F474443

General Info

Members Datasets Scaffolds Average Seq Length
675 306 662 117

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0308302|Ga0373947_0308302_472_873
Length 133
Sequence MCCEQTLSRRGQESALSDTDLPPAAATTTASRPQFVAVQASPEFQELRNRLRRFVFPMTVVFLLWYFAYVLLGAFAHDFMATAVWGNTNVGLLIGLGQFITTFLITGLYVRLANRELDPRAEAIRSELEGDEA

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2643221546 Microbacterium sp. Root53 Isolate Unclassified
3 2643221692 Nocardia sp. Root136 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
13 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
14 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
15 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
16 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0.15
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 13.78
Nodule 0
Rhizoplane 11.7
Rhizosphere 69.78
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1008898 3300000545 Bacteria 708
2 LJNas_1005571 3300000546 Bacteria 1372
3 JGI24746J21847_1007480 3300001977 Bacteria 1670
4 JGI24737J22298_10029164 3300001990 Bacteria 1731
5 JGI24737J22298_10063661 3300001990 Bacteria 1107
6 JGI24743J22301_10001791 3300001991 Bacteria 3087
7 JGI24743J22301_10002734 3300001991 Bacteria 2703
8 JGI24743J22301_10011429 3300001991 Bacteria 1599
9 JGI24735J21928_10141440 3300002067 Bacteria 694
10 JGI24750J21931_1007375 3300002070 Bacteria 1384
11 JGI24750J21931_1036327 3300002070 Bacteria 737
12 JGI24745J21846_1001348 3300002073 Bacteria 2371
13 JGI24745J21846_1010092 3300002073 Bacteria 1073
14 JGI24748J21848_1031970 3300002074 Bacteria 652
15 JGI24744J21845_10015734 3300002077 Bacteria 1509
16 JGI24034J26672_10057437 3300002239 Bacteria 678
17 rootH2_10034644 3300003320 Bacteria 1058
18 Ga0055540_1007887 3300003792 Bacteria 3932
19 Ga0055540_1011575 3300003792 Bacteria 2832
20 Ga0070658_11337055 3300005327 Bacteria 622
21 Ga0070676_10015143 3300005328 Bacteria 4252
22 Ga0070690_100059616 3300005330 Bacteria 2454
23 Ga0070690_100303148 3300005330 Bacteria 1146
24 Ga0070690_101628578 3300005330 Bacteria 524
25 Ga0070670_100090428 3300005331 Bacteria 2631
26 Ga0068869_100008057 3300005334 Bacteria 6770
27 Ga0068869_100021907 3300005334 Bacteria 4398
28 Ga0070682_100012102 3300005337 Bacteria 4938
29 Ga0070682_100267766 3300005337 Bacteria 1240
30 Ga0068868_100079872 3300005338 Bacteria 2620
31 Ga0068868_102108931 3300005338 Bacteria 536
32 Ga0070660_100238175 3300005339 Bacteria 1482
33 Ga0070689_100095533 3300005340 Bacteria 2348
34 Ga0070691_10035636 3300005341 Bacteria 2343
35 Ga0070692_10078416 3300005345 Bacteria 1774
36 Ga0070692_10107574 3300005345 Bacteria 1538
37 Ga0070668_100324173 3300005347 Bacteria 1298
38 Ga0070668_100656973 3300005347 Bacteria 922
39 Ga0070668_100747153 3300005347 Bacteria 866
40 Ga0070669_100038971 3300005353 Bacteria 3451
41 Ga0070669_100237998 3300005353 Bacteria 1445
42 Ga0070669_101272459 3300005353 Bacteria 636
43 Ga0070675_100625215 3300005354 Bacteria 978
44 Ga0070671_100000857 3300005355 Bacteria 22171
45 Ga0070671_100141076 3300005355 Bacteria 2033
46 Ga0070671_100436034 3300005355 Bacteria 1123
47 Ga0070674_100122704 3300005356 Bacteria 1925
48 Ga0070674_100141080 3300005356 Bacteria 1808
49 Ga0070674_100874008 3300005356 Bacteria 781
50 Ga0070673_100038612 3300005364 Bacteria 3647
51 Ga0070688_100008672 3300005365 Bacteria 5532
52 Ga0070688_100287600 3300005365 Bacteria 1183
53 Ga0070659_100046646 3300005366 Bacteria 3396
54 Ga0070659_101013032 3300005366 Bacteria 729
55 Ga0070667_100014633 3300005367 Bacteria 6483
56 Ga0070667_100024791 3300005367 Bacteria 4983
57 Ga0070667_100046868 3300005367 Bacteria 3636
58 Ga0070667_100172254 3300005367 Bacteria 1911
59 Ga0070703_10044398 3300005406 Bacteria 1397
60 Ga0070709_10020853 3300005434 Bacteria 3812
61 Ga0070709_10044036 3300005434 Bacteria 2763
62 Ga0070709_11372007 3300005434 Bacteria 572
63 Ga0070714_100204251 3300005435 Bacteria 1809
64 Ga0070714_100868644 3300005435 Bacteria 875
65 Ga0070710_10025085 3300005437 Bacteria 3153
66 Ga0070710_10255745 3300005437 Bacteria 1127
67 Ga0070701_10006664 3300005438 Bacteria 4877
68 Ga0070701_10402488 3300005438 Bacteria 868
69 Ga0070711_100009282 3300005439 Bacteria 6050
70 Ga0070711_100045137 3300005439 Bacteria 2995
71 Ga0070711_101211743 3300005439 Bacteria 653
72 Ga0070705_100008684 3300005440 Bacteria 5033
73 Ga0070705_100034476 3300005440 Bacteria 2830
74 Ga0070705_100502240 3300005440 Bacteria 921
75 Ga0070700_100012377 3300005441 Bacteria 4757
76 Ga0070700_100158511 3300005441 Bacteria 1555
77 Ga0070694_100414025 3300005444 Bacteria 1058
78 Ga0070694_101113937 3300005444 Bacteria 659
79 Ga0070694_101527304 3300005444 Bacteria 566
80 Ga0070708_100691813 3300005445 Bacteria 960
81 Ga0070708_100772925 3300005445 Bacteria 903
82 Ga0070663_100108732 3300005455 Bacteria 2080
83 Ga0070663_100124028 3300005455 Bacteria 1954
84 Ga0070663_100526198 3300005455 Bacteria 985
85 Ga0070663_100734306 3300005455 Bacteria 842
86 Ga0070663_101126384 3300005455 Bacteria 687
87 Ga0070678_100143543 3300005456 Bacteria 1913
88 Ga0070678_100538377 3300005456 Bacteria 1035
89 Ga0070678_100756139 3300005456 Bacteria 879
90 Ga0070678_101272135 3300005456 Bacteria 684
91 Ga0070662_100016536 3300005457 Bacteria 4955
92 Ga0068867_100056119 3300005459 Bacteria 2913
93 Ga0068867_100278860 3300005459 Bacteria 1370
94 Ga0068867_100375852 3300005459 Bacteria 1192
95 Ga0070685_10018635 3300005466 Bacteria 3736
96 Ga0070685_10160402 3300005466 Bacteria 1433
97 Ga0070685_10446867 3300005466 Bacteria 905
98 Ga0070706_100989546 3300005467 Bacteria 776
99 Ga0070684_100645324 3300005535 Bacteria 985
100 Ga0070697_100183356 3300005536 Bacteria 1775
101 Ga0068853_100011121 3300005539 Bacteria 7301
102 Ga0068853_100035712 3300005539 Bacteria 4223
103 Ga0068853_100952425 3300005539 Bacteria 825
104 Ga0070672_100113767 3300005543 Bacteria 2209
105 Ga0070672_100197703 3300005543 Bacteria 1680
106 Ga0070672_101016539 3300005543 Bacteria 735
107 Ga0070686_100139150 3300005544 Bacteria 1688
108 Ga0070686_100354286 3300005544 Bacteria 1104
109 Ga0070695_100064159 3300005545 Bacteria 2389
110 Ga0070695_100344571 3300005545 Bacteria 1114
111 Ga0070696_100045285 3300005546 Bacteria 3048
112 Ga0070696_100151457 3300005546 Bacteria 1703
113 Ga0070693_100061425 3300005547 Bacteria 2184
114 Ga0070693_100271288 3300005547 Bacteria 1133
115 Ga0070665_100016906 3300005548 Bacteria 7314
116 Ga0070665_100021400 3300005548 Bacteria 6505
117 Ga0070665_100031399 3300005548 Bacteria 5348
118 Ga0070665_100654064 3300005548 Bacteria 1064
119 Ga0070665_101003272 3300005548 Bacteria 847
120 Ga0070665_102330529 3300005548 Bacteria 538
121 Ga0070704_100005943 3300005549 Bacteria 7152
122 Ga0068855_100194985 3300005563 Bacteria 2282
123 Ga0068855_100604067 3300005563 Bacteria 1183
124 Ga0068854_100040527 3300005578 Bacteria 3286
125 Ga0068854_100491939 3300005578 Bacteria 1031
126 Ga0068856_100067702 3300005614 Bacteria 3529
127 Ga0068856_100414663 3300005614 Bacteria 1367
128 Ga0070702_100003765 3300005615 Bacteria 6845
129 Ga0070702_100056656 3300005615 Bacteria 2264
130 Ga0070702_101140048 3300005615 Bacteria 625
131 Ga0070702_101166469 3300005615 Bacteria 619
132 Ga0068852_100067766 3300005616 Bacteria 3121
133 Ga0068852_100182432 3300005616 Bacteria 1975
134 Ga0068852_100405373 3300005616 Bacteria 1342
135 Ga0068859_100022466 3300005617 Bacteria 6325
136 Ga0068859_100668204 3300005617 Bacteria 1130
137 Ga0068859_101527603 3300005617 Bacteria 737
138 Ga0068859_103005510 3300005617 Bacteria 515
139 Ga0068864_100028130 3300005618 Bacteria 4751
140 Ga0068864_100612579 3300005618 Bacteria 1057
141 Ga0068866_10007981 3300005718 Bacteria 4445
142 Ga0068861_100006167 3300005719 Bacteria 8157
143 Ga0068861_100040051 3300005719 Bacteria 3501
144 Ga0068861_100150036 3300005719 Bacteria 1912
145 Ga0068861_100325032 3300005719 Bacteria 1341
146 Ga0068861_101269883 3300005719 Bacteria 715
147 Ga0068851_10131088 3300005834 Bacteria 1356
148 Ga0068870_10081998 3300005840 Bacteria 1785
149 Ga0068870_11454442 3300005840 Bacteria 503
150 Ga0068863_100005929 3300005841 Bacteria 11985
151 Ga0068863_100173939 3300005841 Bacteria 2066
152 Ga0068863_100300342 3300005841 Bacteria 1557
153 Ga0068863_100558697 3300005841 Bacteria 1130
154 Ga0068858_100013663 3300005842 Bacteria 7663
155 Ga0068858_100456722 3300005842 Bacteria 1231
156 Ga0068858_101198998 3300005842 Bacteria 746
157 Ga0068858_101487028 3300005842 Bacteria 668
158 Ga0068858_101557677 3300005842 Bacteria 652
159 Ga0068860_100108853 3300005843 Bacteria 2648
160 Ga0068860_100204393 3300005843 Bacteria 1915
161 Ga0068860_100237707 3300005843 Bacteria 1771
162 Ga0068860_100728776 3300005843 Bacteria 1002
163 Ga0068862_100081840 3300005844 Bacteria 2801
164 Ga0068862_100219149 3300005844 Bacteria 1722
165 Ga0068862_100230913 3300005844 Bacteria 1678
166 Ga0068862_101025704 3300005844 Bacteria 817
167 Ga0081455_10034648 3300005937 Bacteria 4521
168 Ga0081455_10342537 3300005937 Bacteria 1057
169 Ga0075365_10002877 3300006038 Bacteria 8663
170 Ga0075365_10010694 3300006038 Bacteria 5359
171 Ga0075365_10710686 3300006038 Bacteria 710
172 Ga0075368_10106891 3300006042 Bacteria 1152
173 Ga0075363_100003870 3300006048 Bacteria 6457
174 Ga0075363_100140754 3300006048 Bacteria 1358
175 Ga0075363_100454852 3300006048 Bacteria 757
176 Ga0075364_10002232 3300006051 Bacteria 10864
177 Ga0075364_10017167 3300006051 Bacteria 4517
