
506 Ga0207683_10011342 3300026121 Bacteria 7604
507 Ga0207683_10049070 3300026121 Bacteria 3695
508 Ga0207698_10008386 3300026142 Bacteria 6533
509 Ga0207698_10027230 3300026142 Bacteria 4055
510 Ga0207698_10052761 3300026142 Bacteria 3117
511 Ga0207698_10120522 3300026142 Bacteria 2219
512 Ga0268266_10000024 3300028379 Bacteria 490820
513 Ga0268265_10028918 3300028380 Bacteria 3973
514 Ga0268265_10087585 3300028380 Bacteria 2478
515 Ga0268264_10000094 3300028381 Bacteria 231083
516 Ga0268264_10006809 3300028381 Bacteria 9600
517 Ga0268264_10007283 3300028381 Bacteria 9258
518 Ga0268264_10013367 3300028381 Bacteria 6755
519 Ga0268264_10207016 3300028381 Bacteria 1798
520 Ga0307517_10002347 3300028786 Bacteria 30536
521 Ga0307511_10000429 3300030521 Bacteria 44853
522 Ga0265327_10001558 3300031251 Bacteria 28149
523 Ga0307513_10059661 3300031456 Bacteria 4049
524 Ga0307513_10177364 3300031456 Bacteria 1999
525 Ga0307509_10046688 3300031507 Bacteria 4662
526 Ga0307508_10004493 3300031616 Bacteria 13606
527 Ga0307516_10000111 3300031730 Bacteria 94707
528 Ga0307407_10069060 3300031903 Bacteria 2096
529 Ga0307412_10062615 3300031911 Bacteria 2506
530 Ga0307416_100100684 3300032002 Bacteria 2514
531 Ga0307510_10011551 3300033180 Bacteria 10480
532 Ga0373927_0037256 3300035695 Bacteria 3162
533 Ga0395899_0017114 3300037312 Bacteria 5523
534 Ga0395899_0149125 3300037312 Bacteria 1658
535 Ga0395900_0052792 3300037418 Bacteria 4184
536 Ga0395900_0074097 3300037418 Bacteria 3500
537 Ga0395898_0046113 3300037466 Bacteria 4281
538 Ga0395898_0172171 3300037466 Bacteria 2069
539 Ga0395905_0003239 3300037471 Bacteria 17507
540 Ga0395905_0280405 3300037471 Bacteria 1553
541 Ga0395901_0002351 3300038443 Bacteria 19230
542 Ga0436365_1177908 3300039437 Bacteria 14243
543 Ga0439465_0004116 3300041413 Bacteria 4731
544 Ga0451853_0777131 3300041512 Bacteria 3294
545 Ga0439449_0014017 3300042007 Bacteria 3015
546 Ga0439449_0022117 3300042007 Bacteria 2380
547 Ga0439457_002871 3300042014 Bacteria 4800
548 Ga0439457_015606 3300042014 Bacteria 1695
549 Ga0439462_0010364 3300042015 Bacteria 2360
550 Ga0450923_007442 3300042125 Bacteria 1853
551 Ga0451577_0003822 3300042876 Bacteria 16392
552 Ga0466969_0000262 3300044656 Bacteria 28797
553 Ga0466972_0000012 3300044658 Bacteria 246338
554 Ga0466972_0008445 3300044658 Bacteria 5163
555 Ga0453683_0008629 3300044673 Bacteria 6834
556 Ga0453683_0109757 3300044673 Bacteria 1734
557 Ga0466966_0000114 3300044684 Bacteria 49928
558 Ga0466961_0109432 3300044693 Bacteria 1739
559 Ga0466961_0131857 3300044693 Bacteria 1566
560 Ga0453684_0063276 3300044712 Bacteria 4734
561 Ga0453684_0276144 3300044712 Bacteria 1918
562 Ga0466957_0000015 3300044842 Bacteria 68333
563 Ga0466959_0000049 3300045049 Bacteria 83496
564 Ga0466959_0016032 3300045049 Bacteria 5469
565 Ga0466959_0067586 3300045049 Bacteria 2591
566 Ga0451576_0005327 3300045051 Bacteria 16168
567 Ga0466967_0081386 3300045976 Bacteria 2925
568 Ga0495638_0023629 3300046460 Bacteria 4017
569 Ga0495638_0048891 3300046460 Bacteria 2646
570 Ga0495606_0019212 3300046507 Bacteria 5093
571 Ga0495648_0045725 3300046524 Bacteria 2720
572 Ga0495621_0035246 3300046539 Bacteria 1732
573 Ga0495622_0034664 3300046557 Bacteria 2355
574 Ga0495668_0006718 3300046616 Bacteria 7491
575 Ga0495611_0000095 3300046648 Bacteria 61293
576 Ga0495611_0078528 3300046648 Bacteria 1515
577 Ga0495649_0047224 3300046694 Bacteria 2342
578 Ga0495680_0108843 3300047322 Bacteria 2056
579 Ga0495687_000072 3300047443 Bacteria 155519
580 Ga0495686_0000424 3300047472 Bacteria 66338
581 Ga0495686_0017619 3300047472 Bacteria 4806
582 Ga0495686_0025521 3300047472 Bacteria 3873
583 Ga0496101_0014418 3300048904 Bacteria 5312
584 Ga0496108_0194932 3300048911 Bacteria 1757
585 Ga0496114_0071846 3300048917 Bacteria 2909
586 Ga0496121_0000020 3300048924 Bacteria 498732
587 Ga0496126_0197998 3300048929 Bacteria 1698
588 Ga0501298_010763 3300049521 Bacteria 1579
589 Ga0501031_0008583 3300049568 Bacteria 6649
590 Ga0501032_0010122 3300049569 Bacteria 6805
591 Ga0501032_0078706 3300049569 Bacteria 2195
592 Ga0501032_0091263 3300049569 Bacteria 2021
593 Ga0501032_0148497 3300049569 Bacteria 1542
594 Ga0501033_0056301 3300049570 Bacteria 2907
595 Ga0501033_0070139 3300049570 Bacteria 2575
596 Ga0501034_0000043 3300049571 Bacteria 229049
597 Ga0501034_0018832 3300049571 Bacteria 7077
598 Ga0501034_0078222 3300049571 Bacteria 3312
599 Ga0501036_0009845 3300049572 Bacteria 7870
600 Ga0501037_0023321 3300049573 Bacteria 4577
601 Ga0501038_0017545 3300049574 Bacteria 6471
602 Ga0501038_0068272 3300049574 Bacteria 3022
603 Ga0501039_0034856 3300049575 Bacteria 3884
604 Ga0501043_0028686 3300049579 Bacteria 4368
605 Ga0501043_0036901 3300049579 Bacteria 3845
606 Ga0501043_0065340 3300049579 Bacteria 2857
607 Ga0501043_0106455 3300049579 Bacteria 2203
608 Ga0501043_0176120 3300049579 Bacteria 1667
609 Ga0501047_0008527 3300049581 Bacteria 9667
610 Ga0501047_0041977 3300049581 Bacteria 4421
611 Ga0501047_0047833 3300049581 Bacteria 4132
612 Ga0501047_0056603 3300049581 Bacteria 3792
613 Ga0501070_0024071 3300049586 Bacteria 5106
614 Ga0501070_0074590 3300049586 Bacteria 2808
615 Ga0501070_0110046 3300049586 Bacteria 2277
616 Ga0501073_0014685 3300049589 Bacteria 5689
617 Ga0501074_0004644 3300049590 Bacteria 9838
618 Ga0501198_001379 3300049649 Bacteria 3154
619 Ga0501202_001071 3300049652 Bacteria 4259
620 Ga0501206_002442 3300049653 Bacteria 2347
621 Ga0501217_000127 3300049661 Bacteria 10127
622 Ga0501235_003303 3300049669 Bacteria 3483
623 Ga0501240_001942 3300049673 Bacteria 2112
624 Ga0501259_001357 3300049688 Bacteria 4093
625 Ga0501221_000642 3300049704 Bacteria 5603
626 Ga0501234_002563 3300049707 Bacteria 2861
627 Ga0501245_006991 3300049708 Bacteria 1589
628 Ga0501271_002635 3300049768 Bacteria 1614
629 Ga0501035_0039965 3300049822 Bacteria 4242
630 Ga0501035_0107920 3300049822 Bacteria 2441
631 Ga0501044_0021945 3300049823 Bacteria 6807
632 Ga0501044_0029899 3300049823 Bacteria 5744
633 Ga0501044_0044903 3300049823 Bacteria 4582
634 Ga0501044_0060405 3300049823 Bacteria 3881
635 Ga0501044_0060648 3300049823 Bacteria 3872
636 Ga0501044_0150002 3300049823 Bacteria 2314
637 Ga0501284_00032 3300050005 Bacteria 64343
