F474443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 675 | 306 | 662 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0308302|Ga0373947_0308302_472_873 |
| Length | 133 |
| Sequence | MCCEQTLSRRGQESALSDTDLPPAAATTTASRPQFVAVQASPEFQELRNRLRRFVFPMTVVFLLWYFAYVLLGAFAHDFMATAVWGNTNVGLLIGLGQFITTFLITGLYVRLANRELDPRAEAIRSELEGDEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 3 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 8 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 9 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 10 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 11 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 12 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 13 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 14 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 16 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 22 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 211 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 218 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 219 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 222 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 223 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 224 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 225 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 226 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 284 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 297 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 298 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 303 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 305 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.93 |
| Metatranscriptomes | 0.15 |
| Isolates | 1.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 13.78 |
| Nodule | 0 |
| Rhizoplane | 11.7 |
| Rhizosphere | 69.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1008898 | 3300000545 | Bacteria | 708 |
| 2 | LJNas_1005571 | 3300000546 | Bacteria | 1372 |
| 3 | JGI24746J21847_1007480 | 3300001977 | Bacteria | 1670 |
| 4 | JGI24737J22298_10029164 | 3300001990 | Bacteria | 1731 |
| 5 | JGI24737J22298_10063661 | 3300001990 | Bacteria | 1107 |
| 6 | JGI24743J22301_10001791 | 3300001991 | Bacteria | 3087 |
| 7 | JGI24743J22301_10002734 | 3300001991 | Bacteria | 2703 |
| 8 | JGI24743J22301_10011429 | 3300001991 | Bacteria | 1599 |
| 9 | JGI24735J21928_10141440 | 3300002067 | Bacteria | 694 |
| 10 | JGI24750J21931_1007375 | 3300002070 | Bacteria | 1384 |
| 11 | JGI24750J21931_1036327 | 3300002070 | Bacteria | 737 |
| 12 | JGI24745J21846_1001348 | 3300002073 | Bacteria | 2371 |
| 13 | JGI24745J21846_1010092 | 3300002073 | Bacteria | 1073 |
| 14 | JGI24748J21848_1031970 | 3300002074 | Bacteria | 652 |
| 15 | JGI24744J21845_10015734 | 3300002077 | Bacteria | 1509 |
| 16 | JGI24034J26672_10057437 | 3300002239 | Bacteria | 678 |
| 17 | rootH2_10034644 | 3300003320 | Bacteria | 1058 |
| 18 | Ga0055540_1007887 | 3300003792 | Bacteria | 3932 |
| 19 | Ga0055540_1011575 | 3300003792 | Bacteria | 2832 |
| 20 | Ga0070658_11337055 | 3300005327 | Bacteria | 622 |
| 21 | Ga0070676_10015143 | 3300005328 | Bacteria | 4252 |
| 22 | Ga0070690_100059616 | 3300005330 | Bacteria | 2454 |
| 23 | Ga0070690_100303148 | 3300005330 | Bacteria | 1146 |
| 24 | Ga0070690_101628578 | 3300005330 | Bacteria | 524 |
| 25 | Ga0070670_100090428 | 3300005331 | Bacteria | 2631 |
| 26 | Ga0068869_100008057 | 3300005334 | Bacteria | 6770 |
| 27 | Ga0068869_100021907 | 3300005334 | Bacteria | 4398 |
| 28 | Ga0070682_100012102 | 3300005337 | Bacteria | 4938 |
| 29 | Ga0070682_100267766 | 3300005337 | Bacteria | 1240 |
| 30 | Ga0068868_100079872 | 3300005338 | Bacteria | 2620 |
| 31 | Ga0068868_102108931 | 3300005338 | Bacteria | 536 |
| 32 | Ga0070660_100238175 | 3300005339 | Bacteria | 1482 |
| 33 | Ga0070689_100095533 | 3300005340 | Bacteria | 2348 |
| 34 | Ga0070691_10035636 | 3300005341 | Bacteria | 2343 |
| 35 | Ga0070692_10078416 | 3300005345 | Bacteria | 1774 |
| 36 | Ga0070692_10107574 | 3300005345 | Bacteria | 1538 |
| 37 | Ga0070668_100324173 | 3300005347 | Bacteria | 1298 |
| 38 | Ga0070668_100656973 | 3300005347 | Bacteria | 922 |
| 39 | Ga0070668_100747153 | 3300005347 | Bacteria | 866 |
| 40 | Ga0070669_100038971 | 3300005353 | Bacteria | 3451 |
| 41 | Ga0070669_100237998 | 3300005353 | Bacteria | 1445 |
| 42 | Ga0070669_101272459 | 3300005353 | Bacteria | 636 |
| 43 | Ga0070675_100625215 | 3300005354 | Bacteria | 978 |
| 44 | Ga0070671_100000857 | 3300005355 | Bacteria | 22171 |
| 45 | Ga0070671_100141076 | 3300005355 | Bacteria | 2033 |
| 46 | Ga0070671_100436034 | 3300005355 | Bacteria | 1123 |
| 47 | Ga0070674_100122704 | 3300005356 | Bacteria | 1925 |
| 48 | Ga0070674_100141080 | 3300005356 | Bacteria | 1808 |
| 49 | Ga0070674_100874008 | 3300005356 | Bacteria | 781 |
| 50 | Ga0070673_100038612 | 3300005364 | Bacteria | 3647 |
| 51 | Ga0070688_100008672 | 3300005365 | Bacteria | 5532 |
| 52 | Ga0070688_100287600 | 3300005365 | Bacteria | 1183 |
| 53 | Ga0070659_100046646 | 3300005366 | Bacteria | 3396 |
| 54 | Ga0070659_101013032 | 3300005366 | Bacteria | 729 |
| 55 | Ga0070667_100014633 | 3300005367 | Bacteria | 6483 |
| 56 | Ga0070667_100024791 | 3300005367 | Bacteria | 4983 |
| 57 | Ga0070667_100046868 | 3300005367 | Bacteria | 3636 |
| 58 | Ga0070667_100172254 | 3300005367 | Bacteria | 1911 |
| 59 | Ga0070703_10044398 | 3300005406 | Bacteria | 1397 |
| 60 | Ga0070709_10020853 | 3300005434 | Bacteria | 3812 |
| 61 | Ga0070709_10044036 | 3300005434 | Bacteria | 2763 |
| 62 | Ga0070709_11372007 | 3300005434 | Bacteria | 572 |
| 63 | Ga0070714_100204251 | 3300005435 | Bacteria | 1809 |