178 Ga0075364_10069743 3300006051 Bacteria 2313
179 Ga0075364_10071145 3300006051 Bacteria 2291
180 Ga0075364_10523376 3300006051 Bacteria 811
181 Ga0075364_10811186 3300006051 Bacteria 638
182 Ga0075364_11173153 3300006051 Bacteria 521
183 Ga0070715_10011748 3300006163 Bacteria 3162
184 Ga0070716_100004343 3300006173 Bacteria 6764
185 Ga0070716_100080091 3300006173 Bacteria 1947
186 Ga0070716_100725336 3300006173 Bacteria 762
187 Ga0070716_101484731 3300006173 Bacteria 554
188 Ga0070712_100014032 3300006175 Bacteria 5135
189 Ga0070712_100036147 3300006175 Bacteria 3358
190 Ga0075362_10010772 3300006177 Bacteria 3581
191 Ga0075362_10043625 3300006177 Bacteria 1986
192 Ga0075362_10192077 3300006177 Bacteria 992
193 Ga0075362_10303719 3300006177 Bacteria 792
194 Ga0075367_10001961 3300006178 Bacteria 9153
195 Ga0075367_10471429 3300006178 Bacteria 796
196 Ga0075369_10000801 3300006186 Bacteria 10310
197 Ga0075369_10003710 3300006186 Bacteria 5583
198 Ga0075369_10004851 3300006186 Bacteria 5003
199 Ga0075369_10017113 3300006186 Bacteria 2933
200 Ga0075369_10061230 3300006186 Bacteria 1643
201 Ga0075369_10070805 3300006186 Bacteria 1534
202 Ga0075369_10106036 3300006186 Bacteria 1264
203 Ga0075369_10107221 3300006186 Bacteria 1257
204 Ga0075369_10157820 3300006186 Bacteria 1039
205 Ga0075369_10159680 3300006186 Bacteria 1033
206 Ga0075369_10341956 3300006186 Bacteria 701
207 Ga0075369_10413936 3300006186 Bacteria 636
208 Ga0075366_10087610 3300006195 Bacteria 1864
209 Ga0075366_11003370 3300006195 Bacteria 521
210 Ga0097621_100086416 3300006237 Bacteria 2617
211 Ga0097621_100137376 3300006237 Bacteria 2086
212 Ga0075370_10013411 3300006353 Bacteria 4355
213 Ga0075370_10022413 3300006353 Bacteria 3468
214 Ga0075370_10042506 3300006353 Bacteria 2568
215 Ga0075370_10054036 3300006353 Bacteria 2280
216 Ga0075370_10588892 3300006353 Bacteria 674
217 Ga0068871_100053608 3300006358 Bacteria 3269
218 Ga0068871_100158450 3300006358 Bacteria 1934
219 Ga0075430_100004258 3300006846 Bacteria 12089
220 Ga0075431_100036015 3300006847 Bacteria 5097
221 Ga0075433_10848879 3300006852 Bacteria 797
222 Ga0068865_100067444 3300006881 Bacteria 2527
223 Ga0068865_100100518 3300006881 Bacteria 2116
224 Ga0068865_100103728 3300006881 Bacteria 2086
225 Ga0068865_100924054 3300006881 Bacteria 760
226 Ga0097620_100022468 3300006931 Bacteria 6325
227 Ga0097620_100668176 3300006931 Bacteria 1130
228 Ga0097620_101527560 3300006931 Bacteria 737
229 Ga0097620_103003244 3300006931 Bacteria 515
230 Ga0105250_10071661 3300009092 Bacteria 1400
231 Ga0105250_10216707 3300009092 Bacteria 811
232 Ga0105240_10596107 3300009093 Bacteria 1217
233 Ga0111539_10347611 3300009094 Bacteria 1726
234 Ga0105245_10080640 3300009098 Bacteria 2973
235 Ga0105245_10475146 3300009098 Bacteria 1262
236 Ga0105245_11511294 3300009098 Bacteria 722
237 Ga0105245_11551992 3300009098 Bacteria 713
238 Ga0105247_10007780 3300009101 Bacteria 6556
239 Ga0105247_10023605 3300009101 Bacteria 3706
240 Ga0105247_10416842 3300009101 Bacteria 960
241 Ga0114129_10002202 3300009147 Bacteria 26854
242 Ga0105243_10042382 3300009148 Bacteria 3563
243 Ga0105243_10051033 3300009148 Bacteria 3270
244 Ga0105243_11277545 3300009148 Bacteria 750
245 Ga0105241_11512507 3300009174 Bacteria 646
246 Ga0105242_10386822 3300009176 Bacteria 1302
247 Ga0105242_10576480 3300009176 Bacteria 1083
248 Ga0105248_10094559 3300009177 Bacteria 3365
249 Ga0105248_10230982 3300009177 Bacteria 2083
250 Ga0105248_10429279 3300009177 Bacteria 1488
251 Ga0105248_10801240 3300009177 Bacteria 1063
252 Ga0105237_10004358 3300009545 Bacteria 16404
253 Ga0105237_10089465 3300009545 Bacteria 3068
254 Ga0105237_10181117 3300009545 Bacteria 2107
255 Ga0105238_10156407 3300009551 Bacteria 2255
256 Ga0105238_10360030 3300009551 Bacteria 1444
257 Ga0105238_10493373 3300009551 Bacteria 1225
258 Ga0105249_10007627 3300009553 Bacteria 9439
259 Ga0105249_10327740 3300009553 Bacteria 1544
260 Ga0105249_10700148 3300009553 Bacteria 1073
261 Ga0105249_12448528 3300009553 Bacteria 594
262 Ga0105239_10004760 3300010375 Bacteria 16109
263 Ga0105239_10033724 3300010375 Bacteria 5621
264 Ga0105239_10167192 3300010375 Bacteria 2459
265 Ga0105239_11444143 3300010375 Bacteria 794
266 Ga0105246_10019015 3300011119 Bacteria 4382
267 Ga0105246_10216940 3300011119 Bacteria 1497
268 Ga0105246_10354401 3300011119 Bacteria 1203
269 Ga0105246_11772565 3300011119 Bacteria 589
270 Ga0157373_10316988 3300013100 Bacteria 1109
271 Ga0157370_11209071 3300013104 Bacteria 682
272 Ga0157374_10008988 3300013296 Bacteria 8567
273 Ga0157378_10001889 3300013297 Bacteria 18796
274 Ga0157378_10013540 3300013297 Bacteria 7134
275 Ga0157378_10239805 3300013297 Bacteria 1731
276 Ga0163162_10345240 3300013306 Bacteria 1621
277 Ga0163162_10704726 3300013306 Bacteria 1131
278 Ga0163162_12869155 3300013306 Bacteria 555
279 Ga0157372_10034051 3300013307 Bacteria 5597
280 Ga0157372_10048715 3300013307 Bacteria 4710
281 Ga0157375_10026596 3300013308 Bacteria 5396
282 Ga0157375_10230852 3300013308 Bacteria 2009
283 Ga0163163_10078441 3300014325 Bacteria 3299
284 Ga0163163_10291943 3300014325 Bacteria 1683
285 Ga0163163_11219562 3300014325 Bacteria 815
286 Ga0163163_11383120 3300014325 Bacteria 765
287 Ga0157380_10156676 3300014326 Bacteria 1975
288 Ga0157380_10181210 3300014326 Bacteria 1851
289 Ga0157377_10007569 3300014745 Bacteria 5253
290 Ga0157377_10028023 3300014745 Bacteria 3029
291 Ga0157377_10043487 3300014745 Bacteria 2500
292 Ga0157379_10005060 3300014968 Bacteria 11303
293 Ga0157379_10188698 3300014968 Bacteria 1863
294 Ga0157376_10124505 3300014969 Bacteria 2290
295 Ga0157376_10424581 3300014969 Bacteria 1291
296 Ga0163161_10060621 3300017792 Bacteria 2754
297 Ga0163161_10118740 3300017792 Bacteria 1985
298 Ga0163161_10417287 3300017792 Bacteria 1079
299 Ga0163161_10424957 3300017792 Bacteria 1070
300 Ga0213876_10008455 3300021384 Bacteria 5572
301 Ga0213876_10116274 3300021384 Bacteria 1419
302 Ga0209673_1003416 3300025273 Bacteria 9404
303 Ga0209051_1000582 3300025303 Bacteria 43455
304 Ga0209051_1007231 3300025303 Bacteria 6105
305 Ga0209051_1009421 3300025303 Bacteria 5038
306 Ga0209051_1066940 3300025303 Bacteria 1101
307 Ga0207653_10021277 3300025885 Bacteria 2057
308 Ga0207692_10056043 3300025898 Bacteria 2020
309 Ga0207692_10106246 3300025898 Bacteria 1550
310 Ga0207710_10319674 3300025900 Bacteria 787
311 Ga0207688_10000065 3300025901 Bacteria 38587
312 Ga0207688_10020310 3300025901 Bacteria 3626
313 Ga0207688_10049235 3300025901 Bacteria 2355
314 Ga0207647_10033458 3300025904 Bacteria 3292
315 Ga0207685_10005908 3300025905 Bacteria 3282
316 Ga0207685_10304202 3300025905 Bacteria 790
317 Ga0207699_10747600 3300025906 Bacteria 717
318 Ga0207645_10261169 3300025907 Bacteria 1147
319 Ga0207643_10028172 3300025908 Bacteria 3118
320 Ga0207705_11333251 3300025909 Bacteria 547
321 Ga0207654_10495909 3300025911 Bacteria 862
322 Ga0207671_10078683 3300025914 Bacteria 2470
323 Ga0207671_10158046 3300025914 Bacteria 1754
324 Ga0207671_11254625 3300025914 Bacteria 578
325 Ga0207693_10001726 3300025915 Bacteria 19214
326 Ga0207693_10023850 3300025915 Bacteria 4856
327 Ga0207663_10036882 3300025916 Bacteria 2943
328 Ga0207663_10184051 3300025916 Bacteria 1494
329 Ga0207657_10087486 3300025919 Bacteria 2606
330 Ga0207657_10611390 3300025919 Bacteria 850
331 Ga0207681_10100487 3300025923 Bacteria 2085
332 Ga0207681_10166464 3300025923 Bacteria 1667
333 Ga0207681_11755124 3300025923 Bacteria 518
334 Ga0207694_10101524 3300025924 Bacteria 2280
335 Ga0207694_10260973 3300025924 Bacteria 1419
336 Ga0207694_11168984 3300025924 Bacteria 651
337 Ga0207650_10049033 3300025925 Bacteria 3117
338 Ga0207687_10867540 3300025927 Bacteria 772
339 Ga0207700_10814887 3300025928 Bacteria 835
340 Ga0207664_10619014 3300025929 Bacteria 973
341 Ga0207644_10003277 3300025931 Bacteria 10461
342 Ga0207644_10109818 3300025931 Bacteria 2084
343 Ga0207644_10262597 3300025931 Bacteria 1381
344 Ga0207644_10375984 3300025931 Bacteria 1158
345 Ga0207690_10833293 3300025932 Bacteria 763
346 Ga0207706_10011834 3300025933 Bacteria 7945
347 Ga0207706_10036470 3300025933 Bacteria 4367
348 Ga0207686_10364792 3300025934 Bacteria 1091
349 Ga0207686_10401446 3300025934 Bacteria 1044
350 Ga0207686_10715430 3300025934 Bacteria 797
351 Ga0207709_10307012 3300025935 Bacteria 1182
352 Ga0207670_10191100 3300025936 Bacteria 1549
353 Ga0207670_11511669 3300025936 Bacteria 571
354 Ga0207670_11715189 3300025936 Bacteria 534
355 Ga0207669_10311715 3300025937 Bacteria 1200
356 Ga0207669_11628184 3300025937 Bacteria 551
357 Ga0207704_10088130 3300025938 Bacteria 2029
358 Ga0207704_10205845 3300025938 Bacteria 1444
359 Ga0207665_10004137 3300025939 Bacteria 9666
360 Ga0207665_10009561 3300025939 Bacteria 6368
361 Ga0207665_11273491 3300025939 Bacteria 586
362 Ga0207691_10033722 3300025940 Bacteria 4766
363 Ga0207691_10044140 3300025940 Bacteria 4105
364 Ga0207691_10517640 3300025940 Bacteria 1012
365 Ga0207711_10148383 3300025941 Bacteria 2114
366 Ga0207711_10685548 3300025941 Bacteria 956
367 Ga0207711_10924382 3300025941 Bacteria 811
368 Ga0207711_11605567 3300025941 Bacteria 594
369 Ga0207689_10009506 3300025942 Bacteria 8394
370 Ga0207689_10013320 3300025942 Bacteria 7016
371 Ga0207667_10107828 3300025949 Bacteria 2874
372 Ga0207667_10448321 3300025949 Bacteria 1311
373 Ga0207712_10525710 3300025961 Bacteria 1014