638 nmdc:mga0k408_14461_c1 3300050493 Bacteria 4350
639 nmdc:mga0k408_14661_c1 3300050493 Bacteria 4323
640 nmdc:mga0k408_59772_c1 3300050493 Bacteria 2215
641 nmdc:mga05p37_4550_c1 3300050507 Bacteria 16207
642 nmdc:mga09592_27575_c1 3300050508 Bacteria 4714
643 nmdc:mga09592_90231_c1 3300050508 Bacteria 2618
644 nmdc:mga0qj67_24094_c1 3300050509 Bacteria 4689
645 nmdc:mga06r32_56382_c1 3300050510 Bacteria 3772
646 nmdc:mga06r32_91216_c1 3300050510 Bacteria 2977
647 nmdc:mga08y16_27237_c1 3300050511 Bacteria 6022
648 nmdc:mga08y16_85547_c1 3300050511 Bacteria 3286
649 Ga0500578_0000934 3300053086 Bacteria 32814
650 Ga0500644_0001065 3300053088 Bacteria 8143
651 Ga0500644_0004445 3300053088 Bacteria 3508
652 Ga0500646_0019579 3300053090 Bacteria 1791
653 Ga0500583_0000096 3300053092 Bacteria 48076
654 Ga0500583_0000348 3300053092 Bacteria 15402
655 Ga0500583_0004108 3300053092 Bacteria 4693
656 Ga0500583_0008745 3300053092 Bacteria 3657
657 Ga0500569_000271 3300053109 Bacteria 8180
658 Ga0500559_0009804 3300053136 Bacteria 4131
659 Ga0500568_0000306 3300053139 Bacteria 39150
660 Ga0500577_0018902 3300053142 Bacteria 2224
661 Ga0500588_0014501 3300053146 Bacteria 1999
662 Ga0500633_0003502 3300053160 Bacteria 3437
663 Ga0500611_000086 3300053727 Bacteria 28214
664 Ga0466962_0026007 3300061719 Bacteria 2810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10429964 Ga0157372_104299642 333
2 3300025961 Ga0207712_10047068 Ga0207712_100470682 334
3 3300042014 Ga0439457_015606 Ga0439457_015606_615_1679 334
4 3300031507 Ga0307509_10046688 Ga0307509_100466884 340
5 3300044693 Ga0466961_0131857 Ga0466961_0131857_40_1209 341
6 3300045049 Ga0466959_0016032 Ga0466959_0016032_3308_4477 341
7 3300030521 Ga0307511_10000429 Ga0307511_100004296 342
8 3300047472 Ga0495686_0000424 Ga0495686_0000424_63641_64810 342
9 3300003320 rootH2_10047594 rootH2_100475944 343
10 3300005329 Ga0070683_100002217 Ga0070683_10000221715 343
11 3300005535 Ga0070684_100012134 Ga0070684_1000121344 343
12 3300005563 Ga0068855_100008376 Ga0068855_1000083763 343
13 3300005563 Ga0068855_100038494 Ga0068855_1000384945 343
14 3300005563 Ga0068855_100086271 Ga0068855_1000862712 343
15 3300005616 Ga0068852_100143648 Ga0068852_1001436482 343
16 3300005843 Ga0068860_100009655 Ga0068860_1000096555 343
17 3300009093 Ga0105240_10002094 Ga0105240_100020942 343
18 3300009093 Ga0105240_10017759 Ga0105240_100177597 343
19 3300009093 Ga0105240_10068789 Ga0105240_100687892 343
20 3300009545 Ga0105237_10039228 Ga0105237_100392282 343
21 3300009545 Ga0105237_10126638 Ga0105237_101266382 343
22 3300009551 Ga0105238_10091341 Ga0105238_100913411 343
23 3300010375 Ga0105239_10001895 Ga0105239_100018952 343
24 3300010375 Ga0105239_10005006 Ga0105239_100050069 343
25 3300013100 Ga0157373_10036744 Ga0157373_100367442 343
26 3300013105 Ga0157369_10016652 Ga0157369_100166522 343
27 3300013307 Ga0157372_10004225 Ga0157372_100042252 343
28 3300013307 Ga0157372_10057045 Ga0157372_100570453 343
29 3300025913 Ga0207695_10000076 Ga0207695_10000076131 343
30 3300025913 Ga0207695_10000090 Ga0207695_10000090130 343
31 3300025913 Ga0207695_10025810 Ga0207695_100258103 343
32 3300025914 Ga0207671_10020034 Ga0207671_100200342 343
33 3300025914 Ga0207671_10022383 Ga0207671_100223832 343
34 3300025944 Ga0207661_10006134 Ga0207661_100061342 343
35 3300025949 Ga0207667_10007749 Ga0207667_100077494 343
36 3300025949 Ga0207667_10033269 Ga0207667_100332692 343
37 3300025949 Ga0207667_10099407 Ga0207667_100994072 343
38 3300025986 Ga0207658_10182884 Ga0207658_101828842 343
39 3300028381 Ga0268264_10006809 Ga0268264_100068092 343
40 3300028786 Ga0307517_10002347 Ga0307517_1000234716 343
41 3300035695 Ga0373927_0037256 Ga0373927_0037256_1418_2578 343
42 3300045976 Ga0466967_0081386 Ga0466967_0081386_1036_2193 343
43 3300046694 Ga0495649_0047224 Ga0495649_0047224_883_2052 343
44 3300005455 Ga0070663_100172448 Ga0070663_1001724481 344
45 3300026067 Ga0207678_10226588 Ga0207678_102265881 344
46 3300005338 Ga0068868_100192204 Ga0068868_1001922041 346
47 3300021384 Ga0213876_10001699 Ga0213876_1000169911 346
48 3300026023 Ga0207677_10087964 Ga0207677_100879642 346
49 3300039437 Ga0436365_1177908 Ga0436365_1177908_13125_14225 346
50 3300049579 Ga0501043_0036901 Ga0501043_0036901_132_1235 347
51 3300049669 Ga0501235_003303 Ga0501235_003303_955_2073 348
52 3300044673 Ga0453683_0008629 Ga0453683_0008629_2911_4083 349
53 3300044712 Ga0453684_0063276 Ga0453684_0063276_2194_3366 349
54 3300045051 Ga0451576_0005327 Ga0451576_0005327_13396_14568 349
55 3300031903 Ga0307407_10069060 Ga0307407_100690602 350
56 3300031911 Ga0307412_10062615 Ga0307412_100626152 350
57 3300005577 Ga0068857_100027334 Ga0068857_1000273346 351
58 3300009545 Ga0105237_10031679 Ga0105237_100316794 351
59 3300013296 Ga0157374_10018319 Ga0157374_100183196 351
60 3300025914 Ga0207671_10102575 Ga0207671_101025752 351
61 3300026116 Ga0207674_10045603 Ga0207674_100456035 351
62 3300037471 Ga0395905_0003239 Ga0395905_0003239_3465_4634 351
63 3300044656 Ga0466969_0000262 Ga0466969_0000262_18618_19787 351
64 3300044658 Ga0466972_0000012 Ga0466972_0000012_151038_152153 351
65 3300044684 Ga0466966_0000114 Ga0466966_0000114_12324_13493 351
66 3300045049 Ga0466959_0000049 Ga0466959_0000049_38824_39993 351
67 3300049581 Ga0501047_0008527 Ga0501047_0008527_6515_7630 351
68 3300049823 Ga0501044_0021945 Ga0501044_0021945_2329_3444 351
69 3300031730 Ga0307516_10000111 Ga0307516_1000011135 352
70 3300048929 Ga0496126_0197998 Ga0496126_0197998_301_1470 353
71 3300003320 rootH2_10000662 rootH2_100006624 354
72 3300013296 Ga0157374_10000004 Ga0157374_10000004559 354
73 3300014326 Ga0157380_10011442 Ga0157380_100114422 354
74 3300014969 Ga0157376_10005827 Ga0157376_100058277 354
75 3300031251 Ga0265327_10001558 Ga0265327_100015585 354
76 3300003323 rootH1_10267761 rootH1_102677612 355
77 3300009545 Ga0105237_10040944 Ga0105237_100409443 355
78 3300010375 Ga0105239_10014148 Ga0105239_100141483 355
79 3300013102 Ga0157371_10054756 Ga0157371_100547561 355
80 3300013307 Ga0157372_10032724 Ga0157372_100327243 355
81 3300025914 Ga0207671_10024538 Ga0207671_100245383 355
82 3300046460 Ga0495638_0048891 Ga0495638_0048891_138_1307 355
83 3300013307 Ga0157372_10354855 Ga0157372_103548552 359