| 64 | Ga0070714_100868644 | 3300005435 | Bacteria | 875 |
| 65 | Ga0070710_10025085 | 3300005437 | Bacteria | 3153 |
| 66 | Ga0070710_10255745 | 3300005437 | Bacteria | 1127 |
| 67 | Ga0070701_10006664 | 3300005438 | Bacteria | 4877 |
| 68 | Ga0070701_10402488 | 3300005438 | Bacteria | 868 |
| 69 | Ga0070711_100009282 | 3300005439 | Bacteria | 6050 |
| 70 | Ga0070711_100045137 | 3300005439 | Bacteria | 2995 |
| 71 | Ga0070711_101211743 | 3300005439 | Bacteria | 653 |
| 72 | Ga0070705_100008684 | 3300005440 | Bacteria | 5033 |
| 73 | Ga0070705_100034476 | 3300005440 | Bacteria | 2830 |
| 74 | Ga0070705_100502240 | 3300005440 | Bacteria | 921 |
| 75 | Ga0070700_100012377 | 3300005441 | Bacteria | 4757 |
| 76 | Ga0070700_100158511 | 3300005441 | Bacteria | 1555 |
| 77 | Ga0070694_100414025 | 3300005444 | Bacteria | 1058 |
| 78 | Ga0070694_101113937 | 3300005444 | Bacteria | 659 |
| 79 | Ga0070694_101527304 | 3300005444 | Bacteria | 566 |
| 80 | Ga0070708_100691813 | 3300005445 | Bacteria | 960 |
| 81 | Ga0070708_100772925 | 3300005445 | Bacteria | 903 |
| 82 | Ga0070663_100108732 | 3300005455 | Bacteria | 2080 |
| 83 | Ga0070663_100124028 | 3300005455 | Bacteria | 1954 |
| 84 | Ga0070663_100526198 | 3300005455 | Bacteria | 985 |
| 85 | Ga0070663_100734306 | 3300005455 | Bacteria | 842 |
| 86 | Ga0070663_101126384 | 3300005455 | Bacteria | 687 |
| 87 | Ga0070678_100143543 | 3300005456 | Bacteria | 1913 |
| 88 | Ga0070678_100538377 | 3300005456 | Bacteria | 1035 |
| 89 | Ga0070678_100756139 | 3300005456 | Bacteria | 879 |
| 90 | Ga0070678_101272135 | 3300005456 | Bacteria | 684 |
| 91 | Ga0070662_100016536 | 3300005457 | Bacteria | 4955 |
| 92 | Ga0068867_100056119 | 3300005459 | Bacteria | 2913 |
| 93 | Ga0068867_100278860 | 3300005459 | Bacteria | 1370 |
| 94 | Ga0068867_100375852 | 3300005459 | Bacteria | 1192 |
| 95 | Ga0070685_10018635 | 3300005466 | Bacteria | 3736 |
| 96 | Ga0070685_10160402 | 3300005466 | Bacteria | 1433 |
| 97 | Ga0070685_10446867 | 3300005466 | Bacteria | 905 |
| 98 | Ga0070706_100989546 | 3300005467 | Bacteria | 776 |
| 99 | Ga0070684_100645324 | 3300005535 | Bacteria | 985 |
| 100 | Ga0070697_100183356 | 3300005536 | Bacteria | 1775 |
| 101 | Ga0068853_100011121 | 3300005539 | Bacteria | 7301 |
| 102 | Ga0068853_100035712 | 3300005539 | Bacteria | 4223 |
| 103 | Ga0068853_100952425 | 3300005539 | Bacteria | 825 |
| 104 | Ga0070672_100113767 | 3300005543 | Bacteria | 2209 |
| 105 | Ga0070672_100197703 | 3300005543 | Bacteria | 1680 |
| 106 | Ga0070672_101016539 | 3300005543 | Bacteria | 735 |
| 107 | Ga0070686_100139150 | 3300005544 | Bacteria | 1688 |
| 108 | Ga0070686_100354286 | 3300005544 | Bacteria | 1104 |
| 109 | Ga0070695_100064159 | 3300005545 | Bacteria | 2389 |
| 110 | Ga0070695_100344571 | 3300005545 | Bacteria | 1114 |
| 111 | Ga0070696_100045285 | 3300005546 | Bacteria | 3048 |
| 112 | Ga0070696_100151457 | 3300005546 | Bacteria | 1703 |
| 113 | Ga0070693_100061425 | 3300005547 | Bacteria | 2184 |
| 114 | Ga0070693_100271288 | 3300005547 | Bacteria | 1133 |
| 115 | Ga0070665_100016906 | 3300005548 | Bacteria | 7314 |
| 116 | Ga0070665_100021400 | 3300005548 | Bacteria | 6505 |
| 117 | Ga0070665_100031399 | 3300005548 | Bacteria | 5348 |
| 118 | Ga0070665_100654064 | 3300005548 | Bacteria | 1064 |
| 119 | Ga0070665_101003272 | 3300005548 | Bacteria | 847 |
| 120 | Ga0070665_102330529 | 3300005548 | Bacteria | 538 |
| 121 | Ga0070704_100005943 | 3300005549 | Bacteria | 7152 |
| 122 | Ga0068855_100194985 | 3300005563 | Bacteria | 2282 |
| 123 | Ga0068855_100604067 | 3300005563 | Bacteria | 1183 |
| 124 | Ga0068854_100040527 | 3300005578 | Bacteria | 3286 |
| 125 | Ga0068854_100491939 | 3300005578 | Bacteria | 1031 |
| 126 | Ga0068856_100067702 | 3300005614 | Bacteria | 3529 |
| 127 | Ga0068856_100414663 | 3300005614 | Bacteria | 1367 |
| 128 | Ga0070702_100003765 | 3300005615 | Bacteria | 6845 |
| 129 | Ga0070702_100056656 | 3300005615 | Bacteria | 2264 |
| 130 | Ga0070702_101140048 | 3300005615 | Bacteria | 625 |
| 131 | Ga0070702_101166469 | 3300005615 | Bacteria | 619 |
| 132 | Ga0068852_100067766 | 3300005616 | Bacteria | 3121 |
| 133 | Ga0068852_100182432 | 3300005616 | Bacteria | 1975 |
| 134 | Ga0068852_100405373 | 3300005616 | Bacteria | 1342 |
| 135 | Ga0068859_100022466 | 3300005617 | Bacteria | 6325 |
| 136 | Ga0068859_100668204 | 3300005617 | Bacteria | 1130 |
| 137 | Ga0068859_101527603 | 3300005617 | Bacteria | 737 |
| 138 | Ga0068859_103005510 | 3300005617 | Bacteria | 515 |
| 139 | Ga0068864_100028130 | 3300005618 | Bacteria | 4751 |
| 140 | Ga0068864_100612579 | 3300005618 | Bacteria | 1057 |
| 141 | Ga0068866_10007981 | 3300005718 | Bacteria | 4445 |
| 142 | Ga0068861_100006167 | 3300005719 | Bacteria | 8157 |
| 143 | Ga0068861_100040051 | 3300005719 | Bacteria | 3501 |
| 144 | Ga0068861_100150036 | 3300005719 | Bacteria | 1912 |
| 145 | Ga0068861_100325032 | 3300005719 | Bacteria | 1341 |
| 146 | Ga0068861_101269883 | 3300005719 | Bacteria | 715 |
| 147 | Ga0068851_10131088 | 3300005834 | Bacteria | 1356 |
| 148 | Ga0068870_10081998 | 3300005840 | Bacteria | 1785 |
| 149 | Ga0068870_11454442 | 3300005840 | Bacteria | 503 |
| 150 | Ga0068863_100005929 | 3300005841 | Bacteria | 11985 |
| 151 | Ga0068863_100173939 | 3300005841 | Bacteria | 2066 |
| 152 | Ga0068863_100300342 | 3300005841 | Bacteria | 1557 |
| 153 | Ga0068863_100558697 | 3300005841 | Bacteria | 1130 |
| 154 | Ga0068858_100013663 | 3300005842 | Bacteria | 7663 |
| 155 | Ga0068858_100456722 | 3300005842 | Bacteria | 1231 |
| 156 | Ga0068858_101198998 | 3300005842 | Bacteria | 746 |
| 157 | Ga0068858_101487028 | 3300005842 | Bacteria | 668 |
| 158 | Ga0068858_101557677 | 3300005842 | Bacteria | 652 |