374 Ga0207712_10907934 3300025961 Bacteria 779
375 Ga0207668_10322500 3300025972 Bacteria 1282
376 Ga0207668_10534520 3300025972 Bacteria 1013
377 Ga0207668_11999033 3300025972 Bacteria 522
378 Ga0207640_10050976 3300025981 Bacteria 2688
379 Ga0207658_10007890 3300025986 Bacteria 7250
380 Ga0207658_10106296 3300025986 Bacteria 2209
381 Ga0207658_10183170 3300025986 Bacteria 1735
382 Ga0207658_10185707 3300025986 Bacteria 1724
383 Ga0207677_10065309 3300026023 Bacteria 2538
384 Ga0207677_10130254 3300026023 Bacteria 1909
385 Ga0207677_10146556 3300026023 Bacteria 1815
386 Ga0207703_10238958 3300026035 Bacteria 1632
387 Ga0207703_10456380 3300026035 Bacteria 1194
388 Ga0207703_11054861 3300026035 Bacteria 780
389 Ga0207639_10127105 3300026041 Bacteria 2104
390 Ga0207678_10027949 3300026067 Bacteria 4925
391 Ga0207678_10030159 3300026067 Bacteria 4734
392 Ga0207678_10435338 3300026067 Bacteria 1138
393 Ga0207678_10654059 3300026067 Bacteria 923
394 Ga0207678_11154605 3300026067 Bacteria 686
395 Ga0207708_10001834 3300026075 Bacteria 15673
396 Ga0207708_10036418 3300026075 Bacteria 3746
397 Ga0207702_10368087 3300026078 Bacteria 1379
398 Ga0207702_11872890 3300026078 Bacteria 591
399 Ga0207641_10017084 3300026088 Bacteria 5936
400 Ga0207641_10364065 3300026088 Bacteria 1381
401 Ga0207641_10484525 3300026088 Bacteria 1199
402 Ga0207641_10535798 3300026088 Bacteria 1140
403 Ga0207641_10795337 3300026088 Bacteria 935
404 Ga0207648_10075782 3300026089 Bacteria 2932
405 Ga0207648_10082205 3300026089 Bacteria 2809
406 Ga0207648_10538071 3300026089 Bacteria 1072
407 Ga0207676_10055132 3300026095 Bacteria 3119
408 Ga0207676_11231628 3300026095 Bacteria 742
409 Ga0207675_100007395 3300026118 Bacteria 10379
410 Ga0207675_100024109 3300026118 Bacteria 5657
411 Ga0207675_100077852 3300026118 Bacteria 3107
412 Ga0207675_100400880 3300026118 Bacteria 1352
413 Ga0207675_100928953 3300026118 Bacteria 887
414 Ga0207683_10007249 3300026121 Bacteria 9503
415 Ga0207683_10061095 3300026121 Bacteria 3315
416 Ga0207698_10093348 3300026142 Bacteria 2470
417 Ga0207698_10331232 3300026142 Bacteria 1430
418 Ga0207698_12427571 3300026142 Bacteria 535
419 Ga0209813_10037898 3300027866 Bacteria 1454
420 Ga0268266_10003919 3300028379 Bacteria 14469
421 Ga0268266_10025990 3300028379 Bacteria 4980
422 Ga0268266_10120380 3300028379 Bacteria 2335
423 Ga0268266_10779366 3300028379 Bacteria 923
424 Ga0268266_10784606 3300028379 Bacteria 920
425 Ga0268265_10065964 3300028380 Bacteria 2796
426 Ga0268265_10573526 3300028380 Bacteria 1074
427 Ga0268265_10730222 3300028380 Bacteria 959
428 Ga0268265_10770872 3300028380 Bacteria 935
429 Ga0268264_10069268 3300028381 Bacteria 2983
430 Ga0268264_10390284 3300028381 Bacteria 1335
431 Ga0268264_10534760 3300028381 Bacteria 1148
432 Ga0268264_11033272 3300028381 Bacteria 829
433 Ga0307405_10240049 3300031731 Bacteria 1342
434 Ga0307405_11091281 3300031731 Bacteria 685
435 Ga0307413_10238879 3300031824 Bacteria 1340
436 Ga0307410_10304982 3300031852 Bacteria 1258
437 Ga0307406_10021356 3300031901 Bacteria 3828
438 Ga0307412_10103862 3300031911 Bacteria 2015
439 Ga0307409_100203150 3300031995 Bacteria 1775
440 Ga0307409_100353045 3300031995 Bacteria 1388
441 Ga0307416_100756001 3300032002 Bacteria 1065
442 Ga0307416_100918919 3300032002 Bacteria 976
443 Ga0307416_103461341 3300032002 Bacteria 528
444 Ga0307414_11137313 3300032004 Bacteria 722
445 Ga0307411_10179669 3300032005 Bacteria 1605
446 Ga0373959_0073846 3300034820 Bacteria 775
447 Ga0373928_0174053 3300035084 Bacteria 608
448 Ga0373960_0062491 3300035121 Bacteria 1133
449 Ga0373942_0087120 3300035207 Bacteria 936
450 Ga0373942_0113639 3300035207 Bacteria 840
451 Ga0373961_0208109 3300035241 Bacteria 693
452 Ga0373961_0427135 3300035241 Bacteria 513
453 Ga0373962_0130260 3300035242 Bacteria 809
454 Ga0373931_0014323 3300035691 Bacteria 3873
455 Ga0373931_0025634 3300035691 Bacteria 2995
456 Ga0373947_0308302 3300035725 Bacteria 1057
457 Ga0316582_0148261 3300036647 Bacteria 1585
458 Ga0316584_0014880 3300036712 Bacteria 5557
459 Ga0436364_1504233 3300037853 Bacteria 926
460 Ga0436365_0772403 3300039437 Bacteria 19656
461 Ga0436365_0987088 3300039437 Bacteria 25400
462 Ga0436360_0360375 3300039438 Bacteria 554
463 Ga0436361_0536289 3300039447 Bacteria 545
464 Ga0436361_0556079 3300039447 Bacteria 1466
465 Ga0439461_0000589 3300041410 Bacteria 5260
466 Ga0439461_0045365 3300041410 Bacteria 961
467 Ga0439466_0001299 3300041411 Bacteria 9723
468 Ga0439466_0021836 3300041411 Bacteria 2264
469 Ga0439466_0030016 3300041411 Bacteria 1867
470 Ga0439465_0009519 3300041413 Bacteria 3060
471 Ga0439465_0017121 3300041413 Bacteria 2261
472 Ga0439465_0261742 3300041413 Bacteria 641
473 Ga0451787_497249 3300041441 Bacteria 532
474 Ga0451800_1001123 3300041459 Bacteria 950
475 Ga0439431_0000730 3300041997 Bacteria 7093
476 Ga0439431_0068457 3300041997 Bacteria 943
477 Ga0439442_010560 3300042002 Bacteria 1874
478 Ga0439443_118577 3300042003 Bacteria 518
479 Ga0439445_0000885 3300042004 Bacteria 6348
480 Ga0439445_0011393 3300042004 Bacteria 2120
481 Ga0439445_0099403 3300042004 Bacteria 824
482 Ga0439434_0104929 3300042435 Bacteria 912
483 Ga0439459_0027248 3300042438 Bacteria 1140
484 Ga0466972_0023450 3300044658 Bacteria 3069
485 Ga0466965_0039330 3300044683 Bacteria 2325
486 Ga0466965_0602232 3300044683 Bacteria 624
487 Ga0466963_0658703 3300044694 Bacteria 739
488 Ga0466971_0102777 3300044719 Bacteria 1314
489 Ga0466968_0344276 3300044735 Bacteria 723
490 Ga0466970_0403929 3300044765 Bacteria 780
491 Ga0466957_0198387 3300044842 Bacteria 1317
492 Ga0466960_0044826 3300044901 Bacteria 2110
493 Ga0466960_0111425 3300044901 Bacteria 1422
494 Ga0466958_0161012 3300045836 Bacteria 1418
495 Ga0466967_0490931 3300045976 Bacteria 1204
496 Ga0495596_0251562 3300046500 Bacteria 686
497 Ga0495606_0177833 3300046507 Bacteria 1229
498 Ga0495620_0246934 3300046515 Bacteria 681
499 Ga0495620_0291617 3300046515 Bacteria 620
500 Ga0495648_0006972 3300046524 Bacteria 9113
501 Ga0495642_0126622 3300046528 Bacteria 1098
502 Ga0495654_0051006 3300046530 Bacteria 2020
503 Ga0495654_0398672 3300046530 Bacteria 547
504 Ga0495668_0170228 3300046616 Bacteria 1193
505 Ga0495668_0469349 3300046616 Bacteria 693
506 Ga0495611_0049495 3300046648 Bacteria 1891
507 Ga0495625_0091922 3300046660 Bacteria 2097
508 Ga0495671_0072724 3300046692 Bacteria 1688
509 Ga0495649_0062837 3300046694 Bacteria 1996
510 Ga0495589_0330460 3300046794 Bacteria 704
511 Ga0495672_0002254 3300047320 Bacteria 17944
512 Ga0495672_0137051 3300047320 Bacteria 1282
513 Ga0495672_0492561 3300047320 Bacteria 546
514 Ga0495683_0132612 3300047323 Bacteria 1173
515 Ga0495673_0004032 3300047469 Bacteria 9362
516 Ga0495686_0002796 3300047472 Bacteria 15844
517 Ga0496100_0001679 3300048903 Bacteria 10991
518 Ga0496100_0053048 3300048903 Bacteria 2639
519 Ga0496100_0087183 3300048903 Bacteria 2122
520 Ga0496100_0099173 3300048903 Bacteria 2004
521 Ga0496100_0707139 3300048903 Bacteria 787
522 Ga0496101_0000126 3300048904 Bacteria 74316
523 Ga0496101_0028338 3300048904 Bacteria 3909
524 Ga0496101_0097653 3300048904 Bacteria 2194
525 Ga0496101_0273259 3300048904 Bacteria 1320
526 Ga0496102_0000006 3300048905 Bacteria 471494
527 Ga0496102_0030442 3300048905 Bacteria 4831
528 Ga0496102_0077646 3300048905 Bacteria 3056
529 Ga0496102_0114555 3300048905 Bacteria 2515
530 Ga0496102_0120605 3300048905 Bacteria 2449
531 Ga0496102_0185379 3300048905 Bacteria 1961
532 Ga0496102_0321969 3300048905 Bacteria 1457
533 Ga0496102_0988609 3300048905 Bacteria 762
534 Ga0496103_0000006 3300048906 Bacteria 470539
535 Ga0496103_0058033 3300048906 Bacteria 2404
536 Ga0496103_0416543 3300048906 Bacteria 862
537 Ga0496104_0021922 3300048907 Bacteria 5867
538 Ga0496104_0025837 3300048907 Bacteria 5416
539 Ga0496104_0147687 3300048907 Bacteria 2258
540 Ga0496104_0570284 3300048907 Bacteria 1042
541 Ga0496104_0759638 3300048907 Bacteria 876
542 Ga0496104_1606150 3300048907 Bacteria 553
543 Ga0496104_1726964 3300048907 Bacteria 528
544 Ga0496105_0047082 3300048908 Bacteria 3559
545 Ga0496105_0074997 3300048908 Bacteria 2794
546 Ga0496105_0395334 3300048908 Bacteria 1098
547 Ga0496105_0704217 3300048908 Bacteria 775
548 Ga0496106_0024628 3300048909 Bacteria 4475
549 Ga0496106_0040391 3300048909 Bacteria 3494
550 Ga0496106_0065440 3300048909 Bacteria 2767
551 Ga0496106_0087670 3300048909 Bacteria 2398
552 Ga0496106_0820230 3300048909 Bacteria 737
553 Ga0496107_0043581 3300048910 Bacteria 3224
554 Ga0496107_0097513 3300048910 Bacteria 2152
555 Ga0496107_0129132 3300048910 Bacteria 1865
556 Ga0496107_0913937 3300048910 Bacteria 639
557 Ga0496108_0001533 3300048911 Bacteria 18288
558 Ga0496108_0008920 3300048911 Bacteria 8126
559 Ga0496108_0023809 3300048911 Bacteria 5039
560 Ga0496108_0102183 3300048911 Bacteria 2446
561 Ga0496108_0158829 3300048911 Bacteria 1953
562 Ga0496108_0178767 3300048911 Bacteria 1837
563 Ga0496108_0185297 3300048911 Bacteria 1803
564 Ga0496108_0203177 3300048911 Bacteria 1720
565 Ga0496109_0014683 3300048912 Bacteria 6816
566 Ga0496109_0039360 3300048912 Bacteria 4278
567 Ga0496109_0045533 3300048912 Bacteria 3982
568 Ga0496109_0058592 3300048912 Bacteria 3518
569 Ga0496109_0289918 3300048912 Bacteria 1543
570 Ga0496109_1762432 3300048912 Bacteria 553
571 Ga0496110_0022181 3300048913 Bacteria 5388
572 Ga0496110_0026881 3300048913 Bacteria 4928