84 3300005439 Ga0070711_100182489 Ga0070711_1001824891 361
85 iso_pu_bacteria 2818991442 2819573844 361
86 iso_pu_bacteria 2821136567 2821137179 361
87 iso_pu_bacteria 2884791551 2884798197 361
88 iso_pu_bacteria 2896109856 2896115228 361
89 iso_pu_bacteria 2904467357 2904468079 361
90 iso_pu_bacteria 2929177148 2929182721 361
91 iso_pu_bacteria 2929239360 2929241461 361
92 iso_pu_bacteria 2945977869 2945978675 361
93 iso_pu_bacteria 2946013367 2946015458 361
94 3300005334 Ga0068869_100070135 Ga0068869_1000701352 362
95 3300005347 Ga0070668_100016410 Ga0070668_1000164103 362
96 3300005347 Ga0070668_100044169 Ga0070668_1000441692 362
97 3300005353 Ga0070669_100035696 Ga0070669_1000356962 362
98 3300005355 Ga0070671_100171340 Ga0070671_1001713402 362
99 3300005364 Ga0070673_100017291 Ga0070673_1000172912 362
100 3300005456 Ga0070678_100005562 Ga0070678_1000055623 362
101 3300005457 Ga0070662_100122478 Ga0070662_1001224782 362
102 3300005548 Ga0070665_100158098 Ga0070665_1001580982 362
103 3300005617 Ga0068859_100191463 Ga0068859_1001914632 362
104 3300005719 Ga0068861_100010869 Ga0068861_1000108697 362
105 3300005840 Ga0068870_10046281 Ga0068870_100462812 362
106 3300005843 Ga0068860_100104977 Ga0068860_1001049772 362
107 3300006237 Ga0097621_100024141 Ga0097621_1000241416 362
108 3300006358 Ga0068871_100148846 Ga0068871_1001488462 362
109 3300006931 Ga0097620_100191456 Ga0097620_1001914562 362
110 3300009176 Ga0105242_10011128 Ga0105242_100111282 362
111 3300009553 Ga0105249_10234681 Ga0105249_102346812 362
112 3300011119 Ga0105246_10006635 Ga0105246_100066357 362
113 3300025907 Ga0207645_10000175 Ga0207645_1000017523 362
114 3300025908 Ga0207643_10012638 Ga0207643_100126382 362
115 3300025933 Ga0207706_10079679 Ga0207706_100796792 362
116 3300025942 Ga0207689_10002588 Ga0207689_1000258814 362
117 3300025942 Ga0207689_10034013 Ga0207689_100340134 362
118 3300026089 Ga0207648_10001610 Ga0207648_100016109 362
119 3300028380 Ga0268265_10087585 Ga0268265_100875852 362
120 3300028381 Ga0268264_10207016 Ga0268264_102070162 362
121 3300044658 Ga0466972_0008445 Ga0466972_0008445_2974_4143 362
122 3300005290 Ga0065712_10003389 Ga0065712_100033897 363
123 3300005293 Ga0065715_10138427 Ga0065715_101384271 363
124 3300005331 Ga0070670_100091228 Ga0070670_1000912282 363
125 3300005331 Ga0070670_100219286 Ga0070670_1002192861 363
126 3300005338 Ga0068868_100003336 Ga0068868_1000033363 363
127 3300005354 Ga0070675_100011046 Ga0070675_1000110466 363
128 3300005365 Ga0070688_100015259 Ga0070688_1000152594 363
129 3300005466 Ga0070685_10127139 Ga0070685_101271391 363
130 3300005841 Ga0068863_100064875 Ga0068863_1000648752 363
131 3300006358 Ga0068871_100093741 Ga0068871_1000937412 363
132 3300013296 Ga0157374_10024479 Ga0157374_100244794 363
133 3300013297 Ga0157378_10004824 Ga0157378_1000482411 363
134 3300014326 Ga0157380_10001833 Ga0157380_100018332 363
135 3300025925 Ga0207650_10068012 Ga0207650_100680121 363
136 3300025926 Ga0207659_10013090 Ga0207659_100130907 363
137 3300049521 Ga0501298_010763 Ga0501298_010763_47_1213 363
138 3300049649 Ga0501198_001379 Ga0501198_001379_195_1361 363
139 3300049652 Ga0501202_001071 Ga0501202_001071_835_2001 363
140 3300049653 Ga0501206_002442 Ga0501206_002442_1162_2328 363
141 3300049661 Ga0501217_000127 Ga0501217_000127_2511_3677 363
142 3300049673 Ga0501240_001942 Ga0501240_001942_143_1309 363
143 3300049688 Ga0501259_001357 Ga0501259_001357_2234_3400 363
144 3300049704 Ga0501221_000642 Ga0501221_000642_2475_3641 363
145 3300049707 Ga0501234_002563 Ga0501234_002563_1406_2572 363
146 3300049708 Ga0501245_006991 Ga0501245_006991_185_1351 363
147 3300049768 Ga0501271_002635 Ga0501271_002635_253_1419 363
148 3300003320 rootH2_10055958 rootH2_100559582 364
149 3300003322 rootL2_10314777 rootL2_103147772 364
150 3300003354 JGI25160J50197_1003799 JGI25160J50197_10037997 364
151 3300005290 Ga0065712_10079428 Ga0065712_100794282 364
152 3300005329 Ga0070683_100059400 Ga0070683_1000594002 364
153 3300005330 Ga0070690_100177233 Ga0070690_1001772332 364
154 3300005331 Ga0070670_100059762 Ga0070670_1000597622 364
155 3300005331 Ga0070670_100059840 Ga0070670_1000598402 364
156 3300005334 Ga0068869_100009899 Ga0068869_1000098994 364
157 3300005334 Ga0068869_100011172 Ga0068869_1000111726 364
158 3300005334 Ga0068869_100013888 Ga0068869_1000138883 364
159 3300005334 Ga0068869_100029853 Ga0068869_1000298532 364
160 3300005335 Ga0070666_10000323 Ga0070666_1000032323 364
161 3300005335 Ga0070666_10039661 Ga0070666_100396611 364
162 3300005335 Ga0070666_10050834 Ga0070666_100508342 364
163 3300005335 Ga0070666_10089312 Ga0070666_100893121 364
164 3300005336 Ga0070680_100088694 Ga0070680_1000886942 364
165 3300005337 Ga0070682_100015101 Ga0070682_1000151012 364
166 3300005338 Ga0068868_100011769 Ga0068868_1000117692 364
167 3300005338 Ga0068868_100073311 Ga0068868_1000733112 364
168 3300005339 Ga0070660_100018241 Ga0070660_1000182412 364
169 3300005339 Ga0070660_100022575 Ga0070660_1000225753 364
170 3300005339 Ga0070660_100084249 Ga0070660_1000842492 364
171 3300005339 Ga0070660_100091007 Ga0070660_1000910072 364
172 3300005339 Ga0070660_100102205 Ga0070660_1001022051 364
173 3300005340 Ga0070689_100032832 Ga0070689_1000328322 364
174 3300005340 Ga0070689_100081519 Ga0070689_1000815192 364
175 3300005340 Ga0070689_100167422 Ga0070689_1001674221 364
176 3300005343 Ga0070687_100018802 Ga0070687_1000188022 364
177 3300005344 Ga0070661_100017392 Ga0070661_1000173924 364
178 3300005344 Ga0070661_100018414 Ga0070661_1000184143 364
179 3300005344 Ga0070661_100023003 Ga0070661_1000230032 364
180 3300005344 Ga0070661_100125671 Ga0070661_1001256712 364
181 3300005344 Ga0070661_100148562 Ga0070661_1001485622 364
182 3300005353 Ga0070669_100107719 Ga0070669_1001077191 364
183 3300005354 Ga0070675_100075487 Ga0070675_1000754871 364
184 3300005354 Ga0070675_100095534 Ga0070675_1000955342 364
185 3300005354 Ga0070675_100260120 Ga0070675_1002601202 364
186 3300005355 Ga0070671_100017656 Ga0070671_1000176563 364
187 3300005355 Ga0070671_100028756 Ga0070671_1000287562 364
188 3300005355 Ga0070671_100045574 Ga0070671_1000455742 364
189 3300005355 Ga0070671_100051054 Ga0070671_1000510543 364
190 3300005356 Ga0070674_100034090 Ga0070674_1000340901 364