| 159 | Ga0068860_100108853 | 3300005843 | Bacteria | 2648 |
| 160 | Ga0068860_100204393 | 3300005843 | Bacteria | 1915 |
| 161 | Ga0068860_100237707 | 3300005843 | Bacteria | 1771 |
| 162 | Ga0068860_100728776 | 3300005843 | Bacteria | 1002 |
| 163 | Ga0068862_100081840 | 3300005844 | Bacteria | 2801 |
| 164 | Ga0068862_100219149 | 3300005844 | Bacteria | 1722 |
| 165 | Ga0068862_100230913 | 3300005844 | Bacteria | 1678 |
| 166 | Ga0068862_101025704 | 3300005844 | Bacteria | 817 |
| 167 | Ga0081455_10034648 | 3300005937 | Bacteria | 4521 |
| 168 | Ga0081455_10342537 | 3300005937 | Bacteria | 1057 |
| 169 | Ga0075365_10002877 | 3300006038 | Bacteria | 8663 |
| 170 | Ga0075365_10010694 | 3300006038 | Bacteria | 5359 |
| 171 | Ga0075365_10710686 | 3300006038 | Bacteria | 710 |
| 172 | Ga0075368_10106891 | 3300006042 | Bacteria | 1152 |
| 173 | Ga0075363_100003870 | 3300006048 | Bacteria | 6457 |
| 174 | Ga0075363_100140754 | 3300006048 | Bacteria | 1358 |
| 175 | Ga0075363_100454852 | 3300006048 | Bacteria | 757 |
| 176 | Ga0075364_10002232 | 3300006051 | Bacteria | 10864 |
| 177 | Ga0075364_10017167 | 3300006051 | Bacteria | 4517 |
| 178 | Ga0075364_10069743 | 3300006051 | Bacteria | 2313 |
| 179 | Ga0075364_10071145 | 3300006051 | Bacteria | 2291 |
| 180 | Ga0075364_10523376 | 3300006051 | Bacteria | 811 |
| 181 | Ga0075364_10811186 | 3300006051 | Bacteria | 638 |
| 182 | Ga0075364_11173153 | 3300006051 | Bacteria | 521 |
| 183 | Ga0070715_10011748 | 3300006163 | Bacteria | 3162 |
| 184 | Ga0070716_100004343 | 3300006173 | Bacteria | 6764 |
| 185 | Ga0070716_100080091 | 3300006173 | Bacteria | 1947 |
| 186 | Ga0070716_100725336 | 3300006173 | Bacteria | 762 |
| 187 | Ga0070716_101484731 | 3300006173 | Bacteria | 554 |
| 188 | Ga0070712_100014032 | 3300006175 | Bacteria | 5135 |
| 189 | Ga0070712_100036147 | 3300006175 | Bacteria | 3358 |
| 190 | Ga0075362_10010772 | 3300006177 | Bacteria | 3581 |
| 191 | Ga0075362_10043625 | 3300006177 | Bacteria | 1986 |
| 192 | Ga0075362_10192077 | 3300006177 | Bacteria | 992 |
| 193 | Ga0075362_10303719 | 3300006177 | Bacteria | 792 |
| 194 | Ga0075367_10001961 | 3300006178 | Bacteria | 9153 |
| 195 | Ga0075367_10471429 | 3300006178 | Bacteria | 796 |
| 196 | Ga0075369_10000801 | 3300006186 | Bacteria | 10310 |
| 197 | Ga0075369_10003710 | 3300006186 | Bacteria | 5583 |
| 198 | Ga0075369_10004851 | 3300006186 | Bacteria | 5003 |
| 199 | Ga0075369_10017113 | 3300006186 | Bacteria | 2933 |
| 200 | Ga0075369_10061230 | 3300006186 | Bacteria | 1643 |
| 201 | Ga0075369_10070805 | 3300006186 | Bacteria | 1534 |
| 202 | Ga0075369_10106036 | 3300006186 | Bacteria | 1264 |
| 203 | Ga0075369_10107221 | 3300006186 | Bacteria | 1257 |
| 204 | Ga0075369_10157820 | 3300006186 | Bacteria | 1039 |
| 205 | Ga0075369_10159680 | 3300006186 | Bacteria | 1033 |
| 206 | Ga0075369_10341956 | 3300006186 | Bacteria | 701 |
| 207 | Ga0075369_10413936 | 3300006186 | Bacteria | 636 |
| 208 | Ga0075366_10087610 | 3300006195 | Bacteria | 1864 |
| 209 | Ga0075366_11003370 | 3300006195 | Bacteria | 521 |
| 210 | Ga0097621_100086416 | 3300006237 | Bacteria | 2617 |
| 211 | Ga0097621_100137376 | 3300006237 | Bacteria | 2086 |
| 212 | Ga0075370_10013411 | 3300006353 | Bacteria | 4355 |
| 213 | Ga0075370_10022413 | 3300006353 | Bacteria | 3468 |
| 214 | Ga0075370_10042506 | 3300006353 | Bacteria | 2568 |
| 215 | Ga0075370_10054036 | 3300006353 | Bacteria | 2280 |
| 216 | Ga0075370_10588892 | 3300006353 | Bacteria | 674 |
| 217 | Ga0068871_100053608 | 3300006358 | Bacteria | 3269 |
| 218 | Ga0068871_100158450 | 3300006358 | Bacteria | 1934 |
| 219 | Ga0075430_100004258 | 3300006846 | Bacteria | 12089 |
| 220 | Ga0075431_100036015 | 3300006847 | Bacteria | 5097 |
| 221 | Ga0075433_10848879 | 3300006852 | Bacteria | 797 |
| 222 | Ga0068865_100067444 | 3300006881 | Bacteria | 2527 |
| 223 | Ga0068865_100100518 | 3300006881 | Bacteria | 2116 |
| 224 | Ga0068865_100103728 | 3300006881 | Bacteria | 2086 |
| 225 | Ga0068865_100924054 | 3300006881 | Bacteria | 760 |
| 226 | Ga0097620_100022468 | 3300006931 | Bacteria | 6325 |
| 227 | Ga0097620_100668176 | 3300006931 | Bacteria | 1130 |
| 228 | Ga0097620_101527560 | 3300006931 | Bacteria | 737 |
| 229 | Ga0097620_103003244 | 3300006931 | Bacteria | 515 |
| 230 | Ga0105250_10071661 | 3300009092 | Bacteria | 1400 |
| 231 | Ga0105250_10216707 | 3300009092 | Bacteria | 811 |
| 232 | Ga0105240_10596107 | 3300009093 | Bacteria | 1217 |
| 233 | Ga0111539_10347611 | 3300009094 | Bacteria | 1726 |
| 234 | Ga0105245_10080640 | 3300009098 | Bacteria | 2973 |
| 235 | Ga0105245_10475146 | 3300009098 | Bacteria | 1262 |
| 236 | Ga0105245_11511294 | 3300009098 | Bacteria | 722 |
| 237 | Ga0105245_11551992 | 3300009098 | Bacteria | 713 |
| 238 | Ga0105247_10007780 | 3300009101 | Bacteria | 6556 |
| 239 | Ga0105247_10023605 | 3300009101 | Bacteria | 3706 |
| 240 | Ga0105247_10416842 | 3300009101 | Bacteria | 960 |
| 241 | Ga0114129_10002202 | 3300009147 | Bacteria | 26854 |
| 242 | Ga0105243_10042382 | 3300009148 | Bacteria | 3563 |
| 243 | Ga0105243_10051033 | 3300009148 | Bacteria | 3270 |
| 244 | Ga0105243_11277545 | 3300009148 | Bacteria | 750 |
| 245 | Ga0105241_11512507 | 3300009174 | Bacteria | 646 |
| 246 | Ga0105242_10386822 | 3300009176 | Bacteria | 1302 |
| 247 | Ga0105242_10576480 | 3300009176 | Bacteria | 1083 |
| 248 | Ga0105248_10094559 | 3300009177 | Bacteria | 3365 |
| 249 | Ga0105248_10230982 | 3300009177 | Bacteria | 2083 |
| 250 | Ga0105248_10429279 | 3300009177 | Bacteria | 1488 |
| 251 | Ga0105248_10801240 | 3300009177 | Bacteria | 1063 |
| 252 | Ga0105237_10004358 | 3300009545 | Bacteria | 16404 |