573 Ga0496110_0036193 3300048913 Bacteria 4286
574 Ga0496110_0103220 3300048913 Bacteria 2557
575 Ga0496110_0324902 3300048913 Bacteria 1401
576 Ga0496110_0837232 3300048913 Bacteria 825
577 Ga0496110_1568987 3300048913 Bacteria 568
578 Ga0496111_0071549 3300048914 Bacteria 2524
579 Ga0496111_0334569 3300048914 Bacteria 1121
580 Ga0496112_0006014 3300048915 Bacteria 10591
581 Ga0496112_0071297 3300048915 Bacteria 3434
582 Ga0496112_0085169 3300048915 Bacteria 3127
583 Ga0496112_0612864 3300048915 Bacteria 1020
584 Ga0496113_0014039 3300048916 Bacteria 5450
585 Ga0496113_0372301 3300048916 Bacteria 1146
586 Ga0496114_0024804 3300048917 Bacteria 4896
587 Ga0496114_0050905 3300048917 Bacteria 3448
588 Ga0496114_0487927 3300048917 Bacteria 1090
589 Ga0496114_0667878 3300048917 Bacteria 913
590 Ga0496115_0211039 3300048918 Bacteria 1604
591 Ga0496115_0268162 3300048918 Bacteria 1403
592 Ga0496115_0337099 3300048918 Bacteria 1231
593 Ga0496115_0572009 3300048918 Bacteria 901
594 Ga0496116_0000025 3300048919 Bacteria 470539
595 Ga0496117_0000006 3300048920 Bacteria 758420
596 Ga0496117_0386464 3300048920 Bacteria 711
597 Ga0496118_0000004 3300048921 Bacteria 758420
598 Ga0496118_0000236 3300048921 Bacteria 97321
599 Ga0496119_0000041 3300048922 Bacteria 203687
600 Ga0496120_0000027 3300048923 Bacteria 231507
601 Ga0496121_0000171 3300048924 Bacteria 144073
602 Ga0496122_0052528 3300048925 Bacteria 3083
603 Ga0496123_0011411 3300048926 Bacteria 7702
604 Ga0496124_0237227 3300048927 Bacteria 1359
605 Ga0496125_0347221 3300048928 Bacteria 888
606 Ga0496126_0008660 3300048929 Bacteria 10932
607 Ga0496126_0018679 3300048929 Bacteria 6860
608 Ga0496126_0073923 3300048929 Bacteria 3028
609 Ga0501083_0338044 3300049744 Bacteria 979
610 Ga0501044_0035107 3300049823 Bacteria 5253
611 nmdc:mga03683_213944_c1 3300050489 Bacteria 887
612 nmdc:mga03683_352098_c1 3300050489 Bacteria 697
613 nmdc:mga03n38_135766_c1 3300050490 Bacteria 1224
614 nmdc:mga03n38_141882_c1 3300050490 Bacteria 1200
615 nmdc:mga03n38_292309_c1 3300050490 Bacteria 873
616 nmdc:mga03n38_3990_c1 3300050490 Bacteria 4820
617 nmdc:mga03n38_53521_c1 3300050490 Bacteria 1810
618 nmdc:mga03n38_81663_c1 3300050490 Bacteria 1520
619 nmdc:mga03n38_82101_c1 3300050490 Bacteria 1517
620 nmdc:mga03n38_99478_c1 3300050490 Bacteria 1400
621 nmdc:mga00v17_1106_c1 3300050491 Bacteria 14175
622 nmdc:mga00v17_164356_c1 3300050491 Bacteria 1430
623 nmdc:mga00v17_263606_c1 3300050491 Bacteria 1118
624 nmdc:mga00v17_553010_c1 3300050491 Bacteria 744
625 nmdc:mga00v17_62580_c1 3300050491 Bacteria 2290
626 nmdc:mga00v17_720340_c1 3300050491 Bacteria 639
627 nmdc:mga00v17_874605_c1 3300050491 Bacteria 570
628 nmdc:mga0yw44_1217376_c1 3300050492 Bacteria 508
629 nmdc:mga0yw44_222704_c1 3300050492 Bacteria 1251
630 nmdc:mga0yw44_33606_c1 3300050492 Bacteria 2998
631 nmdc:mga0yw44_506374_c1 3300050492 Bacteria 819
632 nmdc:mga0k408_171095_c1 3300050493 Bacteria 1295
633 nmdc:mga06z11_2710_c1 3300050494 Bacteria 6783
634 nmdc:mga06z11_518120_c1 3300050494 Bacteria 723
635 nmdc:mga04h51_113052_c1 3300050495 Bacteria 1003
636 nmdc:mga07m45_252766_c1 3300050496 Bacteria 1025
637 nmdc:mga07m45_29483_c1 3300050496 Bacteria 3035
638 nmdc:mga07m45_82523_c1 3300050496 Bacteria 1036
639 nmdc:mga05p37_10579_c1 3300050507 Bacteria 10941
640 nmdc:mga0qj67_2784_c1 3300050509 Bacteria 12547
641 nmdc:mga06r32_67807_c1 3300050510 Bacteria 3445
642 nmdc:mga08y16_256741_c1 3300050511 Bacteria 1805
643 nmdc:mga0sz30_242218_c1 3300050516 Bacteria 803
644 nmdc:mga0sz30_3096_c1 3300050516 Bacteria 5962
645 nmdc:mga0sz30_430244_c1 3300050516 Bacteria 592
646 nmdc:mga0sz30_4930_c1 3300050516 Bacteria 4340
647 nmdc:mga0sz30_56529_c1 3300050516 Bacteria 1303
648 Ga0500610_0003136 3300053079 Bacteria 6277
649 Ga0500643_009522 3300053087 Bacteria 3703
650 Ga0500641_0165828 3300053096 Bacteria 952
651 Ga0500556_0022575 3300053104 Bacteria 2045
652 Ga0500556_0387107 3300053104 Bacteria 538
653 Ga0500595_074527 3300053119 Bacteria 1002
654 Ga0500559_0027206 3300053136 Bacteria 2440
655 Ga0500616_0024598 3300053153 Bacteria 3344
656 Ga0500622_0454957 3300053156 Bacteria 509
657 Ga0500627_0021180 3300053158 Bacteria 2620
658 Ga0500627_0250521 3300053158 Bacteria 784
659 Ga0500645_000014 3300053730 Bacteria 151349
660 Ga0500645_098038 3300053730 Bacteria 828
661 Ga0587082_162021 3300059504 Bacteria 537
662 Ga0466962_0004573 3300061719 Bacteria 6642

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2902837492 2902843895 108
2 3300006195 Ga0075366_11003370 Ga0075366_110033702 109
3 iso_pu_bacteria 2643221546 2643752577 109
4 iso_pu_bacteria 2643221715 2644634361 110
5 3300005434 Ga0070709_11372007 Ga0070709_113720071 111
6 3300005444 Ga0070694_101527304 Ga0070694_1015273041 111
7 3300005719 Ga0068861_100150036 Ga0068861_1001500362 111
8 3300005937 Ga0081455_10034648 Ga0081455_100346485 111
9 3300006038 Ga0075365_10002877 Ga0075365_1000287711 111
10 3300006042 Ga0075368_10106891 Ga0075368_101068912 111
11 3300006048 Ga0075363_100003870 Ga0075363_1000038702 111
12 3300006048 Ga0075363_100454852 Ga0075363_1004548522 111
13 3300006051 Ga0075364_10069743 Ga0075364_100697432 111
14 3300006177 Ga0075362_10043625 Ga0075362_100436252 111
15 3300006178 Ga0075367_10001961 Ga0075367_100019612 111
16 3300006186 Ga0075369_10061230 Ga0075369_100612302 111
17 3300006195 Ga0075366_10087610 Ga0075366_100876102 111
18 3300006353 Ga0075370_10022413 Ga0075370_100224132 111
19 3300009098 Ga0105245_11551992 Ga0105245_115519921 111
20 3300013297 Ga0157378_10001889 Ga0157378_1000188911 111
21 3300014745 Ga0157377_10043487 Ga0157377_100434872 111
22 3300026118 Ga0207675_100024109 Ga0207675_1000241092 111
23 3300026142 Ga0207698_12427571 Ga0207698_124275711 111
24 3300027866 Ga0209813_10037898 Ga0209813_100378982 111
25 3300044658 Ga0466972_0023450 Ga0466972_0023450_1575_1910 111
26 3300044735 Ga0466968_0344276 Ga0466968_0344276_212_547 111
27 3300044901 Ga0466960_0044826 Ga0466960_0044826_1212_1547 111
28 3300046694 Ga0495649_0062837 Ga0495649_0062837_637_972 111
29 3300047320 Ga0495672_0137051 Ga0495672_0137051_331_666 111
30 3300047323 Ga0495683_0132612 Ga0495683_0132612_392_727 111
31 3300050493 nmdc:mga0k408_171095_c1 nmdc:mga0k408_171095_c1_935_1270 111
32 iso_pu_bacteria 2902810491 2902816903 111
33 3300003792 Ga0055540_1007887 Ga0055540_10078872 112
34 3300003792 Ga0055540_1011575 Ga0055540_10115752 112
35 3300005435 Ga0070714_100868644 Ga0070714_1008686442 112
36 3300005439 Ga0070711_101211743 Ga0070711_1012117431 112
37 3300005455 Ga0070663_100526198 Ga0070663_1005261982 112
38 3300005539 Ga0068853_100011121 Ga0068853_1000111213 112
39 3300005548 Ga0070665_100654064 Ga0070665_1006540642 112
40 3300005548 Ga0070665_102330529 Ga0070665_1023305291 112
41 3300005616 Ga0068852_100405373 Ga0068852_1004053732 112
42 3300005840 Ga0068870_11454442 Ga0068870_114544421 112
43 3300005842 Ga0068858_101557677 Ga0068858_1015576772 112
44 3300006051 Ga0075364_10523376 Ga0075364_105233762 112
45 3300006051 Ga0075364_11173153 Ga0075364_111731531 112
46 3300006173 Ga0070716_100725336 Ga0070716_1007253362 112
47 3300006177 Ga0075362_10303719 Ga0075362_103037191 112
48 3300006186 Ga0075369_10157820 Ga0075369_101578202 112
49 3300009093 Ga0105240_10596107 Ga0105240_105961072 112
50 3300009101 Ga0105247_10416842 Ga0105247_104168422 112
51 3300009148 Ga0105243_11277545 Ga0105243_112775451 112
52 3300009177 Ga0105248_10801240 Ga0105248_108012402 112
53 3300009545 Ga0105237_10004358 Ga0105237_1000435818 112
54 3300009551 Ga0105238_10493373 Ga0105238_104933731 112
55 3300010375 Ga0105239_10004760 Ga0105239_100047602 112
56 3300010375 Ga0105239_11444143 Ga0105239_114441432 112
57 3300011119 Ga0105246_10354401 Ga0105246_103544012 112
58 3300013306 Ga0163162_10345240 Ga0163162_103452402 112
59 3300025273 Ga0209673_1003416 Ga0209673_10034161 112
60 3300025303 Ga0209051_1000582 Ga0209051_10005826 112
61 3300025303 Ga0209051_1007231 Ga0209051_10072315 112
62 3300025303 Ga0209051_1009421 Ga0209051_10094213 112
63 3300025303 Ga0209051_1066940 Ga0209051_10669402 112
64 3300025914 Ga0207671_10078683 Ga0207671_100786832 112
65 3300025924 Ga0207694_11168984 Ga0207694_111689841 112
66 3300025929 Ga0207664_10619014 Ga0207664_106190142 112
67 3300025941 Ga0207711_10685548 Ga0207711_106855482 112
68 3300026035 Ga0207703_10456380 Ga0207703_104563802 112
69 3300026067 Ga0207678_10435338 Ga0207678_104353382 112
70 3300026095 Ga0207676_11231628 Ga0207676_112316282 112
71 3300028379 Ga0268266_10784606 Ga0268266_107846062 112
72 3300041441 Ga0451787_497249 Ga0451787_497249_126_467 112
73 3300041459 Ga0451800_1001123 Ga0451800_1001123_353_694 112
74 3300044683 Ga0466965_0039330 Ga0466965_0039330_1143_1481 112
75 3300044694 Ga0466963_0658703 Ga0466963_0658703_314_652 112
76 3300044765 Ga0466970_0403929 Ga0466970_0403929_348_686 112
77 3300047472 Ga0495686_0002796 Ga0495686_0002796_14903_15244 112
78 3300048903 Ga0496100_0053048 Ga0496100_0053048_883_1224 112
79 3300048904 Ga0496101_0097653 Ga0496101_0097653_1354_1695 112
80 3300048905 Ga0496102_0321969 Ga0496102_0321969_536_877 112
81 3300048907 Ga0496104_0147687 Ga0496104_0147687_1666_2007 112
82 3300048907 Ga0496104_1606150 Ga0496104_1606150_109_450 112
83 3300048908 Ga0496105_0395334 Ga0496105_0395334_430_771 112
84 3300048909 Ga0496106_0087670 Ga0496106_0087670_939_1280 112
85 3300048910 Ga0496107_0129132 Ga0496107_0129132_559_900 112
86 3300048911 Ga0496108_0185297 Ga0496108_0185297_1332_1673 112