191 3300005356 Ga0070674_100040391 Ga0070674_1000403912 364
192 3300005364 Ga0070673_100210247 Ga0070673_1002102472 364
193 3300005366 Ga0070659_100020130 Ga0070659_1000201303 364
194 3300005366 Ga0070659_100027199 Ga0070659_1000271992 364
195 3300005366 Ga0070659_100170706 Ga0070659_1001707062 364
196 3300005366 Ga0070659_100187531 Ga0070659_1001875312 364
197 3300005367 Ga0070667_100013727 Ga0070667_1000137276 364
198 3300005367 Ga0070667_100018635 Ga0070667_1000186353 364
199 3300005441 Ga0070700_100095785 Ga0070700_1000957851 364
200 3300005455 Ga0070663_100160268 Ga0070663_1001602682 364
201 3300005456 Ga0070678_100069065 Ga0070678_1000690652 364
202 3300005456 Ga0070678_100245311 Ga0070678_1002453111 364
203 3300005457 Ga0070662_100008210 Ga0070662_1000082101 364
204 3300005457 Ga0070662_100009369 Ga0070662_1000093692 364
205 3300005457 Ga0070662_100034475 Ga0070662_1000344752 364
206 3300005457 Ga0070662_100072463 Ga0070662_1000724632 364
207 3300005458 Ga0070681_10022539 Ga0070681_100225392 364
208 3300005458 Ga0070681_10090546 Ga0070681_100905461 364
209 3300005458 Ga0070681_10104078 Ga0070681_101040781 364
210 3300005458 Ga0070681_10123837 Ga0070681_101238372 364
211 3300005459 Ga0068867_100066917 Ga0068867_1000669172 364
212 3300005459 Ga0068867_100100906 Ga0068867_1001009062 364
213 3300005535 Ga0070684_100002271 Ga0070684_10000227111 364
214 3300005535 Ga0070684_100003761 Ga0070684_1000037613 364
215 3300005535 Ga0070684_100014398 Ga0070684_1000143982 364
216 3300005535 Ga0070684_100159782 Ga0070684_1001597822 364
217 3300005539 Ga0068853_100004842 Ga0068853_1000048427 364
218 3300005539 Ga0068853_100008095 Ga0068853_1000080952 364
219 3300005544 Ga0070686_100042697 Ga0070686_1000426972 364
220 3300005548 Ga0070665_100000013 Ga0070665_10000001345 364
221 3300005548 Ga0070665_100050472 Ga0070665_1000504722 364
222 3300005563 Ga0068855_100008654 Ga0068855_1000086549 364
223 3300005563 Ga0068855_100082497 Ga0068855_1000824972 364
224 3300005563 Ga0068855_100100971 Ga0068855_1001009712 364
225 3300005563 Ga0068855_100227409 Ga0068855_1002274092 364
226 3300005564 Ga0070664_100008760 Ga0070664_1000087605 364
227 3300005564 Ga0070664_100009912 Ga0070664_1000099126 364
228 3300005564 Ga0070664_100022766 Ga0070664_1000227663 364
229 3300005564 Ga0070664_100077678 Ga0070664_1000776782 364
230 3300005564 Ga0070664_100175937 Ga0070664_1001759372 364
231 3300005564 Ga0070664_100225131 Ga0070664_1002251312 364
232 3300005564 Ga0070664_100229713 Ga0070664_1002297132 364
233 3300005577 Ga0068857_100008973 Ga0068857_1000089732 364
234 3300005577 Ga0068857_100013968 Ga0068857_1000139686 364
235 3300005577 Ga0068857_100111325 Ga0068857_1001113251 364
236 3300005577 Ga0068857_100131169 Ga0068857_1001311692 364
237 3300005578 Ga0068854_100046604 Ga0068854_1000466043 364
238 3300005614 Ga0068856_100011161 Ga0068856_1000111617 364
239 3300005614 Ga0068856_100033995 Ga0068856_1000339954 364
240 3300005614 Ga0068856_100044676 Ga0068856_1000446762 364
241 3300005614 Ga0068856_100049244 Ga0068856_1000492443 364
242 3300005616 Ga0068852_100002185 Ga0068852_1000021851 364
243 3300005616 Ga0068852_100007001 Ga0068852_1000070018 364
244 3300005616 Ga0068852_100010881 Ga0068852_1000108816 364
245 3300005616 Ga0068852_100054037 Ga0068852_1000540372 364
246 3300005616 Ga0068852_100119294 Ga0068852_1001192942 364
247 3300005617 Ga0068859_100000106 Ga0068859_10000010656 364
248 3300005617 Ga0068859_100013598 Ga0068859_1000135986 364
249 3300005617 Ga0068859_100023855 Ga0068859_1000238552 364
250 3300005617 Ga0068859_100455329 Ga0068859_1004553292 364
251 3300005618 Ga0068864_100027728 Ga0068864_1000277282 364
252 3300005719 Ga0068861_100156711 Ga0068861_1001567112 364
253 3300005834 Ga0068851_10044359 Ga0068851_100443592 364
254 3300005841 Ga0068863_100015218 Ga0068863_1000152183 364
255 3300005841 Ga0068863_100141421 Ga0068863_1001414212 364
256 3300005842 Ga0068858_100017875 Ga0068858_1000178754 364
257 3300005842 Ga0068858_100183921 Ga0068858_1001839211 364
258 3300005843 Ga0068860_100000096 Ga0068860_10000009696 364
259 3300005843 Ga0068860_100004286 Ga0068860_1000042863 364
260 3300005843 Ga0068860_100027668 Ga0068860_1000276683 364
261 3300005843 Ga0068860_100098239 Ga0068860_1000982392 364
262 3300005843 Ga0068860_100138830 Ga0068860_1001388302 364
263 3300005985 Ga0081539_10001810 Ga0081539_1000181019 364
264 3300006195 Ga0075366_10014315 Ga0075366_100143152 364
265 3300006237 Ga0097621_100000254 Ga0097621_10000025426 364
266 3300006237 Ga0097621_100039323 Ga0097621_1000393232 364
267 3300006237 Ga0097621_100044843 Ga0097621_1000448432 364
268 3300006237 Ga0097621_100113512 Ga0097621_1001135121 364
269 3300006358 Ga0068871_100013263 Ga0068871_1000132635 364
270 3300006358 Ga0068871_100034272 Ga0068871_1000342722 364
271 3300006358 Ga0068871_100046702 Ga0068871_1000467023 364
272 3300006358 Ga0068871_100090633 Ga0068871_1000906332 364
273 3300006847 Ga0075431_100183200 Ga0075431_1001832001 364
274 3300006871 Ga0075434_100139355 Ga0075434_1001393551 364
275 3300006880 Ga0075429_100033538 Ga0075429_1000335386 364
276 3300006881 Ga0068865_100066772 Ga0068865_1000667722 364
277 3300006881 Ga0068865_100077616 Ga0068865_1000776162 364
278 3300006931 Ga0097620_100000106 Ga0097620_10000010656 364
279 3300006931 Ga0097620_100013598 Ga0097620_1000135986 364
280 3300006931 Ga0097620_100023855 Ga0097620_1000238552 364
281 3300006931 Ga0097620_100455334 Ga0097620_1004553342 364
282 3300009093 Ga0105240_10001307 Ga0105240_1000130721 364
283 3300009093 Ga0105240_10037223 Ga0105240_100372232 364
284 3300009093 Ga0105240_10039925 Ga0105240_100399252 364
285 3300009093 Ga0105240_10258372 Ga0105240_102583721 364
286 3300009094 Ga0111539_10036677 Ga0111539_100366774 364
287 3300009094 Ga0111539_10077353 Ga0111539_100773532 364
288 3300009101 Ga0105247_10067079 Ga0105247_100670792 364
289 3300009147 Ga0114129_10007516 Ga0114129_100075166 364
290 3300009174 Ga0105241_10000450 Ga0105241_1000045011 364
291 3300009174 Ga0105241_10001462 Ga0105241_1000146214 364
292 3300009174 Ga0105241_10042941 Ga0105241_100429412 364
293 3300009177 Ga0105248_10280292 Ga0105248_102802921 364
294 3300009545 Ga0105237_10003093 Ga0105237_1000309315 364
295 3300009545 Ga0105237_10052084 Ga0105237_100520843 364