| 253 | Ga0105237_10089465 | 3300009545 | Bacteria | 3068 |
| 254 | Ga0105237_10181117 | 3300009545 | Bacteria | 2107 |
| 255 | Ga0105238_10156407 | 3300009551 | Bacteria | 2255 |
| 256 | Ga0105238_10360030 | 3300009551 | Bacteria | 1444 |
| 257 | Ga0105238_10493373 | 3300009551 | Bacteria | 1225 |
| 258 | Ga0105249_10007627 | 3300009553 | Bacteria | 9439 |
| 259 | Ga0105249_10327740 | 3300009553 | Bacteria | 1544 |
| 260 | Ga0105249_10700148 | 3300009553 | Bacteria | 1073 |
| 261 | Ga0105249_12448528 | 3300009553 | Bacteria | 594 |
| 262 | Ga0105239_10004760 | 3300010375 | Bacteria | 16109 |
| 263 | Ga0105239_10033724 | 3300010375 | Bacteria | 5621 |
| 264 | Ga0105239_10167192 | 3300010375 | Bacteria | 2459 |
| 265 | Ga0105239_11444143 | 3300010375 | Bacteria | 794 |
| 266 | Ga0105246_10019015 | 3300011119 | Bacteria | 4382 |
| 267 | Ga0105246_10216940 | 3300011119 | Bacteria | 1497 |
| 268 | Ga0105246_10354401 | 3300011119 | Bacteria | 1203 |
| 269 | Ga0105246_11772565 | 3300011119 | Bacteria | 589 |
| 270 | Ga0157373_10316988 | 3300013100 | Bacteria | 1109 |
| 271 | Ga0157370_11209071 | 3300013104 | Bacteria | 682 |
| 272 | Ga0157374_10008988 | 3300013296 | Bacteria | 8567 |
| 273 | Ga0157378_10001889 | 3300013297 | Bacteria | 18796 |
| 274 | Ga0157378_10013540 | 3300013297 | Bacteria | 7134 |
| 275 | Ga0157378_10239805 | 3300013297 | Bacteria | 1731 |
| 276 | Ga0163162_10345240 | 3300013306 | Bacteria | 1621 |
| 277 | Ga0163162_10704726 | 3300013306 | Bacteria | 1131 |
| 278 | Ga0163162_12869155 | 3300013306 | Bacteria | 555 |
| 279 | Ga0157372_10034051 | 3300013307 | Bacteria | 5597 |
| 280 | Ga0157372_10048715 | 3300013307 | Bacteria | 4710 |
| 281 | Ga0157375_10026596 | 3300013308 | Bacteria | 5396 |
| 282 | Ga0157375_10230852 | 3300013308 | Bacteria | 2009 |
| 283 | Ga0163163_10078441 | 3300014325 | Bacteria | 3299 |
| 284 | Ga0163163_10291943 | 3300014325 | Bacteria | 1683 |
| 285 | Ga0163163_11219562 | 3300014325 | Bacteria | 815 |
| 286 | Ga0163163_11383120 | 3300014325 | Bacteria | 765 |
| 287 | Ga0157380_10156676 | 3300014326 | Bacteria | 1975 |
| 288 | Ga0157380_10181210 | 3300014326 | Bacteria | 1851 |
| 289 | Ga0157377_10007569 | 3300014745 | Bacteria | 5253 |
| 290 | Ga0157377_10028023 | 3300014745 | Bacteria | 3029 |
| 291 | Ga0157377_10043487 | 3300014745 | Bacteria | 2500 |
| 292 | Ga0157379_10005060 | 3300014968 | Bacteria | 11303 |
| 293 | Ga0157379_10188698 | 3300014968 | Bacteria | 1863 |
| 294 | Ga0157376_10124505 | 3300014969 | Bacteria | 2290 |
| 295 | Ga0157376_10424581 | 3300014969 | Bacteria | 1291 |
| 296 | Ga0163161_10060621 | 3300017792 | Bacteria | 2754 |
| 297 | Ga0163161_10118740 | 3300017792 | Bacteria | 1985 |
| 298 | Ga0163161_10417287 | 3300017792 | Bacteria | 1079 |
| 299 | Ga0163161_10424957 | 3300017792 | Bacteria | 1070 |
| 300 | Ga0213876_10008455 | 3300021384 | Bacteria | 5572 |
| 301 | Ga0213876_10116274 | 3300021384 | Bacteria | 1419 |
| 302 | Ga0209673_1003416 | 3300025273 | Bacteria | 9404 |
| 303 | Ga0209051_1000582 | 3300025303 | Bacteria | 43455 |
| 304 | Ga0209051_1007231 | 3300025303 | Bacteria | 6105 |
| 305 | Ga0209051_1009421 | 3300025303 | Bacteria | 5038 |
| 306 | Ga0209051_1066940 | 3300025303 | Bacteria | 1101 |
| 307 | Ga0207653_10021277 | 3300025885 | Bacteria | 2057 |
| 308 | Ga0207692_10056043 | 3300025898 | Bacteria | 2020 |
| 309 | Ga0207692_10106246 | 3300025898 | Bacteria | 1550 |
| 310 | Ga0207710_10319674 | 3300025900 | Bacteria | 787 |
| 311 | Ga0207688_10000065 | 3300025901 | Bacteria | 38587 |
| 312 | Ga0207688_10020310 | 3300025901 | Bacteria | 3626 |
| 313 | Ga0207688_10049235 | 3300025901 | Bacteria | 2355 |
| 314 | Ga0207647_10033458 | 3300025904 | Bacteria | 3292 |
| 315 | Ga0207685_10005908 | 3300025905 | Bacteria | 3282 |
| 316 | Ga0207685_10304202 | 3300025905 | Bacteria | 790 |
| 317 | Ga0207699_10747600 | 3300025906 | Bacteria | 717 |
| 318 | Ga0207645_10261169 | 3300025907 | Bacteria | 1147 |
| 319 | Ga0207643_10028172 | 3300025908 | Bacteria | 3118 |
| 320 | Ga0207705_11333251 | 3300025909 | Bacteria | 547 |
| 321 | Ga0207654_10495909 | 3300025911 | Bacteria | 862 |
| 322 | Ga0207671_10078683 | 3300025914 | Bacteria | 2470 |
| 323 | Ga0207671_10158046 | 3300025914 | Bacteria | 1754 |
| 324 | Ga0207671_11254625 | 3300025914 | Bacteria | 578 |
| 325 | Ga0207693_10001726 | 3300025915 | Bacteria | 19214 |
| 326 | Ga0207693_10023850 | 3300025915 | Bacteria | 4856 |
| 327 | Ga0207663_10036882 | 3300025916 | Bacteria | 2943 |
| 328 | Ga0207663_10184051 | 3300025916 | Bacteria | 1494 |
| 329 | Ga0207657_10087486 | 3300025919 | Bacteria | 2606 |
| 330 | Ga0207657_10611390 | 3300025919 | Bacteria | 850 |
| 331 | Ga0207681_10100487 | 3300025923 | Bacteria | 2085 |
| 332 | Ga0207681_10166464 | 3300025923 | Bacteria | 1667 |
| 333 | Ga0207681_11755124 | 3300025923 | Bacteria | 518 |
| 334 | Ga0207694_10101524 | 3300025924 | Bacteria | 2280 |
| 335 | Ga0207694_10260973 | 3300025924 | Bacteria | 1419 |
| 336 | Ga0207694_11168984 | 3300025924 | Bacteria | 651 |
| 337 | Ga0207650_10049033 | 3300025925 | Bacteria | 3117 |
| 338 | Ga0207687_10867540 | 3300025927 | Bacteria | 772 |
| 339 | Ga0207700_10814887 | 3300025928 | Bacteria | 835 |
| 340 | Ga0207664_10619014 | 3300025929 | Bacteria | 973 |
| 341 | Ga0207644_10003277 | 3300025931 | Bacteria | 10461 |
| 342 | Ga0207644_10109818 | 3300025931 | Bacteria | 2084 |
| 343 | Ga0207644_10262597 | 3300025931 | Bacteria | 1381 |
| 344 | Ga0207644_10375984 | 3300025931 | Bacteria | 1158 |
| 345 | Ga0207690_10833293 | 3300025932 | Bacteria | 763 |
| 346 | Ga0207706_10011834 | 3300025933 | Bacteria | 7945 |
| 347 | Ga0207706_10036470 | 3300025933 | Bacteria | 4367 |