87 3300048913 Ga0496110_0837232 Ga0496110_0837232_173_514 112
88 3300048915 Ga0496112_0071297 Ga0496112_0071297_278_619 112
89 3300048915 Ga0496112_0612864 Ga0496112_0612864_131_472 112
90 3300048916 Ga0496113_0014039 Ga0496113_0014039_4431_4772 112
91 3300048917 Ga0496114_0667878 Ga0496114_0667878_171_512 112
92 3300048918 Ga0496115_0572009 Ga0496115_0572009_474_815 112
93 3300048920 Ga0496117_0386464 Ga0496117_0386464_312_653 112
94 3300048925 Ga0496122_0052528 Ga0496122_0052528_775_1116 112
95 3300048926 Ga0496123_0011411 Ga0496123_0011411_4941_5282 112
96 3300048927 Ga0496124_0237227 Ga0496124_0237227_918_1259 112
97 3300048929 Ga0496126_0008660 Ga0496126_0008660_5401_5742 112
98 3300050489 nmdc:mga03683_352098_c1 nmdc:mga03683_352098_c1_59_400 112
99 3300050491 nmdc:mga00v17_164356_c1 nmdc:mga00v17_164356_c1_905_1246 112
100 3300050491 nmdc:mga00v17_553010_c1 nmdc:mga00v17_553010_c1_236_577 112
101 3300050491 nmdc:mga00v17_874605_c1 nmdc:mga00v17_874605_c1_185_526 112
102 3300053156 Ga0500622_0454957 Ga0500622_0454957_54_395 112
103 iso_pu_bacteria 2738541274 2738705009 112
104 iso_pu_bacteria 2738543028 2739330184 112
105 iso_pu_bacteria 2902792274 2902798960 112
106 iso_pu_bacteria 2902799365 2902803315 112
107 3300044719 Ga0466971_0102777 Ga0466971_0102777_617_964 113
108 3300044842 Ga0466957_0198387 Ga0466957_0198387_851_1198 113
109 3300045836 Ga0466958_0161012 Ga0466958_0161012_707_1054 113
110 3300049744 Ga0501083_0338044 Ga0501083_0338044_85_426 113
111 3300061719 Ga0466962_0004573 Ga0466962_0004573_3956_4303 113
112 3300006186 Ga0075369_10017113 Ga0075369_100171132 114
113 3300006186 Ga0075369_10159680 Ga0075369_101596802 114
114 3300021384 Ga0213876_10116274 Ga0213876_101162742 114
115 3300031731 Ga0307405_10240049 Ga0307405_102400491 114
116 3300031824 Ga0307413_10238879 Ga0307413_102388792 114
117 3300031911 Ga0307412_10103862 Ga0307412_101038622 114
118 3300031995 Ga0307409_100353045 Ga0307409_1003530452 114
119 3300032002 Ga0307416_100918919 Ga0307416_1009189192 114
120 3300032004 Ga0307414_11137313 Ga0307414_111373132 114
121 3300039437 Ga0436365_0987088 Ga0436365_0987088_17246_17593 114
122 3300039447 Ga0436361_0536289 Ga0436361_0536289_162_509 114
123 3300042003 Ga0439443_118577 Ga0439443_118577_88_435 114
124 3300044683 Ga0466965_0602232 Ga0466965_0602232_164_508 114
125 3300048905 Ga0496102_0077646 Ga0496102_0077646_2041_2388 114
126 3300048906 Ga0496103_0416543 Ga0496103_0416543_173_520 114
127 3300048921 Ga0496118_0000236 Ga0496118_0000236_88896_89243 114
128 3300048928 Ga0496125_0347221 Ga0496125_0347221_300_644 114
129 3300048929 Ga0496126_0073923 Ga0496126_0073923_1690_2034 114
130 3300050491 nmdc:mga00v17_720340_c1 nmdc:mga00v17_720340_c1_53_400 114
131 3300050516 nmdc:mga0sz30_4930_c1 nmdc:mga0sz30_4930_c1_999_1346 114
132 3300053136 Ga0500559_0027206 Ga0500559_0027206_690_1034 114
133 3300053730 Ga0500645_000014 Ga0500645_000014_110945_111289 114
134 iso_pu_bacteria 2551306166 2552107193 114
135 iso_pu_bacteria 2643221692 2644514395 114
136 iso_pu_bacteria 2744054611 2744958276 114
137 3300006048 Ga0075363_100140754 Ga0075363_1001407542 115
138 3300031852 Ga0307410_10304982 Ga0307410_103049822 115
139 3300031901 Ga0307406_10021356 Ga0307406_100213562 115
140 3300031995 Ga0307409_100203150 Ga0307409_1002031502 115
141 3300032002 Ga0307416_100756001 Ga0307416_1007560012 115
142 3300032005 Ga0307411_10179669 Ga0307411_101796692 115
143 3300041410 Ga0439461_0000589 Ga0439461_0000589_4575_4925 115
144 3300041411 Ga0439466_0001299 Ga0439466_0001299_11_361 115
145 3300041413 Ga0439465_0261742 Ga0439465_0261742_125_475 115
146 3300041997 Ga0439431_0000730 Ga0439431_0000730_3962_4312 115
147 3300042004 Ga0439445_0000885 Ga0439445_0000885_2038_2388 115
148 3300042435 Ga0439434_0104929 Ga0439434_0104929_145_495 115
149 3300045976 Ga0466967_0490931 Ga0466967_0490931_843_1190 115
150 3300050490 nmdc:mga03n38_81663_c1 nmdc:mga03n38_81663_c1_406_768 115
151 iso_pu_bacteria 2974315732 2974318616 115
152 iso_pu_bacteria 2984523437 2984526857 115
153 3300000545 CNXas_1008898 CNXas_10088982 116
154 3300000546 LJNas_1005571 LJNas_10055712 116
155 3300001977 JGI24746J21847_1007480 JGI24746J21847_10074802 116
156 3300001990 JGI24737J22298_10029164 JGI24737J22298_100291641 116
157 3300001990 JGI24737J22298_10063661 JGI24737J22298_100636612 116
158 3300001991 JGI24743J22301_10001791 JGI24743J22301_100017914 116
159 3300001991 JGI24743J22301_10002734 JGI24743J22301_100027342 116
160 3300001991 JGI24743J22301_10011429 JGI24743J22301_100114292 116
161 3300002067 JGI24735J21928_10141440 JGI24735J21928_101414402 116
162 3300002070 JGI24750J21931_1007375 JGI24750J21931_10073752 116
163 3300002070 JGI24750J21931_1036327 JGI24750J21931_10363271 116
164 3300002073 JGI24745J21846_1001348 JGI24745J21846_10013482 116
165 3300002073 JGI24745J21846_1010092 JGI24745J21846_10100922 116
166 3300002074 JGI24748J21848_1031970 JGI24748J21848_10319701 116
167 3300002077 JGI24744J21845_10015734 JGI24744J21845_100157342 116
168 3300002239 JGI24034J26672_10057437 JGI24034J26672_100574372 116
169 3300003320 rootH2_10034644 rootH2_100346442 116
170 3300005327 Ga0070658_11337055 Ga0070658_113370551 116
171 3300005328 Ga0070676_10015143 Ga0070676_100151435 116
172 3300005330 Ga0070690_100059616 Ga0070690_1000596162 116
173 3300005330 Ga0070690_100303148 Ga0070690_1003031482 116
174 3300005330 Ga0070690_101628578 Ga0070690_1016285781 116
175 3300005331 Ga0070670_100090428 Ga0070670_1000904282 116
176 3300005334 Ga0068869_100008057 Ga0068869_1000080573 116
177 3300005334 Ga0068869_100021907 Ga0068869_1000219073 116
178 3300005337 Ga0070682_100012102 Ga0070682_1000121022 116
179 3300005337 Ga0070682_100267766 Ga0070682_1002677661 116
180 3300005338 Ga0068868_100079872 Ga0068868_1000798722 116
181 3300005338 Ga0068868_102108931 Ga0068868_1021089311 116
182 3300005339 Ga0070660_100238175 Ga0070660_1002381752 116
183 3300005340 Ga0070689_100095533 Ga0070689_1000955332 116
184 3300005341 Ga0070691_10035636 Ga0070691_100356362 116
185 3300005345 Ga0070692_10078416 Ga0070692_100784162 116
186 3300005345 Ga0070692_10107574 Ga0070692_101075742 116
187 3300005347 Ga0070668_100324173 Ga0070668_1003241732 116
188 3300005347 Ga0070668_100656973 Ga0070668_1006569731 116
189 3300005347 Ga0070668_100747153 Ga0070668_1007471531 116
190 3300005353 Ga0070669_100038971 Ga0070669_1000389713 116
191 3300005353 Ga0070669_100237998 Ga0070669_1002379982 116
192 3300005353 Ga0070669_101272459 Ga0070669_1012724592 116
193 3300005354 Ga0070675_100625215 Ga0070675_1006252152 116
194 3300005355 Ga0070671_100000857 Ga0070671_1000008576 116
195 3300005355 Ga0070671_100141076 Ga0070671_1001410762 116
196 3300005355 Ga0070671_100436034 Ga0070671_1004360341 116
197 3300005356 Ga0070674_100122704 Ga0070674_1001227042 116
198 3300005356 Ga0070674_100141080 Ga0070674_1001410802 116
199 3300005356 Ga0070674_100874008 Ga0070674_1008740081 116
200 3300005364 Ga0070673_100038612 Ga0070673_1000386123 116
201 3300005365 Ga0070688_100008672 Ga0070688_1000086722 116
202 3300005365 Ga0070688_100287600 Ga0070688_1002876002 116
203 3300005366 Ga0070659_100046646 Ga0070659_1000466462 116
204 3300005366 Ga0070659_101013032 Ga0070659_1010130321 116
205 3300005367 Ga0070667_100014633 Ga0070667_1000146333 116
206 3300005367 Ga0070667_100024791 Ga0070667_1000247913 116
207 3300005367 Ga0070667_100046868 Ga0070667_1000468682 116
208 3300005367 Ga0070667_100172254 Ga0070667_1001722542 116
209 3300005406 Ga0070703_10044398 Ga0070703_100443981 116
210 3300005434 Ga0070709_10020853 Ga0070709_100208533 116
211 3300005434 Ga0070709_10044036 Ga0070709_100440362 116
212 3300005435 Ga0070714_100204251 Ga0070714_1002042512 116
213 3300005437 Ga0070710_10025085 Ga0070710_100250852 116
214 3300005437 Ga0070710_10255745 Ga0070710_102557452 116
215 3300005438 Ga0070701_10006664 Ga0070701_100066642 116
216 3300005438 Ga0070701_10402488 Ga0070701_104024881 116
217 3300005439 Ga0070711_100009282 Ga0070711_1000092825 116
218 3300005439 Ga0070711_100045137 Ga0070711_1000451372 116
219 3300005440 Ga0070705_100008684 Ga0070705_1000086845 116
220 3300005440 Ga0070705_100034476 Ga0070705_1000344762 116
221 3300005440 Ga0070705_100502240 Ga0070705_1005022401 116
222 3300005441 Ga0070700_100012377 Ga0070700_1000123773 116
223 3300005441 Ga0070700_100158511 Ga0070700_1001585112 116
224 3300005444 Ga0070694_100414025 Ga0070694_1004140252 116
225 3300005444 Ga0070694_101113937 Ga0070694_1011139372 116
226 3300005445 Ga0070708_100691813 Ga0070708_1006918132 116
227 3300005445 Ga0070708_100772925 Ga0070708_1007729252 116
228 3300005455 Ga0070663_100108732 Ga0070663_1001087322 116
229 3300005455 Ga0070663_100124028 Ga0070663_1001240282 116
230 3300005455 Ga0070663_100734306 Ga0070663_1007343061 116
231 3300005455 Ga0070663_101126384 Ga0070663_1011263841 116
232 3300005456 Ga0070678_100143543 Ga0070678_1001435432 116
233 3300005456 Ga0070678_100538377 Ga0070678_1005383772 116
234 3300005456 Ga0070678_100756139 Ga0070678_1007561392 116
235 3300005456 Ga0070678_101272135 Ga0070678_1012721352 116
236 3300005457 Ga0070662_100016536 Ga0070662_1000165362 116
237 3300005459 Ga0068867_100056119 Ga0068867_1000561193 116
238 3300005459 Ga0068867_100278860 Ga0068867_1002788602 116
239 3300005459 Ga0068867_100375852 Ga0068867_1003758522 116
240 3300005466 Ga0070685_10018635 Ga0070685_100186353 116