296 3300009545 Ga0105237_10083882 Ga0105237_100838821 364
297 3300009545 Ga0105237_10112593 Ga0105237_101125932 364
298 3300009551 Ga0105238_10027049 Ga0105238_100270492 364
299 3300009551 Ga0105238_10031092 Ga0105238_100310925 364
300 3300009553 Ga0105249_10045730 Ga0105249_100457302 364
301 3300009553 Ga0105249_10047197 Ga0105249_100471972 364
302 3300009553 Ga0105249_10051875 Ga0105249_100518752 364
303 3300010375 Ga0105239_10018442 Ga0105239_100184423 364
304 3300010375 Ga0105239_10059843 Ga0105239_100598431 364
305 3300010375 Ga0105239_10088533 Ga0105239_100885331 364
306 3300010375 Ga0105239_10286601 Ga0105239_102866012 364
307 3300013100 Ga0157373_10007993 Ga0157373_100079935 364
308 3300013100 Ga0157373_10018991 Ga0157373_100189912 364
309 3300013102 Ga0157371_10000232 Ga0157371_1000023269 364
310 3300013102 Ga0157371_10000741 Ga0157371_1000074131 364
311 3300013102 Ga0157371_10010793 Ga0157371_100107933 364
312 3300013102 Ga0157371_10012606 Ga0157371_100126062 364
313 3300013102 Ga0157371_10013699 Ga0157371_100136994 364
314 3300013102 Ga0157371_10027523 Ga0157371_100275233 364
315 3300013102 Ga0157371_10028986 Ga0157371_100289862 364
316 3300013102 Ga0157371_10052339 Ga0157371_100523392 364
317 3300013102 Ga0157371_10081797 Ga0157371_100817972 364
318 3300013104 Ga0157370_10007033 Ga0157370_100070332 364
319 3300013104 Ga0157370_10019629 Ga0157370_100196295 364
320 3300013104 Ga0157370_10072220 Ga0157370_100722202 364
321 3300013104 Ga0157370_10133879 Ga0157370_101338792 364
322 3300013105 Ga0157369_10049312 Ga0157369_100493123 364
323 3300013105 Ga0157369_10278709 Ga0157369_102787092 364
324 3300013296 Ga0157374_10001709 Ga0157374_100017098 364
325 3300013296 Ga0157374_10011096 Ga0157374_100110962 364
326 3300013296 Ga0157374_10037610 Ga0157374_100376102 364
327 3300013296 Ga0157374_10269884 Ga0157374_102698841 364
328 3300013297 Ga0157378_10010095 Ga0157378_100100957 364
329 3300013297 Ga0157378_10012713 Ga0157378_100127132 364
330 3300013297 Ga0157378_10012980 Ga0157378_100129802 364
331 3300013297 Ga0157378_10028220 Ga0157378_100282201 364
332 3300013297 Ga0157378_10225749 Ga0157378_102257492 364
333 3300013306 Ga0163162_10000339 Ga0163162_1000033930 364
334 3300013306 Ga0163162_10004808 Ga0163162_1000480811 364
335 3300013306 Ga0163162_10018015 Ga0163162_100180156 364
336 3300013306 Ga0163162_10029916 Ga0163162_100299166 364
337 3300013306 Ga0163162_10103211 Ga0163162_101032112 364
338 3300013307 Ga0157372_10002019 Ga0157372_1000201914 364
339 3300013307 Ga0157372_10014606 Ga0157372_100146063 364
340 3300013307 Ga0157372_10057014 Ga0157372_100570142 364
341 3300013307 Ga0157372_10075567 Ga0157372_100755673 364
342 3300013307 Ga0157372_10188376 Ga0157372_101883762 364
343 3300013307 Ga0157372_10195802 Ga0157372_101958022 364
344 3300013307 Ga0157372_10206650 Ga0157372_102066501 364
345 3300013307 Ga0157372_10275781 Ga0157372_102757812 364
346 3300013308 Ga0157375_10005268 Ga0157375_100052682 364
347 3300013308 Ga0157375_10006234 Ga0157375_100062346 364
348 3300013308 Ga0157375_10032468 Ga0157375_100324683 364
349 3300013308 Ga0157375_10095733 Ga0157375_100957332 364
350 3300013308 Ga0157375_10202026 Ga0157375_102020262 364
351 3300013308 Ga0157375_10262152 Ga0157375_102621522 364
352 3300013308 Ga0157375_10298543 Ga0157375_102985432 364
353 3300014325 Ga0163163_10001534 Ga0163163_1000153418 364
354 3300014325 Ga0163163_10001692 Ga0163163_1000169213 364
355 3300014325 Ga0163163_10003221 Ga0163163_100032212 364
356 3300014326 Ga0157380_10009627 Ga0157380_100096273 364
357 3300014326 Ga0157380_10120399 Ga0157380_101203992 364
358 3300014326 Ga0157380_10257058 Ga0157380_102570581 364
359 3300014745 Ga0157377_10019611 Ga0157377_100196112 364
360 3300014745 Ga0157377_10030614 Ga0157377_100306142 364
361 3300014968 Ga0157379_10011015 Ga0157379_100110156 364
362 3300014968 Ga0157379_10012914 Ga0157379_100129143 364
363 3300014968 Ga0157379_10047082 Ga0157379_100470822 364
364 3300014969 Ga0157376_10002772 Ga0157376_100027726 364
365 3300014969 Ga0157376_10024576 Ga0157376_100245762 364
366 3300014969 Ga0157376_10039865 Ga0157376_100398652 364
367 3300014969 Ga0157376_10073056 Ga0157376_100730563 364
368 3300015265 Ga0182005_1000131 Ga0182005_100013148 364
369 3300017792 Ga0163161_10009040 Ga0163161_100090402 364
370 3300017792 Ga0163161_10050012 Ga0163161_100500122 364
371 3300017792 Ga0163161_10152538 Ga0163161_101525381 364
372 3300025242 Ga0209258_100219 Ga0209258_10021918 364
373 3300025246 Ga0209646_1002107 Ga0209646_10021072 364
374 3300025254 Ga0209148_1000543 Ga0209148_100054314 364
375 3300025284 Ga0209130_1001419 Ga0209130_10014195 364
376 3300025302 Ga0207426_1000089 Ga0207426_100008946 364
377 3300025302 Ga0207426_1000412 Ga0207426_10004125 364
378 3300025302 Ga0207426_1021857 Ga0207426_10218572 364
379 3300025315 Ga0207697_10093545 Ga0207697_100935451 364
380 3300025315 Ga0207697_10094465 Ga0207697_100944651 364
381 3300025901 Ga0207688_10032238 Ga0207688_100322382 364
382 3300025903 Ga0207680_10000958 Ga0207680_100009588 364
383 3300025903 Ga0207680_10077165 Ga0207680_100771652 364
384 3300025903 Ga0207680_10122344 Ga0207680_101223442 364
385 3300025904 Ga0207647_10010225 Ga0207647_100102253 364
386 3300025904 Ga0207647_10031308 Ga0207647_100313083 364
387 3300025907 Ga0207645_10005660 Ga0207645_1000566010 364
388 3300025909 Ga0207705_10010075 Ga0207705_100100752 364
389 3300025909 Ga0207705_10013815 Ga0207705_100138154 364
390 3300025909 Ga0207705_10104291 Ga0207705_101042912 364
391 3300025911 Ga0207654_10006887 Ga0207654_100068874 364
392 3300025911 Ga0207654_10008121 Ga0207654_100081213 364
393 3300025912 Ga0207707_10041904 Ga0207707_100419042 364
394 3300025912 Ga0207707_10135100 Ga0207707_101351002 364
395 3300025913 Ga0207695_10000027 Ga0207695_10000027119 364
396 3300025913 Ga0207695_10000247 Ga0207695_100002472 364
397 3300025913 Ga0207695_10000545 Ga0207695_1000054523 364
398 3300025914 Ga0207671_10002087 Ga0207671_1000208716 364
399 3300025914 Ga0207671_10007498 Ga0207671_100074985 364
400 3300025917 Ga0207660_10030214 Ga0207660_100302144 364
401 3300025918 Ga0207662_10013999 Ga0207662_100139992 364
402 3300025919 Ga0207657_10013358 Ga0207657_100133583 364
403 3300025919 Ga0207657_10104244 Ga0207657_101042442 364