| 348 | Ga0207686_10364792 | 3300025934 | Bacteria | 1091 |
| 349 | Ga0207686_10401446 | 3300025934 | Bacteria | 1044 |
| 350 | Ga0207686_10715430 | 3300025934 | Bacteria | 797 |
| 351 | Ga0207709_10307012 | 3300025935 | Bacteria | 1182 |
| 352 | Ga0207670_10191100 | 3300025936 | Bacteria | 1549 |
| 353 | Ga0207670_11511669 | 3300025936 | Bacteria | 571 |
| 354 | Ga0207670_11715189 | 3300025936 | Bacteria | 534 |
| 355 | Ga0207669_10311715 | 3300025937 | Bacteria | 1200 |
| 356 | Ga0207669_11628184 | 3300025937 | Bacteria | 551 |
| 357 | Ga0207704_10088130 | 3300025938 | Bacteria | 2029 |
| 358 | Ga0207704_10205845 | 3300025938 | Bacteria | 1444 |
| 359 | Ga0207665_10004137 | 3300025939 | Bacteria | 9666 |
| 360 | Ga0207665_10009561 | 3300025939 | Bacteria | 6368 |
| 361 | Ga0207665_11273491 | 3300025939 | Bacteria | 586 |
| 362 | Ga0207691_10033722 | 3300025940 | Bacteria | 4766 |
| 363 | Ga0207691_10044140 | 3300025940 | Bacteria | 4105 |
| 364 | Ga0207691_10517640 | 3300025940 | Bacteria | 1012 |
| 365 | Ga0207711_10148383 | 3300025941 | Bacteria | 2114 |
| 366 | Ga0207711_10685548 | 3300025941 | Bacteria | 956 |
| 367 | Ga0207711_10924382 | 3300025941 | Bacteria | 811 |
| 368 | Ga0207711_11605567 | 3300025941 | Bacteria | 594 |
| 369 | Ga0207689_10009506 | 3300025942 | Bacteria | 8394 |
| 370 | Ga0207689_10013320 | 3300025942 | Bacteria | 7016 |
| 371 | Ga0207667_10107828 | 3300025949 | Bacteria | 2874 |
| 372 | Ga0207667_10448321 | 3300025949 | Bacteria | 1311 |
| 373 | Ga0207712_10525710 | 3300025961 | Bacteria | 1014 |
| 374 | Ga0207712_10907934 | 3300025961 | Bacteria | 779 |
| 375 | Ga0207668_10322500 | 3300025972 | Bacteria | 1282 |
| 376 | Ga0207668_10534520 | 3300025972 | Bacteria | 1013 |
| 377 | Ga0207668_11999033 | 3300025972 | Bacteria | 522 |
| 378 | Ga0207640_10050976 | 3300025981 | Bacteria | 2688 |
| 379 | Ga0207658_10007890 | 3300025986 | Bacteria | 7250 |
| 380 | Ga0207658_10106296 | 3300025986 | Bacteria | 2209 |
| 381 | Ga0207658_10183170 | 3300025986 | Bacteria | 1735 |
| 382 | Ga0207658_10185707 | 3300025986 | Bacteria | 1724 |
| 383 | Ga0207677_10065309 | 3300026023 | Bacteria | 2538 |
| 384 | Ga0207677_10130254 | 3300026023 | Bacteria | 1909 |
| 385 | Ga0207677_10146556 | 3300026023 | Bacteria | 1815 |
| 386 | Ga0207703_10238958 | 3300026035 | Bacteria | 1632 |
| 387 | Ga0207703_10456380 | 3300026035 | Bacteria | 1194 |
| 388 | Ga0207703_11054861 | 3300026035 | Bacteria | 780 |
| 389 | Ga0207639_10127105 | 3300026041 | Bacteria | 2104 |
| 390 | Ga0207678_10027949 | 3300026067 | Bacteria | 4925 |
| 391 | Ga0207678_10030159 | 3300026067 | Bacteria | 4734 |
| 392 | Ga0207678_10435338 | 3300026067 | Bacteria | 1138 |
| 393 | Ga0207678_10654059 | 3300026067 | Bacteria | 923 |
| 394 | Ga0207678_11154605 | 3300026067 | Bacteria | 686 |
| 395 | Ga0207708_10001834 | 3300026075 | Bacteria | 15673 |
| 396 | Ga0207708_10036418 | 3300026075 | Bacteria | 3746 |
| 397 | Ga0207702_10368087 | 3300026078 | Bacteria | 1379 |
| 398 | Ga0207702_11872890 | 3300026078 | Bacteria | 591 |
| 399 | Ga0207641_10017084 | 3300026088 | Bacteria | 5936 |
| 400 | Ga0207641_10364065 | 3300026088 | Bacteria | 1381 |
| 401 | Ga0207641_10484525 | 3300026088 | Bacteria | 1199 |
| 402 | Ga0207641_10535798 | 3300026088 | Bacteria | 1140 |
| 403 | Ga0207641_10795337 | 3300026088 | Bacteria | 935 |
| 404 | Ga0207648_10075782 | 3300026089 | Bacteria | 2932 |
| 405 | Ga0207648_10082205 | 3300026089 | Bacteria | 2809 |
| 406 | Ga0207648_10538071 | 3300026089 | Bacteria | 1072 |
| 407 | Ga0207676_10055132 | 3300026095 | Bacteria | 3119 |
| 408 | Ga0207676_11231628 | 3300026095 | Bacteria | 742 |
| 409 | Ga0207675_100007395 | 3300026118 | Bacteria | 10379 |
| 410 | Ga0207675_100024109 | 3300026118 | Bacteria | 5657 |
| 411 | Ga0207675_100077852 | 3300026118 | Bacteria | 3107 |
| 412 | Ga0207675_100400880 | 3300026118 | Bacteria | 1352 |
| 413 | Ga0207675_100928953 | 3300026118 | Bacteria | 887 |
| 414 | Ga0207683_10007249 | 3300026121 | Bacteria | 9503 |
| 415 | Ga0207683_10061095 | 3300026121 | Bacteria | 3315 |
| 416 | Ga0207698_10093348 | 3300026142 | Bacteria | 2470 |
| 417 | Ga0207698_10331232 | 3300026142 | Bacteria | 1430 |
| 418 | Ga0207698_12427571 | 3300026142 | Bacteria | 535 |
| 419 | Ga0209813_10037898 | 3300027866 | Bacteria | 1454 |
| 420 | Ga0268266_10003919 | 3300028379 | Bacteria | 14469 |
| 421 | Ga0268266_10025990 | 3300028379 | Bacteria | 4980 |
| 422 | Ga0268266_10120380 | 3300028379 | Bacteria | 2335 |
| 423 | Ga0268266_10779366 | 3300028379 | Bacteria | 923 |
| 424 | Ga0268266_10784606 | 3300028379 | Bacteria | 920 |
| 425 | Ga0268265_10065964 | 3300028380 | Bacteria | 2796 |
| 426 | Ga0268265_10573526 | 3300028380 | Bacteria | 1074 |
| 427 | Ga0268265_10730222 | 3300028380 | Bacteria | 959 |
| 428 | Ga0268265_10770872 | 3300028380 | Bacteria | 935 |
| 429 | Ga0268264_10069268 | 3300028381 | Bacteria | 2983 |
| 430 | Ga0268264_10390284 | 3300028381 | Bacteria | 1335 |
| 431 | Ga0268264_10534760 | 3300028381 | Bacteria | 1148 |
| 432 | Ga0268264_11033272 | 3300028381 | Bacteria | 829 |
| 433 | Ga0307405_10240049 | 3300031731 | Bacteria | 1342 |
| 434 | Ga0307405_11091281 | 3300031731 | Bacteria | 685 |
| 435 | Ga0307413_10238879 | 3300031824 | Bacteria | 1340 |
| 436 | Ga0307410_10304982 | 3300031852 | Bacteria | 1258 |
| 437 | Ga0307406_10021356 | 3300031901 | Bacteria | 3828 |
| 438 | Ga0307412_10103862 | 3300031911 | Bacteria | 2015 |
| 439 | Ga0307409_100203150 | 3300031995 | Bacteria | 1775 |
| 440 | Ga0307409_100353045 | 3300031995 | Bacteria | 1388 |
| 441 | Ga0307416_100756001 | 3300032002 | Bacteria | 1065 |
| 442 | Ga0307416_100918919 | 3300032002 | Bacteria | 976 |
| 443 | Ga0307416_103461341 | 3300032002 | Bacteria | 528 |