241 3300005466 Ga0070685_10160402 Ga0070685_101604022 116
242 3300005466 Ga0070685_10446867 Ga0070685_104468672 116
243 3300005467 Ga0070706_100989546 Ga0070706_1009895462 116
244 3300005535 Ga0070684_100645324 Ga0070684_1006453242 116
245 3300005536 Ga0070697_100183356 Ga0070697_1001833561 116
246 3300005539 Ga0068853_100035712 Ga0068853_1000357123 116
247 3300005539 Ga0068853_100952425 Ga0068853_1009524252 116
248 3300005543 Ga0070672_100113767 Ga0070672_1001137672 116
249 3300005543 Ga0070672_100197703 Ga0070672_1001977032 116
250 3300005543 Ga0070672_101016539 Ga0070672_1010165392 116
251 3300005544 Ga0070686_100139150 Ga0070686_1001391501 116
252 3300005544 Ga0070686_100354286 Ga0070686_1003542862 116
253 3300005545 Ga0070695_100064159 Ga0070695_1000641592 116
254 3300005545 Ga0070695_100344571 Ga0070695_1003445711 116
255 3300005546 Ga0070696_100045285 Ga0070696_1000452853 116
256 3300005546 Ga0070696_100151457 Ga0070696_1001514572 116
257 3300005547 Ga0070693_100061425 Ga0070693_1000614252 116
258 3300005547 Ga0070693_100271288 Ga0070693_1002712882 116
259 3300005548 Ga0070665_100016906 Ga0070665_1000169067 116
260 3300005548 Ga0070665_100021400 Ga0070665_1000214002 116
261 3300005548 Ga0070665_100031399 Ga0070665_1000313992 116
262 3300005548 Ga0070665_101003272 Ga0070665_1010032722 116
263 3300005549 Ga0070704_100005943 Ga0070704_1000059432 116
264 3300005563 Ga0068855_100194985 Ga0068855_1001949852 116
265 3300005563 Ga0068855_100604067 Ga0068855_1006040672 116
266 3300005578 Ga0068854_100040527 Ga0068854_1000405273 116
267 3300005578 Ga0068854_100491939 Ga0068854_1004919391 116
268 3300005614 Ga0068856_100067702 Ga0068856_1000677022 116
269 3300005614 Ga0068856_100414663 Ga0068856_1004146631 116
270 3300005615 Ga0070702_100003765 Ga0070702_1000037655 116
271 3300005615 Ga0070702_100056656 Ga0070702_1000566562 116
272 3300005615 Ga0070702_101140048 Ga0070702_1011400481 116
273 3300005615 Ga0070702_101166469 Ga0070702_1011664692 116
274 3300005616 Ga0068852_100067766 Ga0068852_1000677662 116
275 3300005616 Ga0068852_100182432 Ga0068852_1001824322 116
276 3300005617 Ga0068859_100022466 Ga0068859_1000224664 116
277 3300005617 Ga0068859_100668204 Ga0068859_1006682041 116
278 3300005617 Ga0068859_101527603 Ga0068859_1015276032 116
279 3300005617 Ga0068859_103005510 Ga0068859_1030055101 116
280 3300005618 Ga0068864_100028130 Ga0068864_1000281305 116
281 3300005618 Ga0068864_100612579 Ga0068864_1006125792 116
282 3300005718 Ga0068866_10007981 Ga0068866_100079812 116
283 3300005719 Ga0068861_100006167 Ga0068861_1000061674 116
284 3300005719 Ga0068861_100040051 Ga0068861_1000400513 116
285 3300005719 Ga0068861_100325032 Ga0068861_1003250322 116
286 3300005719 Ga0068861_101269883 Ga0068861_1012698832 116
287 3300005834 Ga0068851_10131088 Ga0068851_101310882 116
288 3300005840 Ga0068870_10081998 Ga0068870_100819984 116
289 3300005841 Ga0068863_100005929 Ga0068863_1000059294 116
290 3300005841 Ga0068863_100173939 Ga0068863_1001739392 116
291 3300005841 Ga0068863_100300342 Ga0068863_1003003424 116
292 3300005841 Ga0068863_100558697 Ga0068863_1005586972 116
293 3300005842 Ga0068858_100013663 Ga0068858_1000136632 116
294 3300005842 Ga0068858_100456722 Ga0068858_1004567222 116
295 3300005842 Ga0068858_101198998 Ga0068858_1011989982 116
296 3300005842 Ga0068858_101487028 Ga0068858_1014870282 116
297 3300005843 Ga0068860_100108853 Ga0068860_1001088532 116
298 3300005843 Ga0068860_100204393 Ga0068860_1002043932 116
299 3300005843 Ga0068860_100237707 Ga0068860_1002377072 116
300 3300005843 Ga0068860_100728776 Ga0068860_1007287762 116
301 3300005844 Ga0068862_100081840 Ga0068862_1000818403 116
302 3300005844 Ga0068862_100219149 Ga0068862_1002191492 116
303 3300005844 Ga0068862_100230913 Ga0068862_1002309132 116
304 3300005844 Ga0068862_101025704 Ga0068862_1010257041 116
305 3300005937 Ga0081455_10342537 Ga0081455_103425372 116
306 3300006038 Ga0075365_10010694 Ga0075365_100106943 116
307 3300006038 Ga0075365_10710686 Ga0075365_107106862 116
308 3300006051 Ga0075364_10002232 Ga0075364_1000223211 116
309 3300006051 Ga0075364_10017167 Ga0075364_100171674 116
310 3300006051 Ga0075364_10071145 Ga0075364_100711452 116
311 3300006051 Ga0075364_10811186 Ga0075364_108111861 116
312 3300006163 Ga0070715_10011748 Ga0070715_100117483 116
313 3300006173 Ga0070716_100004343 Ga0070716_1000043439 116
314 3300006173 Ga0070716_100080091 Ga0070716_1000800912 116
315 3300006173 Ga0070716_101484731 Ga0070716_1014847311 116
316 3300006175 Ga0070712_100014032 Ga0070712_1000140323 116
317 3300006175 Ga0070712_100036147 Ga0070712_1000361472 116
318 3300006177 Ga0075362_10010772 Ga0075362_100107722 116
319 3300006177 Ga0075362_10192077 Ga0075362_101920772 116
320 3300006178 Ga0075367_10471429 Ga0075367_104714292 116
321 3300006186 Ga0075369_10000801 Ga0075369_1000080110 116
322 3300006186 Ga0075369_10003710 Ga0075369_100037108 116
323 3300006186 Ga0075369_10004851 Ga0075369_100048514 116
324 3300006186 Ga0075369_10070805 Ga0075369_100708052 116
325 3300006186 Ga0075369_10106036 Ga0075369_101060361 116
326 3300006186 Ga0075369_10107221 Ga0075369_101072212 116
327 3300006186 Ga0075369_10341956 Ga0075369_103419562 116
328 3300006186 Ga0075369_10413936 Ga0075369_104139362 116
329 3300006237 Ga0097621_100086416 Ga0097621_1000864162 116
330 3300006237 Ga0097621_100137376 Ga0097621_1001373762 116
331 3300006353 Ga0075370_10013411 Ga0075370_100134112 116
332 3300006353 Ga0075370_10042506 Ga0075370_100425061 116
333 3300006353 Ga0075370_10054036 Ga0075370_100540364 116
334 3300006353 Ga0075370_10588892 Ga0075370_105888922 116
335 3300006358 Ga0068871_100053608 Ga0068871_1000536084 116
336 3300006358 Ga0068871_100158450 Ga0068871_1001584502 116
337 3300006846 Ga0075430_100004258 Ga0075430_10000425810 116
338 3300006847 Ga0075431_100036015 Ga0075431_1000360155 116
339 3300006852 Ga0075433_10848879 Ga0075433_108488792 116
340 3300006881 Ga0068865_100067444 Ga0068865_1000674443 116
341 3300006881 Ga0068865_100100518 Ga0068865_1001005182 116
342 3300006881 Ga0068865_100103728 Ga0068865_1001037282 116
343 3300006881 Ga0068865_100924054 Ga0068865_1009240542 116
344 3300006931 Ga0097620_100022468 Ga0097620_1000224684 116
345 3300006931 Ga0097620_100668176 Ga0097620_1006681762 116
346 3300006931 Ga0097620_101527560 Ga0097620_1015275602 116
347 3300006931 Ga0097620_103003244 Ga0097620_1030032441 116
348 3300009092 Ga0105250_10071661 Ga0105250_100716612 116
349 3300009092 Ga0105250_10216707 Ga0105250_102167072 116
350 3300009094 Ga0111539_10347611 Ga0111539_103476112 116
351 3300009098 Ga0105245_10080640 Ga0105245_100806403 116
352 3300009098 Ga0105245_10475146 Ga0105245_104751462 116
353 3300009098 Ga0105245_11511294 Ga0105245_115112942 116
354 3300009101 Ga0105247_10007780 Ga0105247_100077802 116
355 3300009101 Ga0105247_10023605 Ga0105247_100236054 116
356 3300009147 Ga0114129_10002202 Ga0114129_1000220219 116
357 3300009148 Ga0105243_10042382 Ga0105243_100423822 116
358 3300009148 Ga0105243_10051033 Ga0105243_100510332 116
359 3300009174 Ga0105241_11512507 Ga0105241_115125072 116
360 3300009176 Ga0105242_10386822 Ga0105242_103868222 116
361 3300009176 Ga0105242_10576480 Ga0105242_105764802 116
362 3300009177 Ga0105248_10094559 Ga0105248_100945593 116
363 3300009177 Ga0105248_10230982 Ga0105248_102309822 116
364 3300009177 Ga0105248_10429279 Ga0105248_104292793 116
365 3300009545 Ga0105237_10089465 Ga0105237_100894652 116
366 3300009545 Ga0105237_10181117 Ga0105237_101811172 116
367 3300009551 Ga0105238_10156407 Ga0105238_101564072 116
368 3300009551 Ga0105238_10360030 Ga0105238_103600302 116
369 3300009553 Ga0105249_10007627 Ga0105249_100076277 116
370 3300009553 Ga0105249_10327740 Ga0105249_103277402 116
371 3300009553 Ga0105249_10700148 Ga0105249_107001482 116
372 3300009553 Ga0105249_12448528 Ga0105249_124485281 116
373 3300010375 Ga0105239_10033724 Ga0105239_100337243 116
374 3300010375 Ga0105239_10167192 Ga0105239_101671924 116
375 3300011119 Ga0105246_10019015 Ga0105246_100190152 116
376 3300011119 Ga0105246_10216940 Ga0105246_102169402 116
377 3300011119 Ga0105246_11772565 Ga0105246_117725651 116
378 3300013100 Ga0157373_10316988 Ga0157373_103169881 116
379 3300013104 Ga0157370_11209071 Ga0157370_112090711 116
380 3300013296 Ga0157374_10008988 Ga0157374_100089885 116
381 3300013297 Ga0157378_10013540 Ga0157378_100135402 116
382 3300013297 Ga0157378_10239805 Ga0157378_102398052 116
383 3300013306 Ga0163162_10704726 Ga0163162_107047262 116
384 3300013306 Ga0163162_12869155 Ga0163162_128691551 116
385 3300013307 Ga0157372_10034051 Ga0157372_100340512 116
386 3300013307 Ga0157372_10048715 Ga0157372_100487155 116
387 3300013308 Ga0157375_10026596 Ga0157375_100265964 116
388 3300013308 Ga0157375_10230852 Ga0157375_102308521 116
389 3300014325 Ga0163163_10078441 Ga0163163_100784413 116
390 3300014325 Ga0163163_10291943 Ga0163163_102919434 116
391 3300014325 Ga0163163_11219562 Ga0163163_112195622 116
392 3300014325 Ga0163163_11383120 Ga0163163_113831201 116
393 3300014326 Ga0157380_10156676 Ga0157380_101566762 116
394 3300014326 Ga0157380_10181210 Ga0157380_101812102 116
395 3300014745 Ga0157377_10007569 Ga0157377_100075695 116
396 3300014745 Ga0157377_10028023 Ga0157377_100280232 116
397 3300014968 Ga0157379_10005060 Ga0157379_100050605 116
398 3300014968 Ga0157379_10188698 Ga0157379_101886982 116
399 3300014969 Ga0157376_10124505 Ga0157376_101245052 116
400 3300014969 Ga0157376_10424581 Ga0157376_104245812 116