404 3300025919 Ga0207657_10224742 Ga0207657_102247422 364
405 3300025919 Ga0207657_10234266 Ga0207657_102342662 364
406 3300025920 Ga0207649_10005455 Ga0207649_100054553 364
407 3300025920 Ga0207649_10035280 Ga0207649_100352802 364
408 3300025920 Ga0207649_10072800 Ga0207649_100728002 364
409 3300025921 Ga0207652_10000115 Ga0207652_1000011571 364
410 3300025921 Ga0207652_10091840 Ga0207652_100918401 364
411 3300025921 Ga0207652_10095020 Ga0207652_100950202 364
412 3300025923 Ga0207681_10218189 Ga0207681_102181892 364
413 3300025924 Ga0207694_10016251 Ga0207694_100162512 364
414 3300025925 Ga0207650_10003564 Ga0207650_100035648 364
415 3300025925 Ga0207650_10059793 Ga0207650_100597932 364
416 3300025925 Ga0207650_10062627 Ga0207650_100626272 364
417 3300025926 Ga0207659_10012168 Ga0207659_100121682 364
418 3300025926 Ga0207659_10105320 Ga0207659_101053202 364
419 3300025931 Ga0207644_10120679 Ga0207644_101206792 364
420 3300025932 Ga0207690_10017335 Ga0207690_100173352 364
421 3300025932 Ga0207690_10034224 Ga0207690_100342242 364
422 3300025933 Ga0207706_10002398 Ga0207706_100023986 364
423 3300025933 Ga0207706_10015809 Ga0207706_100158097 364
424 3300025933 Ga0207706_10015825 Ga0207706_100158252 364
425 3300025936 Ga0207670_10182166 Ga0207670_101821662 364
426 3300025938 Ga0207704_10053192 Ga0207704_100531922 364
427 3300025938 Ga0207704_10093476 Ga0207704_100934762 364
428 3300025940 Ga0207691_10036560 Ga0207691_100365603 364
429 3300025942 Ga0207689_10000360 Ga0207689_1000036022 364
430 3300025942 Ga0207689_10013538 Ga0207689_100135382 364
431 3300025942 Ga0207689_10013879 Ga0207689_100138793 364
432 3300025942 Ga0207689_10029544 Ga0207689_100295442 364
433 3300025944 Ga0207661_10027550 Ga0207661_100275506 364
434 3300025944 Ga0207661_10043244 Ga0207661_100432442 364
435 3300025945 Ga0207679_10003352 Ga0207679_100033524 364
436 3300025945 Ga0207679_10029202 Ga0207679_100292023 364
437 3300025945 Ga0207679_10035501 Ga0207679_100355012 364
438 3300025945 Ga0207679_10038962 Ga0207679_100389622 364
439 3300025945 Ga0207679_10072333 Ga0207679_100723332 364
440 3300025945 Ga0207679_10246152 Ga0207679_102461522 364
441 3300025949 Ga0207667_10001637 Ga0207667_100016373 364
442 3300025949 Ga0207667_10011285 Ga0207667_100112853 364
443 3300025949 Ga0207667_10028760 Ga0207667_100287604 364
444 3300025960 Ga0207651_10004229 Ga0207651_100042292 364
445 3300025960 Ga0207651_10030986 Ga0207651_100309861 364
446 3300025961 Ga0207712_10001164 Ga0207712_100011641 364
447 3300025986 Ga0207658_10004542 Ga0207658_100045423 364
448 3300025986 Ga0207658_10044243 Ga0207658_100442432 364
449 3300026023 Ga0207677_10006746 Ga0207677_100067463 364
450 3300026023 Ga0207677_10066685 Ga0207677_100666852 364
451 3300026035 Ga0207703_10001922 Ga0207703_1000192213 364
452 3300026041 Ga0207639_10020021 Ga0207639_100200213 364
453 3300026041 Ga0207639_10052568 Ga0207639_100525684 364
454 3300026041 Ga0207639_10073538 Ga0207639_100735382 364
455 3300026067 Ga0207678_10030180 Ga0207678_100301803 364
456 3300026067 Ga0207678_10177572 Ga0207678_101775722 364
457 3300026075 Ga0207708_10037700 Ga0207708_100377003 364
458 3300026078 Ga0207702_10035596 Ga0207702_100355962 364
459 3300026078 Ga0207702_10062840 Ga0207702_100628402 364
460 3300026088 Ga0207641_10000082 Ga0207641_10000082110 364
461 3300026088 Ga0207641_10124557 Ga0207641_101245572 364
462 3300026088 Ga0207641_10159138 Ga0207641_101591382 364
463 3300026089 Ga0207648_10007104 Ga0207648_100071043 364
464 3300026089 Ga0207648_10017728 Ga0207648_100177286 364
465 3300026089 Ga0207648_10023556 Ga0207648_100235563 364
466 3300026089 Ga0207648_10083796 Ga0207648_100837962 364
467 3300026095 Ga0207676_10021921 Ga0207676_100219211 364
468 3300026095 Ga0207676_10030817 Ga0207676_100308172 364
469 3300026095 Ga0207676_10044339 Ga0207676_100443393 364
470 3300026095 Ga0207676_10048871 Ga0207676_100488712 364
471 3300026116 Ga0207674_10011604 Ga0207674_100116047 364
472 3300026116 Ga0207674_10029392 Ga0207674_100293924 364
473 3300026116 Ga0207674_10094181 Ga0207674_100941812 364
474 3300026116 Ga0207674_10131541 Ga0207674_101315413 364
475 3300026118 Ga0207675_100060987 Ga0207675_1000609872 364
476 3300026118 Ga0207675_100144583 Ga0207675_1001445832 364
477 3300026118 Ga0207675_100204740 Ga0207675_1002047402 364
478 3300026121 Ga0207683_10011342 Ga0207683_100113426 364
479 3300026121 Ga0207683_10049070 Ga0207683_100490704 364
480 3300026142 Ga0207698_10008386 Ga0207698_100083862 364
481 3300026142 Ga0207698_10027230 Ga0207698_100272302 364
482 3300026142 Ga0207698_10052761 Ga0207698_100527612 364
483 3300026142 Ga0207698_10120522 Ga0207698_101205222 364
484 3300028379 Ga0268266_10000024 Ga0268266_10000024355 364
485 3300028381 Ga0268264_10000094 Ga0268264_10000094193 364
486 3300028381 Ga0268264_10007283 Ga0268264_100072834 364
487 3300028381 Ga0268264_10013367 Ga0268264_100133673 364
488 3300031456 Ga0307513_10059661 Ga0307513_100596613 364
489 3300031456 Ga0307513_10177364 Ga0307513_101773642 364
490 3300031616 Ga0307508_10004493 Ga0307508_100044933 364
491 3300032002 Ga0307416_100100684 Ga0307416_1001006842 364
492 3300033180 Ga0307510_10011551 Ga0307510_1001155110 364
493 3300037312 Ga0395899_0017114 Ga0395899_0017114_1423_2589 364
494 3300037312 Ga0395899_0149125 Ga0395899_0149125_448_1638 364
495 3300037418 Ga0395900_0052792 Ga0395900_0052792_1420_2586 364
496 3300037418 Ga0395900_0074097 Ga0395900_0074097_1743_2909 364
497 3300037466 Ga0395898_0046113 Ga0395898_0046113_1513_2679 364
498 3300037466 Ga0395898_0172171 Ga0395898_0172171_859_2049 364
499 3300037471 Ga0395905_0280405 Ga0395905_0280405_242_1411 364
500 3300038443 Ga0395901_0002351 Ga0395901_0002351_12697_13887 364
501 3300041413 Ga0439465_0004116 Ga0439465_0004116_51_1217 364
502 3300041512 Ga0451853_0777131 Ga0451853_0777131_980_2149 364
503 3300042007 Ga0439449_0014017 Ga0439449_0014017_790_1959 364
504 3300042014 Ga0439457_002871 Ga0439457_002871_3448_4617 364
505 3300042015 Ga0439462_0010364 Ga0439462_0010364_828_1997 364
506 3300044673 Ga0453683_0109757 Ga0453683_0109757_481_1653 364
507 3300044693 Ga0466961_0109432 Ga0466961_0109432_229_1398 364
508 3300044712 Ga0453684_0276144 Ga0453684_0276144_674_1840 364