| 444 | Ga0307414_11137313 | 3300032004 | Bacteria | 722 |
| 445 | Ga0307411_10179669 | 3300032005 | Bacteria | 1605 |
| 446 | Ga0373959_0073846 | 3300034820 | Bacteria | 775 |
| 447 | Ga0373928_0174053 | 3300035084 | Bacteria | 608 |
| 448 | Ga0373960_0062491 | 3300035121 | Bacteria | 1133 |
| 449 | Ga0373942_0087120 | 3300035207 | Bacteria | 936 |
| 450 | Ga0373942_0113639 | 3300035207 | Bacteria | 840 |
| 451 | Ga0373961_0208109 | 3300035241 | Bacteria | 693 |
| 452 | Ga0373961_0427135 | 3300035241 | Bacteria | 513 |
| 453 | Ga0373962_0130260 | 3300035242 | Bacteria | 809 |
| 454 | Ga0373931_0014323 | 3300035691 | Bacteria | 3873 |
| 455 | Ga0373931_0025634 | 3300035691 | Bacteria | 2995 |
| 456 | Ga0373947_0308302 | 3300035725 | Bacteria | 1057 |
| 457 | Ga0316582_0148261 | 3300036647 | Bacteria | 1585 |
| 458 | Ga0316584_0014880 | 3300036712 | Bacteria | 5557 |
| 459 | Ga0436364_1504233 | 3300037853 | Bacteria | 926 |
| 460 | Ga0436365_0772403 | 3300039437 | Bacteria | 19656 |
| 461 | Ga0436365_0987088 | 3300039437 | Bacteria | 25400 |
| 462 | Ga0436360_0360375 | 3300039438 | Bacteria | 554 |
| 463 | Ga0436361_0536289 | 3300039447 | Bacteria | 545 |
| 464 | Ga0436361_0556079 | 3300039447 | Bacteria | 1466 |
| 465 | Ga0439461_0000589 | 3300041410 | Bacteria | 5260 |
| 466 | Ga0439461_0045365 | 3300041410 | Bacteria | 961 |
| 467 | Ga0439466_0001299 | 3300041411 | Bacteria | 9723 |
| 468 | Ga0439466_0021836 | 3300041411 | Bacteria | 2264 |
| 469 | Ga0439466_0030016 | 3300041411 | Bacteria | 1867 |
| 470 | Ga0439465_0009519 | 3300041413 | Bacteria | 3060 |
| 471 | Ga0439465_0017121 | 3300041413 | Bacteria | 2261 |
| 472 | Ga0439465_0261742 | 3300041413 | Bacteria | 641 |
| 473 | Ga0451787_497249 | 3300041441 | Bacteria | 532 |
| 474 | Ga0451800_1001123 | 3300041459 | Bacteria | 950 |
| 475 | Ga0439431_0000730 | 3300041997 | Bacteria | 7093 |
| 476 | Ga0439431_0068457 | 3300041997 | Bacteria | 943 |
| 477 | Ga0439442_010560 | 3300042002 | Bacteria | 1874 |
| 478 | Ga0439443_118577 | 3300042003 | Bacteria | 518 |
| 479 | Ga0439445_0000885 | 3300042004 | Bacteria | 6348 |
| 480 | Ga0439445_0011393 | 3300042004 | Bacteria | 2120 |
| 481 | Ga0439445_0099403 | 3300042004 | Bacteria | 824 |
| 482 | Ga0439434_0104929 | 3300042435 | Bacteria | 912 |
| 483 | Ga0439459_0027248 | 3300042438 | Bacteria | 1140 |
| 484 | Ga0466972_0023450 | 3300044658 | Bacteria | 3069 |
| 485 | Ga0466965_0039330 | 3300044683 | Bacteria | 2325 |
| 486 | Ga0466965_0602232 | 3300044683 | Bacteria | 624 |
| 487 | Ga0466963_0658703 | 3300044694 | Bacteria | 739 |
| 488 | Ga0466971_0102777 | 3300044719 | Bacteria | 1314 |
| 489 | Ga0466968_0344276 | 3300044735 | Bacteria | 723 |
| 490 | Ga0466970_0403929 | 3300044765 | Bacteria | 780 |
| 491 | Ga0466957_0198387 | 3300044842 | Bacteria | 1317 |
| 492 | Ga0466960_0044826 | 3300044901 | Bacteria | 2110 |
| 493 | Ga0466960_0111425 | 3300044901 | Bacteria | 1422 |
| 494 | Ga0466958_0161012 | 3300045836 | Bacteria | 1418 |
| 495 | Ga0466967_0490931 | 3300045976 | Bacteria | 1204 |
| 496 | Ga0495596_0251562 | 3300046500 | Bacteria | 686 |
| 497 | Ga0495606_0177833 | 3300046507 | Bacteria | 1229 |
| 498 | Ga0495620_0246934 | 3300046515 | Bacteria | 681 |
| 499 | Ga0495620_0291617 | 3300046515 | Bacteria | 620 |
| 500 | Ga0495648_0006972 | 3300046524 | Bacteria | 9113 |
| 501 | Ga0495642_0126622 | 3300046528 | Bacteria | 1098 |
| 502 | Ga0495654_0051006 | 3300046530 | Bacteria | 2020 |
| 503 | Ga0495654_0398672 | 3300046530 | Bacteria | 547 |
| 504 | Ga0495668_0170228 | 3300046616 | Bacteria | 1193 |
| 505 | Ga0495668_0469349 | 3300046616 | Bacteria | 693 |
| 506 | Ga0495611_0049495 | 3300046648 | Bacteria | 1891 |
| 507 | Ga0495625_0091922 | 3300046660 | Bacteria | 2097 |
| 508 | Ga0495671_0072724 | 3300046692 | Bacteria | 1688 |
| 509 | Ga0495649_0062837 | 3300046694 | Bacteria | 1996 |
| 510 | Ga0495589_0330460 | 3300046794 | Bacteria | 704 |
| 511 | Ga0495672_0002254 | 3300047320 | Bacteria | 17944 |
| 512 | Ga0495672_0137051 | 3300047320 | Bacteria | 1282 |
| 513 | Ga0495672_0492561 | 3300047320 | Bacteria | 546 |
| 514 | Ga0495683_0132612 | 3300047323 | Bacteria | 1173 |
| 515 | Ga0495673_0004032 | 3300047469 | Bacteria | 9362 |
| 516 | Ga0495686_0002796 | 3300047472 | Bacteria | 15844 |
| 517 | Ga0496100_0001679 | 3300048903 | Bacteria | 10991 |
| 518 | Ga0496100_0053048 | 3300048903 | Bacteria | 2639 |
| 519 | Ga0496100_0087183 | 3300048903 | Bacteria | 2122 |
| 520 | Ga0496100_0099173 | 3300048903 | Bacteria | 2004 |
| 521 | Ga0496100_0707139 | 3300048903 | Bacteria | 787 |
| 522 | Ga0496101_0000126 | 3300048904 | Bacteria | 74316 |
| 523 | Ga0496101_0028338 | 3300048904 | Bacteria | 3909 |
| 524 | Ga0496101_0097653 | 3300048904 | Bacteria | 2194 |
| 525 | Ga0496101_0273259 | 3300048904 | Bacteria | 1320 |
| 526 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 527 | Ga0496102_0030442 | 3300048905 | Bacteria | 4831 |
| 528 | Ga0496102_0077646 | 3300048905 | Bacteria | 3056 |
| 529 | Ga0496102_0114555 | 3300048905 | Bacteria | 2515 |
| 530 | Ga0496102_0120605 | 3300048905 | Bacteria | 2449 |
| 531 | Ga0496102_0185379 | 3300048905 | Bacteria | 1961 |
| 532 | Ga0496102_0321969 | 3300048905 | Bacteria | 1457 |
| 533 | Ga0496102_0988609 | 3300048905 | Bacteria | 762 |
| 534 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 535 | Ga0496103_0058033 | 3300048906 | Bacteria | 2404 |
| 536 | Ga0496103_0416543 | 3300048906 | Bacteria | 862 |
| 537 | Ga0496104_0021922 | 3300048907 | Bacteria | 5867 |
| 538 | Ga0496104_0025837 | 3300048907 | Bacteria | 5416 |
| 539 | Ga0496104_0147687 | 3300048907 | Bacteria | 2258 |
| 540 | Ga0496104_0570284 | 3300048907 | Bacteria | 1042 |