401 3300017792 Ga0163161_10060621 Ga0163161_100606212 116
402 3300017792 Ga0163161_10118740 Ga0163161_101187404 116
403 3300017792 Ga0163161_10417287 Ga0163161_104172873 116
404 3300017792 Ga0163161_10424957 Ga0163161_104249572 116
405 3300021384 Ga0213876_10008455 Ga0213876_100084555 116
406 3300025885 Ga0207653_10021277 Ga0207653_100212772 116
407 3300025898 Ga0207692_10056043 Ga0207692_100560432 116
408 3300025898 Ga0207692_10106246 Ga0207692_101062462 116
409 3300025900 Ga0207710_10319674 Ga0207710_103196741 116
410 3300025901 Ga0207688_10000065 Ga0207688_1000006529 116
411 3300025901 Ga0207688_10020310 Ga0207688_100203101 116
412 3300025901 Ga0207688_10049235 Ga0207688_100492352 116
413 3300025904 Ga0207647_10033458 Ga0207647_100334582 116
414 3300025905 Ga0207685_10005908 Ga0207685_100059082 116
415 3300025905 Ga0207685_10304202 Ga0207685_103042021 116
416 3300025906 Ga0207699_10747600 Ga0207699_107476002 116
417 3300025907 Ga0207645_10261169 Ga0207645_102611692 116
418 3300025908 Ga0207643_10028172 Ga0207643_100281722 116
419 3300025909 Ga0207705_11333251 Ga0207705_113332511 116
420 3300025911 Ga0207654_10495909 Ga0207654_104959092 116
421 3300025914 Ga0207671_10158046 Ga0207671_101580462 116
422 3300025914 Ga0207671_11254625 Ga0207671_112546251 116
423 3300025915 Ga0207693_10001726 Ga0207693_1000172625 116
424 3300025915 Ga0207693_10023850 Ga0207693_100238502 116
425 3300025916 Ga0207663_10036882 Ga0207663_100368823 116
426 3300025916 Ga0207663_10184051 Ga0207663_101840512 116
427 3300025919 Ga0207657_10087486 Ga0207657_100874862 116
428 3300025919 Ga0207657_10611390 Ga0207657_106113902 116
429 3300025923 Ga0207681_10100487 Ga0207681_101004872 116
430 3300025923 Ga0207681_10166464 Ga0207681_101664642 116
431 3300025923 Ga0207681_11755124 Ga0207681_117551241 116
432 3300025924 Ga0207694_10101524 Ga0207694_101015242 116
433 3300025924 Ga0207694_10260973 Ga0207694_102609732 116
434 3300025925 Ga0207650_10049033 Ga0207650_100490332 116
435 3300025927 Ga0207687_10867540 Ga0207687_108675402 116
436 3300025928 Ga0207700_10814887 Ga0207700_108148872 116
437 3300025931 Ga0207644_10003277 Ga0207644_1000327710 116
438 3300025931 Ga0207644_10109818 Ga0207644_101098182 116
439 3300025931 Ga0207644_10262597 Ga0207644_102625972 116
440 3300025931 Ga0207644_10375984 Ga0207644_103759842 116
441 3300025932 Ga0207690_10833293 Ga0207690_108332931 116
442 3300025933 Ga0207706_10011834 Ga0207706_100118347 116
443 3300025933 Ga0207706_10036470 Ga0207706_100364702 116
444 3300025934 Ga0207686_10364792 Ga0207686_103647921 116
445 3300025934 Ga0207686_10401446 Ga0207686_104014462 116
446 3300025934 Ga0207686_10715430 Ga0207686_107154301 116
447 3300025935 Ga0207709_10307012 Ga0207709_103070122 116
448 3300025936 Ga0207670_10191100 Ga0207670_101911002 116
449 3300025936 Ga0207670_11511669 Ga0207670_115116691 116
450 3300025936 Ga0207670_11715189 Ga0207670_117151891 116
451 3300025937 Ga0207669_10311715 Ga0207669_103117152 116
452 3300025937 Ga0207669_11628184 Ga0207669_116281841 116
453 3300025938 Ga0207704_10088130 Ga0207704_100881304 116
454 3300025938 Ga0207704_10205845 Ga0207704_102058452 116
455 3300025939 Ga0207665_10004137 Ga0207665_100041376 116
456 3300025939 Ga0207665_10009561 Ga0207665_100095612 116
457 3300025939 Ga0207665_11273491 Ga0207665_112734911 116
458 3300025940 Ga0207691_10033722 Ga0207691_100337225 116
459 3300025940 Ga0207691_10044140 Ga0207691_100441402 116
460 3300025940 Ga0207691_10517640 Ga0207691_105176402 116
461 3300025941 Ga0207711_10148383 Ga0207711_101483832 116
462 3300025941 Ga0207711_10924382 Ga0207711_109243821 116
463 3300025941 Ga0207711_11605567 Ga0207711_116055672 116
464 3300025942 Ga0207689_10009506 Ga0207689_100095063 116
465 3300025942 Ga0207689_10013320 Ga0207689_100133207 116
466 3300025949 Ga0207667_10107828 Ga0207667_101078283 116
467 3300025949 Ga0207667_10448321 Ga0207667_104483212 116
468 3300025961 Ga0207712_10525710 Ga0207712_105257102 116
469 3300025961 Ga0207712_10907934 Ga0207712_109079342 116
470 3300025972 Ga0207668_10322500 Ga0207668_103225002 116
471 3300025972 Ga0207668_10534520 Ga0207668_105345202 116
472 3300025972 Ga0207668_11999033 Ga0207668_119990331 116
473 3300025981 Ga0207640_10050976 Ga0207640_100509762 116
474 3300025986 Ga0207658_10007890 Ga0207658_1000789010 116
475 3300025986 Ga0207658_10106296 Ga0207658_101062962 116
476 3300025986 Ga0207658_10183170 Ga0207658_101831702 116
477 3300025986 Ga0207658_10185707 Ga0207658_101857072 116
478 3300026023 Ga0207677_10065309 Ga0207677_100653092 116
479 3300026023 Ga0207677_10130254 Ga0207677_101302542 116
480 3300026023 Ga0207677_10146556 Ga0207677_101465564 116
481 3300026035 Ga0207703_10238958 Ga0207703_102389583 116
482 3300026035 Ga0207703_11054861 Ga0207703_110548611 116
483 3300026041 Ga0207639_10127105 Ga0207639_101271051 116
484 3300026067 Ga0207678_10027949 Ga0207678_100279495 116
485 3300026067 Ga0207678_10030159 Ga0207678_100301594 116
486 3300026067 Ga0207678_10654059 Ga0207678_106540593 116
487 3300026067 Ga0207678_11154605 Ga0207678_111546051 116
488 3300026075 Ga0207708_10001834 Ga0207708_100018346 116
489 3300026075 Ga0207708_10036418 Ga0207708_100364181 116
490 3300026078 Ga0207702_10368087 Ga0207702_103680872 116
491 3300026078 Ga0207702_11872890 Ga0207702_118728902 116
492 3300026088 Ga0207641_10017084 Ga0207641_100170846 116
493 3300026088 Ga0207641_10364065 Ga0207641_103640652 116
494 3300026088 Ga0207641_10484525 Ga0207641_104845252 116
495 3300026088 Ga0207641_10535798 Ga0207641_105357982 116
496 3300026088 Ga0207641_10795337 Ga0207641_107953371 116
497 3300026089 Ga0207648_10075782 Ga0207648_100757822 116
498 3300026089 Ga0207648_10082205 Ga0207648_100822052 116
499 3300026089 Ga0207648_10538071 Ga0207648_105380711 116
500 3300026095 Ga0207676_10055132 Ga0207676_100551323 116
501 3300026118 Ga0207675_100007395 Ga0207675_1000073955 116
502 3300026118 Ga0207675_100077852 Ga0207675_1000778522 116
503 3300026118 Ga0207675_100400880 Ga0207675_1004008802 116
504 3300026118 Ga0207675_100928953 Ga0207675_1009289531 116
505 3300026121 Ga0207683_10007249 Ga0207683_100072497 116
506 3300026121 Ga0207683_10061095 Ga0207683_100610953 116
507 3300026142 Ga0207698_10093348 Ga0207698_100933482 116
508 3300026142 Ga0207698_10331232 Ga0207698_103312323 116
509 3300028379 Ga0268266_10003919 Ga0268266_1000391915 116
510 3300028379 Ga0268266_10025990 Ga0268266_100259903 116
511 3300028379 Ga0268266_10120380 Ga0268266_101203802 116
512 3300028379 Ga0268266_10779366 Ga0268266_107793662 116
513 3300028380 Ga0268265_10065964 Ga0268265_100659642 116
514 3300028380 Ga0268265_10573526 Ga0268265_105735262 116
515 3300028380 Ga0268265_10730222 Ga0268265_107302221 116
516 3300028380 Ga0268265_10770872 Ga0268265_107708722 116
517 3300028381 Ga0268264_10069268 Ga0268264_100692682 116
518 3300028381 Ga0268264_10390284 Ga0268264_103902842 116
519 3300028381 Ga0268264_10534760 Ga0268264_105347602 116
520 3300028381 Ga0268264_11033272 Ga0268264_110332721 116
521 3300031731 Ga0307405_11091281 Ga0307405_110912812 116
522 3300032002 Ga0307416_103461341 Ga0307416_1034613411 116
523 3300034820 Ga0373959_0073846 Ga0373959_0073846_220_570 116
524 3300035084 Ga0373928_0174053 Ga0373928_0174053_82_435 116
525 3300035121 Ga0373960_0062491 Ga0373960_0062491_658_1008 116
526 3300035207 Ga0373942_0087120 Ga0373942_0087120_446_796 116
527 3300035207 Ga0373942_0113639 Ga0373942_0113639_52_405 116
528 3300035241 Ga0373961_0208109 Ga0373961_0208109_316_666 116
529 3300035241 Ga0373961_0427135 Ga0373961_0427135_117_470 116
530 3300035242 Ga0373962_0130260 Ga0373962_0130260_254_604 116
531 3300035691 Ga0373931_0014323 Ga0373931_0014323_606_956 116
532 3300035691 Ga0373931_0025634 Ga0373931_0025634_1863_2216 116
533 3300035725 Ga0373947_0308302 Ga0373947_0308302_472_873 116
534 3300036647 Ga0316582_0148261 Ga0316582_0148261_763_1113 116
535 3300036712 Ga0316584_0014880 Ga0316584_0014880_3797_4147 116
536 3300037853 Ga0436364_1504233 Ga0436364_1504233_283_636 116
537 3300039437 Ga0436365_0772403 Ga0436365_0772403_9295_9648 116
538 3300039438 Ga0436360_0360375 Ga0436360_0360375_110_463 116
539 3300039447 Ga0436361_0556079 Ga0436361_0556079_109_462 116
540 3300041410 Ga0439461_0045365 Ga0439461_0045365_150_500 116
541 3300041411 Ga0439466_0021836 Ga0439466_0021836_1398_1751 116
542 3300041411 Ga0439466_0030016 Ga0439466_0030016_230_580 116
543 3300041413 Ga0439465_0009519 Ga0439465_0009519_2661_3014 116
544 3300041413 Ga0439465_0017121 Ga0439465_0017121_1726_2076 116
545 3300041997 Ga0439431_0068457 Ga0439431_0068457_315_665 116
546 3300042002 Ga0439442_010560 Ga0439442_010560_616_966 116
547 3300042004 Ga0439445_0011393 Ga0439445_0011393_1725_2078 116
548 3300042004 Ga0439445_0099403 Ga0439445_0099403_96_446 116
549 3300042438 Ga0439459_0027248 Ga0439459_0027248_54_410 116
550 3300044901 Ga0466960_0111425 Ga0466960_0111425_965_1348 116
551 3300046500 Ga0495596_0251562 Ga0495596_0251562_213_563 116
552 3300046507 Ga0495606_0177833 Ga0495606_0177833_68_424 116
553 3300046515 Ga0495620_0246934 Ga0495620_0246934_35_391 116
554 3300046515 Ga0495620_0291617 Ga0495620_0291617_66_416 116
555 3300046524 Ga0495648_0006972 Ga0495648_0006972_3759_4115 116
556 3300046528 Ga0495642_0126622 Ga0495642_0126622_303_659 116
557 3300046530 Ga0495654_0051006 Ga0495654_0051006_445_801 116
558 3300046530 Ga0495654_0398672 Ga0495654_0398672_22_372 116