509 3300044842 Ga0466957_0000015 Ga0466957_0000015_16089_17258 364
510 3300045049 Ga0466959_0067586 Ga0466959_0067586_824_1993 364
511 3300046460 Ga0495638_0023629 Ga0495638_0023629_987_2156 364
512 3300046507 Ga0495606_0019212 Ga0495606_0019212_102_1331 364
513 3300046524 Ga0495648_0045725 Ga0495648_0045725_1168_2337 364
514 3300046557 Ga0495622_0034664 Ga0495622_0034664_734_1903 364
515 3300046616 Ga0495668_0006718 Ga0495668_0006718_5550_6719 364
516 3300046648 Ga0495611_0000095 Ga0495611_0000095_17163_18332 364
517 3300046648 Ga0495611_0078528 Ga0495611_0078528_31_1200 364
518 3300047322 Ga0495680_0108843 Ga0495680_0108843_210_1379 364
519 3300047443 Ga0495687_000072 Ga0495687_000072_100954_102123 364
520 3300047472 Ga0495686_0017619 Ga0495686_0017619_1056_2225 364
521 3300047472 Ga0495686_0025521 Ga0495686_0025521_916_2085 364
522 3300048904 Ga0496101_0014418 Ga0496101_0014418_198_1352 364
523 3300048911 Ga0496108_0194932 Ga0496108_0194932_100_1269 364
524 3300048917 Ga0496114_0071846 Ga0496114_0071846_895_2049 364
525 3300048924 Ga0496121_0000020 Ga0496121_0000020_240485_241651 364
526 3300049568 Ga0501031_0008583 Ga0501031_0008583_482_1792 364
527 3300049569 Ga0501032_0010122 Ga0501032_0010122_2000_3169 364
528 3300049569 Ga0501032_0078706 Ga0501032_0078706_111_1277 364
529 3300049569 Ga0501032_0091263 Ga0501032_0091263_45_1199 364
530 3300049569 Ga0501032_0148497 Ga0501032_0148497_77_1387 364
531 3300049570 Ga0501033_0056301 Ga0501033_0056301_1510_2703 364
532 3300049570 Ga0501033_0070139 Ga0501033_0070139_1199_2365 364
533 3300049571 Ga0501034_0000043 Ga0501034_0000043_36645_37814 364
534 3300049571 Ga0501034_0018832 Ga0501034_0018832_2564_3730 364
535 3300049571 Ga0501034_0078222 Ga0501034_0078222_1986_3140 364
536 3300049572 Ga0501036_0009845 Ga0501036_0009845_3996_5165 364
537 3300049573 Ga0501037_0023321 Ga0501037_0023321_1142_2335 364
538 3300049574 Ga0501038_0017545 Ga0501038_0017545_3240_4409 364
539 3300049574 Ga0501038_0068272 Ga0501038_0068272_1033_2199 364
540 3300049575 Ga0501039_0034856 Ga0501039_0034856_1135_2304 364
541 3300049579 Ga0501043_0028686 Ga0501043_0028686_2030_3340 364
542 3300049579 Ga0501043_0065340 Ga0501043_0065340_1384_2577 364
543 3300049579 Ga0501043_0106455 Ga0501043_0106455_787_1941 364
544 3300049579 Ga0501043_0176120 Ga0501043_0176120_144_1313 364
545 3300049581 Ga0501047_0041977 Ga0501047_0041977_1201_2355 364
546 3300049581 Ga0501047_0047833 Ga0501047_0047833_2889_4058 364
547 3300049581 Ga0501047_0056603 Ga0501047_0056603_539_1732 364
548 3300049586 Ga0501070_0024071 Ga0501070_0024071_1775_2944 364
549 3300049586 Ga0501070_0074590 Ga0501070_0074590_638_1804 364
550 3300049586 Ga0501070_0110046 Ga0501070_0110046_260_1414 364
551 3300049589 Ga0501073_0014685 Ga0501073_0014685_2487_3656 364
552 3300049590 Ga0501074_0004644 Ga0501074_0004644_6589_7758 364
553 3300049822 Ga0501035_0039965 Ga0501035_0039965_1573_2883 364
554 3300049822 Ga0501035_0107920 Ga0501035_0107920_646_1800 364
555 3300049823 Ga0501044_0029899 Ga0501044_0029899_4472_5638 364
556 3300049823 Ga0501044_0044903 Ga0501044_0044903_1703_2860 364
557 3300049823 Ga0501044_0060405 Ga0501044_0060405_2238_3395 364
558 3300049823 Ga0501044_0060648 Ga0501044_0060648_671_1840 364
559 3300049823 Ga0501044_0150002 Ga0501044_0150002_53_1207 364
560 3300050005 Ga0501284_00032 Ga0501284_00032_44166_45335 364
561 3300050493 nmdc:mga0k408_14461_c1 nmdc:mga0k408_14461_c1_542_1708 364
562 3300050493 nmdc:mga0k408_14661_c1 nmdc:mga0k408_14661_c1_451_1620 364
563 3300050493 nmdc:mga0k408_59772_c1 nmdc:mga0k408_59772_c1_155_1324 364
564 3300050507 nmdc:mga05p37_4550_c1 nmdc:mga05p37_4550_c1_11883_13052 364
565 3300050508 nmdc:mga09592_90231_c1 nmdc:mga09592_90231_c1_123_1277 364
566 3300050510 nmdc:mga06r32_56382_c1 nmdc:mga06r32_56382_c1_1620_2774 364
567 3300050511 nmdc:mga08y16_85547_c1 nmdc:mga08y16_85547_c1_1794_2963 364
568 3300053086 Ga0500578_0000934 Ga0500578_0000934_25513_26682 364
569 3300053088 Ga0500644_0001065 Ga0500644_0001065_1230_2396 364
570 3300053088 Ga0500644_0004445 Ga0500644_0004445_1625_2794 364
571 3300053090 Ga0500646_0019579 Ga0500646_0019579_281_1450 364
572 3300053092 Ga0500583_0000096 Ga0500583_0000096_2061_3230 364
573 3300053092 Ga0500583_0000348 Ga0500583_0000348_175_1344 364
574 3300053092 Ga0500583_0004108 Ga0500583_0004108_472_1638 364
575 3300053092 Ga0500583_0008745 Ga0500583_0008745_2073_3242 364
576 3300053109 Ga0500569_000271 Ga0500569_000271_759_1925 364
577 3300053136 Ga0500559_0009804 Ga0500559_0009804_2224_3390 364
578 3300053139 Ga0500568_0000306 Ga0500568_0000306_2213_3382 364
579 3300053142 Ga0500577_0018902 Ga0500577_0018902_427_1593 364
580 3300053146 Ga0500588_0014501 Ga0500588_0014501_413_1582 364
581 3300053160 Ga0500633_0003502 Ga0500633_0003502_457_1623 364
582 3300053727 Ga0500611_000086 Ga0500611_000086_22936_24102 364
583 3300061719 Ga0466962_0026007 Ga0466962_0026007_770_1939 364
584 iso_pu_bacteria 2738541278 2738727323 364
585 iso_pu_bacteria 2842903701 2842903744 364
586 3300042876 Ga0451577_0003822 Ga0451577_0003822_2028_3191 365
587 3300005843 Ga0068860_100097597 Ga0068860_1000975972 366
588 3300009101 Ga0105247_10008461 Ga0105247_100084613 366
589 3300014325 Ga0163163_10135567 Ga0163163_101355672 366
590 3300025900 Ga0207710_10006690 Ga0207710_100066902 366
591 3300025923 Ga0207681_10079869 Ga0207681_100798692 366
592 3300025961 Ga0207712_10094131 Ga0207712_100941312 366
593 3300005364 Ga0070673_100007833 Ga0070673_1000078337 367
594 3300005719 Ga0068861_100115830 Ga0068861_1001158302 367
595 3300014326 Ga0157380_10034973 Ga0157380_100349732 367
596 3300025893 Ga0207682_10010850 Ga0207682_100108502 367
597 3300025960 Ga0207651_10144900 Ga0207651_101449002 367
598 3300026089 Ga0207648_10070046 Ga0207648_100700462 367
599 3300005295 Ga0065707_10096512 Ga0065707_100965122 368
600 3300005330 Ga0070690_100042620 Ga0070690_1000426202 368
601 3300005334 Ga0068869_100139101 Ga0068869_1001391012 368
602 3300005340 Ga0070689_100029388 Ga0070689_1000293882 368
603 3300005347 Ga0070668_100027498 Ga0070668_1000274981 368
604 3300005364 Ga0070673_100003881 Ga0070673_1000038814 368
605 3300005365 Ga0070688_100001020 Ga0070688_1000010204 368
606 3300005456 Ga0070678_100166679 Ga0070678_1001666792 368