| 541 | Ga0496104_0759638 | 3300048907 | Bacteria | 876 |
| 542 | Ga0496104_1606150 | 3300048907 | Bacteria | 553 |
| 543 | Ga0496104_1726964 | 3300048907 | Bacteria | 528 |
| 544 | Ga0496105_0047082 | 3300048908 | Bacteria | 3559 |
| 545 | Ga0496105_0074997 | 3300048908 | Bacteria | 2794 |
| 546 | Ga0496105_0395334 | 3300048908 | Bacteria | 1098 |
| 547 | Ga0496105_0704217 | 3300048908 | Bacteria | 775 |
| 548 | Ga0496106_0024628 | 3300048909 | Bacteria | 4475 |
| 549 | Ga0496106_0040391 | 3300048909 | Bacteria | 3494 |
| 550 | Ga0496106_0065440 | 3300048909 | Bacteria | 2767 |
| 551 | Ga0496106_0087670 | 3300048909 | Bacteria | 2398 |
| 552 | Ga0496106_0820230 | 3300048909 | Bacteria | 737 |
| 553 | Ga0496107_0043581 | 3300048910 | Bacteria | 3224 |
| 554 | Ga0496107_0097513 | 3300048910 | Bacteria | 2152 |
| 555 | Ga0496107_0129132 | 3300048910 | Bacteria | 1865 |
| 556 | Ga0496107_0913937 | 3300048910 | Bacteria | 639 |
| 557 | Ga0496108_0001533 | 3300048911 | Bacteria | 18288 |
| 558 | Ga0496108_0008920 | 3300048911 | Bacteria | 8126 |
| 559 | Ga0496108_0023809 | 3300048911 | Bacteria | 5039 |
| 560 | Ga0496108_0102183 | 3300048911 | Bacteria | 2446 |
| 561 | Ga0496108_0158829 | 3300048911 | Bacteria | 1953 |
| 562 | Ga0496108_0178767 | 3300048911 | Bacteria | 1837 |
| 563 | Ga0496108_0185297 | 3300048911 | Bacteria | 1803 |
| 564 | Ga0496108_0203177 | 3300048911 | Bacteria | 1720 |
| 565 | Ga0496109_0014683 | 3300048912 | Bacteria | 6816 |
| 566 | Ga0496109_0039360 | 3300048912 | Bacteria | 4278 |
| 567 | Ga0496109_0045533 | 3300048912 | Bacteria | 3982 |
| 568 | Ga0496109_0058592 | 3300048912 | Bacteria | 3518 |
| 569 | Ga0496109_0289918 | 3300048912 | Bacteria | 1543 |
| 570 | Ga0496109_1762432 | 3300048912 | Bacteria | 553 |
| 571 | Ga0496110_0022181 | 3300048913 | Bacteria | 5388 |
| 572 | Ga0496110_0026881 | 3300048913 | Bacteria | 4928 |
| 573 | Ga0496110_0036193 | 3300048913 | Bacteria | 4286 |
| 574 | Ga0496110_0103220 | 3300048913 | Bacteria | 2557 |
| 575 | Ga0496110_0324902 | 3300048913 | Bacteria | 1401 |
| 576 | Ga0496110_0837232 | 3300048913 | Bacteria | 825 |
| 577 | Ga0496110_1568987 | 3300048913 | Bacteria | 568 |
| 578 | Ga0496111_0071549 | 3300048914 | Bacteria | 2524 |
| 579 | Ga0496111_0334569 | 3300048914 | Bacteria | 1121 |
| 580 | Ga0496112_0006014 | 3300048915 | Bacteria | 10591 |
| 581 | Ga0496112_0071297 | 3300048915 | Bacteria | 3434 |
| 582 | Ga0496112_0085169 | 3300048915 | Bacteria | 3127 |
| 583 | Ga0496112_0612864 | 3300048915 | Bacteria | 1020 |
| 584 | Ga0496113_0014039 | 3300048916 | Bacteria | 5450 |
| 585 | Ga0496113_0372301 | 3300048916 | Bacteria | 1146 |
| 586 | Ga0496114_0024804 | 3300048917 | Bacteria | 4896 |
| 587 | Ga0496114_0050905 | 3300048917 | Bacteria | 3448 |
| 588 | Ga0496114_0487927 | 3300048917 | Bacteria | 1090 |
| 589 | Ga0496114_0667878 | 3300048917 | Bacteria | 913 |
| 590 | Ga0496115_0211039 | 3300048918 | Bacteria | 1604 |
| 591 | Ga0496115_0268162 | 3300048918 | Bacteria | 1403 |
| 592 | Ga0496115_0337099 | 3300048918 | Bacteria | 1231 |
| 593 | Ga0496115_0572009 | 3300048918 | Bacteria | 901 |
| 594 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 595 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 596 | Ga0496117_0386464 | 3300048920 | Bacteria | 711 |
| 597 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 598 | Ga0496118_0000236 | 3300048921 | Bacteria | 97321 |
| 599 | Ga0496119_0000041 | 3300048922 | Bacteria | 203687 |
| 600 | Ga0496120_0000027 | 3300048923 | Bacteria | 231507 |
| 601 | Ga0496121_0000171 | 3300048924 | Bacteria | 144073 |
| 602 | Ga0496122_0052528 | 3300048925 | Bacteria | 3083 |
| 603 | Ga0496123_0011411 | 3300048926 | Bacteria | 7702 |
| 604 | Ga0496124_0237227 | 3300048927 | Bacteria | 1359 |
| 605 | Ga0496125_0347221 | 3300048928 | Bacteria | 888 |
| 606 | Ga0496126_0008660 | 3300048929 | Bacteria | 10932 |
| 607 | Ga0496126_0018679 | 3300048929 | Bacteria | 6860 |
| 608 | Ga0496126_0073923 | 3300048929 | Bacteria | 3028 |
| 609 | Ga0501083_0338044 | 3300049744 | Bacteria | 979 |
| 610 | Ga0501044_0035107 | 3300049823 | Bacteria | 5253 |
| 611 | nmdc:mga03683_213944_c1 | 3300050489 | Bacteria | 887 |
| 612 | nmdc:mga03683_352098_c1 | 3300050489 | Bacteria | 697 |
| 613 | nmdc:mga03n38_135766_c1 | 3300050490 | Bacteria | 1224 |
| 614 | nmdc:mga03n38_141882_c1 | 3300050490 | Bacteria | 1200 |
| 615 | nmdc:mga03n38_292309_c1 | 3300050490 | Bacteria | 873 |
| 616 | nmdc:mga03n38_3990_c1 | 3300050490 | Bacteria | 4820 |
| 617 | nmdc:mga03n38_53521_c1 | 3300050490 | Bacteria | 1810 |
| 618 | nmdc:mga03n38_81663_c1 | 3300050490 | Bacteria | 1520 |
| 619 | nmdc:mga03n38_82101_c1 | 3300050490 | Bacteria | 1517 |
| 620 | nmdc:mga03n38_99478_c1 | 3300050490 | Bacteria | 1400 |
| 621 | nmdc:mga00v17_1106_c1 | 3300050491 | Bacteria | 14175 |
| 622 | nmdc:mga00v17_164356_c1 | 3300050491 | Bacteria | 1430 |
| 623 | nmdc:mga00v17_263606_c1 | 3300050491 | Bacteria | 1118 |
| 624 | nmdc:mga00v17_553010_c1 | 3300050491 | Bacteria | 744 |
| 625 | nmdc:mga00v17_62580_c1 | 3300050491 | Bacteria | 2290 |
| 626 | nmdc:mga00v17_720340_c1 | 3300050491 | Bacteria | 639 |
| 627 | nmdc:mga00v17_874605_c1 | 3300050491 | Bacteria | 570 |
| 628 | nmdc:mga0yw44_1217376_c1 | 3300050492 | Bacteria | 508 |
| 629 | nmdc:mga0yw44_222704_c1 | 3300050492 | Bacteria | 1251 |
| 630 | nmdc:mga0yw44_33606_c1 | 3300050492 | Bacteria | 2998 |
| 631 | nmdc:mga0yw44_506374_c1 | 3300050492 | Bacteria | 819 |
| 632 | nmdc:mga0k408_171095_c1 | 3300050493 | Bacteria | 1295 |
| 633 | nmdc:mga06z11_2710_c1 | 3300050494 | Bacteria | 6783 |
| 634 | nmdc:mga06z11_518120_c1 | 3300050494 | Bacteria | 723 |