559 3300046616 Ga0495668_0170228 Ga0495668_0170228_744_1100 116
560 3300046616 Ga0495668_0469349 Ga0495668_0469349_79_432 116
561 3300046648 Ga0495611_0049495 Ga0495611_0049495_1095_1451 116
562 3300046660 Ga0495625_0091922 Ga0495625_0091922_498_851 116
563 3300046692 Ga0495671_0072724 Ga0495671_0072724_92_442 116
564 3300046794 Ga0495589_0330460 Ga0495589_0330460_55_405 116
565 3300047320 Ga0495672_0002254 Ga0495672_0002254_12461_12817 116
566 3300047320 Ga0495672_0492561 Ga0495672_0492561_20_403 116
567 3300047469 Ga0495673_0004032 Ga0495673_0004032_3726_4082 116
568 3300048903 Ga0496100_0001679 Ga0496100_0001679_7689_8045 116
569 3300048903 Ga0496100_0087183 Ga0496100_0087183_405_758 116
570 3300048903 Ga0496100_0099173 Ga0496100_0099173_849_1232 116
571 3300048903 Ga0496100_0707139 Ga0496100_0707139_392_754 116
572 3300048904 Ga0496101_0000126 Ga0496101_0000126_12454_12810 116
573 3300048904 Ga0496101_0028338 Ga0496101_0028338_2162_2545 116
574 3300048904 Ga0496101_0273259 Ga0496101_0273259_213_563 116
575 3300048905 Ga0496102_0000006 Ga0496102_0000006_60065_60421 116
576 3300048905 Ga0496102_0030442 Ga0496102_0030442_3593_3976 116
577 3300048905 Ga0496102_0114555 Ga0496102_0114555_514_864 116
578 3300048905 Ga0496102_0120605 Ga0496102_0120605_1372_1755 116
579 3300048905 Ga0496102_0185379 Ga0496102_0185379_1036_1386 116
580 3300048905 Ga0496102_0988609 Ga0496102_0988609_206_556 116
581 3300048906 Ga0496103_0000006 Ga0496103_0000006_59892_60248 116
582 3300048906 Ga0496103_0058033 Ga0496103_0058033_421_774 116
583 3300048907 Ga0496104_0021922 Ga0496104_0021922_1509_1862 116
584 3300048907 Ga0496104_0025837 Ga0496104_0025837_1329_1712 116
585 3300048907 Ga0496104_0570284 Ga0496104_0570284_610_960 116
586 3300048907 Ga0496104_0759638 Ga0496104_0759638_32_388 116
587 3300048907 Ga0496104_1726964 Ga0496104_1726964_46_396 116
588 3300048908 Ga0496105_0047082 Ga0496105_0047082_1909_2262 116
589 3300048908 Ga0496105_0074997 Ga0496105_0074997_1347_1730 116
590 3300048908 Ga0496105_0704217 Ga0496105_0704217_330_680 116
591 3300048909 Ga0496106_0024628 Ga0496106_0024628_186_536 116
592 3300048909 Ga0496106_0040391 Ga0496106_0040391_2009_2365 116
593 3300048909 Ga0496106_0065440 Ga0496106_0065440_35_388 116
594 3300048909 Ga0496106_0820230 Ga0496106_0820230_270_653 116
595 3300048910 Ga0496107_0043581 Ga0496107_0043581_1133_1489 116
596 3300048910 Ga0496107_0097513 Ga0496107_0097513_1312_1662 116
597 3300048910 Ga0496107_0913937 Ga0496107_0913937_78_461 116
598 3300048911 Ga0496108_0001533 Ga0496108_0001533_3475_3825 116
599 3300048911 Ga0496108_0008920 Ga0496108_0008920_1447_1800 116
600 3300048911 Ga0496108_0023809 Ga0496108_0023809_2543_2926 116
601 3300048911 Ga0496108_0102183 Ga0496108_0102183_1837_2187 116
602 3300048911 Ga0496108_0158829 Ga0496108_0158829_1294_1677 116
603 3300048911 Ga0496108_0178767 Ga0496108_0178767_306_662 116
604 3300048911 Ga0496108_0203177 Ga0496108_0203177_647_1009 116
605 3300048912 Ga0496109_0014683 Ga0496109_0014683_3202_3552 116
606 3300048912 Ga0496109_0039360 Ga0496109_0039360_1080_1433 116
607 3300048912 Ga0496109_0045533 Ga0496109_0045533_209_565 116
608 3300048912 Ga0496109_0058592 Ga0496109_0058592_1654_2004 116
609 3300048912 Ga0496109_0289918 Ga0496109_0289918_966_1349 116
610 3300048912 Ga0496109_1762432 Ga0496109_1762432_11_394 116
611 3300048913 Ga0496110_0022181 Ga0496110_0022181_4711_5064 116
612 3300048913 Ga0496110_0026881 Ga0496110_0026881_859_1242 116
613 3300048913 Ga0496110_0036193 Ga0496110_0036193_1194_1544 116
614 3300048913 Ga0496110_0103220 Ga0496110_0103220_92_448 116
615 3300048913 Ga0496110_0324902 Ga0496110_0324902_588_971 116
616 3300048913 Ga0496110_1568987 Ga0496110_1568987_91_453 116
617 3300048914 Ga0496111_0071549 Ga0496111_0071549_1710_2093 116
618 3300048914 Ga0496111_0334569 Ga0496111_0334569_450_803 116
619 3300048915 Ga0496112_0006014 Ga0496112_0006014_2919_3269 116
620 3300048915 Ga0496112_0085169 Ga0496112_0085169_1743_2096 116
621 3300048916 Ga0496113_0372301 Ga0496113_0372301_135_485 116
622 3300048917 Ga0496114_0024804 Ga0496114_0024804_2058_2408 116
623 3300048917 Ga0496114_0050905 Ga0496114_0050905_2527_2889 116
624 3300048917 Ga0496114_0487927 Ga0496114_0487927_360_713 116
625 3300048918 Ga0496115_0211039 Ga0496115_0211039_1114_1467 116
626 3300048918 Ga0496115_0268162 Ga0496115_0268162_994_1350 116
627 3300048918 Ga0496115_0337099 Ga0496115_0337099_824_1174 116
628 3300048919 Ga0496116_0000025 Ga0496116_0000025_410292_410648 116
629 3300048920 Ga0496117_0000006 Ga0496117_0000006_410321_410677 116
630 3300048921 Ga0496118_0000004 Ga0496118_0000004_410321_410677 116
631 3300048922 Ga0496119_0000041 Ga0496119_0000041_30960_31316 116
632 3300048923 Ga0496120_0000027 Ga0496120_0000027_169689_170045 116
633 3300048924 Ga0496121_0000171 Ga0496121_0000171_4839_5195 116
634 3300048929 Ga0496126_0018679 Ga0496126_0018679_166_522 116
635 3300049823 Ga0501044_0035107 Ga0501044_0035107_4277_4627 116
636 3300050489 nmdc:mga03683_213944_c1 nmdc:mga03683_213944_c1_420_770 116
637 3300050490 nmdc:mga03n38_135766_c1 nmdc:mga03n38_135766_c1_758_1108 116
638 3300050490 nmdc:mga03n38_141882_c1 nmdc:mga03n38_141882_c1_112_483 116
639 3300050490 nmdc:mga03n38_292309_c1 nmdc:mga03n38_292309_c1_469_819 116
640 3300050490 nmdc:mga03n38_3990_c1 nmdc:mga03n38_3990_c1_200_571 116
641 3300050490 nmdc:mga03n38_53521_c1 nmdc:mga03n38_53521_c1_1368_1718 116
642 3300050490 nmdc:mga03n38_82101_c1 nmdc:mga03n38_82101_c1_650_1006 116
643 3300050490 nmdc:mga03n38_99478_c1 nmdc:mga03n38_99478_c1_428_778 116
644 3300050491 nmdc:mga00v17_1106_c1 nmdc:mga00v17_1106_c1_4551_4901 116
645 3300050491 nmdc:mga00v17_263606_c1 nmdc:mga00v17_263606_c1_83_433 116
646 3300050491 nmdc:mga00v17_62580_c1 nmdc:mga00v17_62580_c1_1384_1755 116
647 3300050492 nmdc:mga0yw44_1217376_c1 nmdc:mga0yw44_1217376_c1_64_414 116
648 3300050492 nmdc:mga0yw44_222704_c1 nmdc:mga0yw44_222704_c1_493_843 116
649 3300050492 nmdc:mga0yw44_33606_c1 nmdc:mga0yw44_33606_c1_2427_2798 116
650 3300050492 nmdc:mga0yw44_506374_c1 nmdc:mga0yw44_506374_c1_446_796 116
651 3300050494 nmdc:mga06z11_2710_c1 nmdc:mga06z11_2710_c1_1918_2289 116
652 3300050494 nmdc:mga06z11_518120_c1 nmdc:mga06z11_518120_c1_242_625 116
653 3300050495 nmdc:mga04h51_113052_c1 nmdc:mga04h51_113052_c1_70_441 116
654 3300050496 nmdc:mga07m45_252766_c1 nmdc:mga07m45_252766_c1_94_444 116
655 3300050496 nmdc:mga07m45_29483_c1 nmdc:mga07m45_29483_c1_179_529 116
656 3300050496 nmdc:mga07m45_82523_c1 nmdc:mga07m45_82523_c1_594_965 116
657 3300050507 nmdc:mga05p37_10579_c1 nmdc:mga05p37_10579_c1_2047_2397 116
658 3300050509 nmdc:mga0qj67_2784_c1 nmdc:mga0qj67_2784_c1_3934_4284 116
659 3300050510 nmdc:mga06r32_67807_c1 nmdc:mga06r32_67807_c1_1082_1432 116
660 3300050511 nmdc:mga08y16_256741_c1 nmdc:mga08y16_256741_c1_713_1063 116
661 3300050516 nmdc:mga0sz30_242218_c1 nmdc:mga0sz30_242218_c1_255_605 116
662 3300050516 nmdc:mga0sz30_3096_c1 nmdc:mga0sz30_3096_c1_3938_4288 116
663 3300050516 nmdc:mga0sz30_430244_c1 nmdc:mga0sz30_430244_c1_68_418 116
664 3300050516 nmdc:mga0sz30_56529_c1 nmdc:mga0sz30_56529_c1_863_1234 116
665 3300053079 Ga0500610_0003136 Ga0500610_0003136_669_1022 116
666 3300053087 Ga0500643_009522 Ga0500643_009522_1440_1793 116
667 3300053096 Ga0500641_0165828 Ga0500641_0165828_417_767 116
668 3300053104 Ga0500556_0022575 Ga0500556_0022575_1002_1352 116
669 3300053104 Ga0500556_0387107 Ga0500556_0387107_174_527 116
670 3300053119 Ga0500595_074527 Ga0500595_074527_345_695 116
671 3300053153 Ga0500616_0024598 Ga0500616_0024598_2141_2491 116
672 3300053158 Ga0500627_0021180 Ga0500627_0021180_74_427 116
673 3300053158 Ga0500627_0250521 Ga0500627_0250521_23_376 116
674 3300053730 Ga0500645_098038 Ga0500645_098038_311_661 116
675 3300059504 Ga0587082_162021 Ga0587082_162021_57_407 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04341

DUF485

Protein of unknown function, DUF485

39

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nrb-assembly1.cif.gz_2 htric-hpfd class2 0.467 20 114
6nrb-assembly1.cif.gz_2 htric-hpfd class2 0.4384 20 114
5ndk-assembly2.cif.gz_L5 crystal structure of aminoglycoside tc007 co-crystallized with 70s ribosome from thermus thermophilus, three trnas and mrna 0.4193 1 36
5tcu-assembly1.cif.gz_LG methicillin sensitive staphylococcus aureus 70s ribosome 0.4084 1 36
5ip0-assembly1.cif.gz_D pha binding protein phap (phasin) 0.3584 16 114
ID Description Score Start End Superfamily
af_A0A2R8Q4E3_11_140_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.4308 15 107 1.20.1270.60
4wce200 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4199 1 36 1.10.287.3980
af_Q58427_1_163_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3995 16 115 1.10.287.1490
af_O54897_16_359_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.3878 1 106 3.40.50.720
af_A0A2R8Q4E3_11_140_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3691 15 107 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A3A6P0C1-F1-model_v4 DUF485 domain-containing protein 0.8658 19 111 GO:0005886
AF-A0A238Y6A9-F1-model_v4 Uncharacterized membrane protein, DUF485 family 0.8515 16 114 GO:0005886
AF-A0A7C1P1Z8-F1-model_v4 DUF485 domain-containing protein 0.8515 19 112 GO:0005886
AF-A0A837JF64-F1-model_v4 deleted 0.85 14 113
AF-A0A2G1YHX8-F1-model_v4 DUF485 domain-containing protein 0.8463 18 110 GO:0005886

Feature Viewer

pLDDT pTM Quality
80.52 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map