607 3300005457 Ga0070662_100012225 Ga0070662_1000122255 368
608 3300005543 Ga0070672_100030153 Ga0070672_1000301534 368
609 3300005577 Ga0068857_100040424 Ga0068857_1000404242 368
610 3300005617 Ga0068859_100030317 Ga0068859_1000303175 368
611 3300005719 Ga0068861_100022664 Ga0068861_1000226646 368
612 3300005840 Ga0068870_10060048 Ga0068870_100600482 368
613 3300005844 Ga0068862_100017036 Ga0068862_1000170366 368
614 3300006931 Ga0097620_100030315 Ga0097620_1000303155 368
615 3300009094 Ga0111539_10034031 Ga0111539_100340316 368
616 3300013306 Ga0163162_10024454 Ga0163162_100244546 368
617 3300013308 Ga0157375_10017257 Ga0157375_100172573 368
618 3300014326 Ga0157380_10000368 Ga0157380_1000036820 368
619 3300014745 Ga0157377_10022247 Ga0157377_100222472 368
620 3300025908 Ga0207643_10096974 Ga0207643_100969742 368
621 3300025940 Ga0207691_10032612 Ga0207691_100326122 368
622 3300025961 Ga0207712_10011854 Ga0207712_100118542 368
623 3300026075 Ga0207708_10078812 Ga0207708_100788122 368
624 3300026116 Ga0207674_10094840 Ga0207674_100948402 368
625 3300026118 Ga0207675_100002684 Ga0207675_10000268416 368
626 3300028380 Ga0268265_10028918 Ga0268265_100289182 368
627 3300050511 nmdc:mga08y16_27237_c1 nmdc:mga08y16_27237_c1_3443_4654 368
628 3300002459 JGI24751J29686_10003308 JGI24751J29686_100033082 369
629 3300005331 Ga0070670_100005355 Ga0070670_1000053557 369
630 3300005340 Ga0070689_100044422 Ga0070689_1000444221 369
631 3300005364 Ga0070673_100169166 Ga0070673_1001691661 369
632 3300005365 Ga0070688_100128996 Ga0070688_1001289962 369
633 3300005365 Ga0070688_100131620 Ga0070688_1001316202 369
634 3300005471 Ga0070698_100015928 Ga0070698_1000159282 369
635 3300005471 Ga0070698_100092573 Ga0070698_1000925732 369
636 3300005618 Ga0068864_100304264 Ga0068864_1003042641 369
637 3300005841 Ga0068863_100071179 Ga0068863_1000711792 369
638 3300005841 Ga0068863_100079329 Ga0068863_1000793292 369
639 3300005842 Ga0068858_100226432 Ga0068858_1002264322 369
640 3300006237 Ga0097621_100154876 Ga0097621_1001548761 369
641 3300006844 Ga0075428_100062734 Ga0075428_1000627343 369
642 3300006846 Ga0075430_100003255 Ga0075430_10000325510 369
643 3300006846 Ga0075430_100204478 Ga0075430_1002044781 369
644 3300006847 Ga0075431_100100167 Ga0075431_1001001672 369
645 3300006847 Ga0075431_100321865 Ga0075431_1003218651 369
646 3300006880 Ga0075429_100008852 Ga0075429_1000088524 369
647 3300009553 Ga0105249_10008661 Ga0105249_100086613 369
648 3300009553 Ga0105249_10010512 Ga0105249_100105123 369
649 3300011119 Ga0105246_10057011 Ga0105246_100570112 369
650 3300013308 Ga0157375_10229737 Ga0157375_102297372 369
651 3300014745 Ga0157377_10145367 Ga0157377_101453672 369
652 3300025893 Ga0207682_10015655 Ga0207682_100156552 369
653 3300025925 Ga0207650_10091357 Ga0207650_100913572 369
654 3300025925 Ga0207650_10159880 Ga0207650_101598801 369
655 3300025925 Ga0207650_10215374 Ga0207650_102153742 369
656 3300025926 Ga0207659_10210408 Ga0207659_102104082 369
657 3300025936 Ga0207670_10043917 Ga0207670_100439172 369
658 3300025938 Ga0207704_10184496 Ga0207704_101844961 369
659 3300025940 Ga0207691_10027498 Ga0207691_100274982 369
660 3300025942 Ga0207689_10109872 Ga0207689_101098722 369
661 3300025961 Ga0207712_10001647 Ga0207712_1000164710 369
662 3300025961 Ga0207712_10028757 Ga0207712_100287571 369
663 3300025981 Ga0207640_10125095 Ga0207640_101250952 369
664 3300026035 Ga0207703_10079248 Ga0207703_100792482 369
665 3300026088 Ga0207641_10014751 Ga0207641_100147512 369
666 3300026088 Ga0207641_10279671 Ga0207641_102796712 369
667 3300026089 Ga0207648_10050419 Ga0207648_100504192 369
668 3300026095 Ga0207676_10182494 Ga0207676_101824942 369
669 3300026118 Ga0207675_100028740 Ga0207675_1000287402 369
670 3300042007 Ga0439449_0022117 Ga0439449_0022117_499_1716 369
671 3300042125 Ga0450923_007442 Ga0450923_007442_163_1383 369
672 3300046539 Ga0495621_0035246 Ga0495621_0035246_101_1321 369
673 3300050508 nmdc:mga09592_27575_c1 nmdc:mga09592_27575_c1_2288_3508 369
674 3300050509 nmdc:mga0qj67_24094_c1 nmdc:mga0qj67_24094_c1_2712_3932 369
675 3300050510 nmdc:mga06r32_91216_c1 nmdc:mga06r32_91216_c1_152_1372 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

197

280

0.99

PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

57

183

0.98

PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

312

429

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mh5-assembly1.cif.gz_A crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from staphylococcus schleiferi in complex with fosmidomycin (fom) 0.9273 7 360
1jvs-assembly1.cif.gz_B crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs 0.9186 8 368
5kry-assembly1.cif.gz_B 1-deoxy-d-xylulose 5-phosphate reductoisomerase from vibrio vulnificus 0.9107 6 368
5kqo-assembly1.cif.gz_A 1-deoxy-d-xylulose 5-phosphate reductoisomerase from vibrio vulnificus 0.9088 6 368
1r0k-assembly2.cif.gz_D crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9056 8 369
ID Description Score Start End Superfamily
af_A0A1D6MNI9_381_464_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9532 292 366 1.10.1740.10
4zn6B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.949 287 368 1.10.1740.10
3au9B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9327 292 368 1.10.1740.10
3au9A03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.931 292 368 1.10.1740.10
1t1rA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9282 292 368 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A3N5K7R6-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase 0.9797 7 88 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A662BSW1-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase 0.9775 6 97 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A432UA01-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9608 7 99 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A4Q3DAG8-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase 0.9603 7 103 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A382T863-F1-model_v4 1-deoxy-D-xylulose 5-phosphate reductoisomerase N-terminal domain-containing protein 0.9581 7 95 GO:0030145
GO:0030604
GO:0051484
GO:0070402

Feature Viewer

pLDDT pTM Quality
84.37 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map