| 635 | nmdc:mga04h51_113052_c1 | 3300050495 | Bacteria | 1003 |
| 636 | nmdc:mga07m45_252766_c1 | 3300050496 | Bacteria | 1025 |
| 637 | nmdc:mga07m45_29483_c1 | 3300050496 | Bacteria | 3035 |
| 638 | nmdc:mga07m45_82523_c1 | 3300050496 | Bacteria | 1036 |
| 639 | nmdc:mga05p37_10579_c1 | 3300050507 | Bacteria | 10941 |
| 640 | nmdc:mga0qj67_2784_c1 | 3300050509 | Bacteria | 12547 |
| 641 | nmdc:mga06r32_67807_c1 | 3300050510 | Bacteria | 3445 |
| 642 | nmdc:mga08y16_256741_c1 | 3300050511 | Bacteria | 1805 |
| 643 | nmdc:mga0sz30_242218_c1 | 3300050516 | Bacteria | 803 |
| 644 | nmdc:mga0sz30_3096_c1 | 3300050516 | Bacteria | 5962 |
| 645 | nmdc:mga0sz30_430244_c1 | 3300050516 | Bacteria | 592 |
| 646 | nmdc:mga0sz30_4930_c1 | 3300050516 | Bacteria | 4340 |
| 647 | nmdc:mga0sz30_56529_c1 | 3300050516 | Bacteria | 1303 |
| 648 | Ga0500610_0003136 | 3300053079 | Bacteria | 6277 |
| 649 | Ga0500643_009522 | 3300053087 | Bacteria | 3703 |
| 650 | Ga0500641_0165828 | 3300053096 | Bacteria | 952 |
| 651 | Ga0500556_0022575 | 3300053104 | Bacteria | 2045 |
| 652 | Ga0500556_0387107 | 3300053104 | Bacteria | 538 |
| 653 | Ga0500595_074527 | 3300053119 | Bacteria | 1002 |
| 654 | Ga0500559_0027206 | 3300053136 | Bacteria | 2440 |
| 655 | Ga0500616_0024598 | 3300053153 | Bacteria | 3344 |
| 656 | Ga0500622_0454957 | 3300053156 | Bacteria | 509 |
| 657 | Ga0500627_0021180 | 3300053158 | Bacteria | 2620 |
| 658 | Ga0500627_0250521 | 3300053158 | Bacteria | 784 |
| 659 | Ga0500645_000014 | 3300053730 | Bacteria | 151349 |
| 660 | Ga0500645_098038 | 3300053730 | Bacteria | 828 |
| 661 | Ga0587082_162021 | 3300059504 | Bacteria | 537 |
| 662 | Ga0466962_0004573 | 3300061719 | Bacteria | 6642 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2902837492 | 2902843895 | 108 |
| 2 | 3300006195 | Ga0075366_11003370 | Ga0075366_110033702 | 109 |
| 3 | iso_pu_bacteria | 2643221546 | 2643752577 | 109 |
| 4 | iso_pu_bacteria | 2643221715 | 2644634361 | 110 |
| 5 | 3300005434 | Ga0070709_11372007 | Ga0070709_113720071 | 111 |
| 6 | 3300005444 | Ga0070694_101527304 | Ga0070694_1015273041 | 111 |
| 7 | 3300005719 | Ga0068861_100150036 | Ga0068861_1001500362 | 111 |
| 8 | 3300005937 | Ga0081455_10034648 | Ga0081455_100346485 | 111 |
| 9 | 3300006038 | Ga0075365_10002877 | Ga0075365_1000287711 | 111 |
| 10 | 3300006042 | Ga0075368_10106891 | Ga0075368_101068912 | 111 |
| 11 | 3300006048 | Ga0075363_100003870 | Ga0075363_1000038702 | 111 |
| 12 | 3300006048 | Ga0075363_100454852 | Ga0075363_1004548522 | 111 |
| 13 | 3300006051 | Ga0075364_10069743 | Ga0075364_100697432 | 111 |
| 14 | 3300006177 | Ga0075362_10043625 | Ga0075362_100436252 | 111 |
| 15 | 3300006178 | Ga0075367_10001961 | Ga0075367_100019612 | 111 |
| 16 | 3300006186 | Ga0075369_10061230 | Ga0075369_100612302 | 111 |
| 17 | 3300006195 | Ga0075366_10087610 | Ga0075366_100876102 | 111 |
| 18 | 3300006353 | Ga0075370_10022413 | Ga0075370_100224132 | 111 |
| 19 | 3300009098 | Ga0105245_11551992 | Ga0105245_115519921 | 111 |
| 20 | 3300013297 | Ga0157378_10001889 | Ga0157378_1000188911 | 111 |
| 21 | 3300014745 | Ga0157377_10043487 | Ga0157377_100434872 | 111 |
| 22 | 3300026118 | Ga0207675_100024109 | Ga0207675_1000241092 | 111 |
| 23 | 3300026142 | Ga0207698_12427571 | Ga0207698_124275711 | 111 |
| 24 | 3300027866 | Ga0209813_10037898 | Ga0209813_100378982 | 111 |
| 25 | 3300044658 | Ga0466972_0023450 | Ga0466972_0023450_1575_1910 | 111 |
| 26 | 3300044735 | Ga0466968_0344276 | Ga0466968_0344276_212_547 | 111 |
| 27 | 3300044901 | Ga0466960_0044826 | Ga0466960_0044826_1212_1547 | 111 |
| 28 | 3300046694 | Ga0495649_0062837 | Ga0495649_0062837_637_972 | 111 |
| 29 | 3300047320 | Ga0495672_0137051 | Ga0495672_0137051_331_666 | 111 |
| 30 | 3300047323 | Ga0495683_0132612 | Ga0495683_0132612_392_727 | 111 |
| 31 | 3300050493 | nmdc:mga0k408_171095_c1 | nmdc:mga0k408_171095_c1_935_1270 | 111 |
| 32 | iso_pu_bacteria | 2902810491 | 2902816903 | 111 |
| 33 | 3300003792 | Ga0055540_1007887 | Ga0055540_10078872 | 112 |
| 34 | 3300003792 | Ga0055540_1011575 | Ga0055540_10115752 | 112 |
| 35 | 3300005435 | Ga0070714_100868644 | Ga0070714_1008686442 | 112 |
| 36 | 3300005439 | Ga0070711_101211743 | Ga0070711_1012117431 | 112 |
| 37 | 3300005455 | Ga0070663_100526198 | Ga0070663_1005261982 | 112 |
| 38 | 3300005539 | Ga0068853_100011121 | Ga0068853_1000111213 | 112 |
| 39 | 3300005548 | Ga0070665_100654064 | Ga0070665_1006540642 | 112 |
| 40 | 3300005548 | Ga0070665_102330529 | Ga0070665_1023305291 | 112 |
| 41 | 3300005616 | Ga0068852_100405373 | Ga0068852_1004053732 | 112 |
| 42 | 3300005840 | Ga0068870_11454442 | Ga0068870_114544421 | 112 |
| 43 | 3300005842 | Ga0068858_101557677 | Ga0068858_1015576772 | 112 |
| 44 | 3300006051 | Ga0075364_10523376 | Ga0075364_105233762 | 112 |
| 45 | 3300006051 | Ga0075364_11173153 | Ga0075364_111731531 | 112 |
| 46 | 3300006173 | Ga0070716_100725336 | Ga0070716_1007253362 | 112 |
| 47 | 3300006177 | Ga0075362_10303719 | Ga0075362_103037191 | 112 |
| 48 | 3300006186 | Ga0075369_10157820 | Ga0075369_101578202 | 112 |
| 49 | 3300009093 | Ga0105240_10596107 | Ga0105240_105961072 | 112 |
| 50 | 3300009101 | Ga0105247_10416842 | Ga0105247_104168422 | 112 |
| 51 | 3300009148 | Ga0105243_11277545 | Ga0105243_112775451 | 112 |
| 52 | 3300009177 | Ga0105248_10801240 | Ga0105248_108012402 | 112 |
| 53 | 3300009545 | Ga0105237_10004358 | Ga0105237_1000435818 | 112 |
| 54 | 3300009551 | Ga0105238_10493373 | Ga0105238_104933731 | 112 |
| 55 | 3300010375 | Ga0105239_10004760 | Ga0105239_100047602 | 112 |
| 56 | 3300010375 | Ga0105239_11444143 | Ga0105239_114441432 | 112 |
| 57 | 3300011119 | Ga0105246_10354401 | Ga0105246_103544012 | 112 |
| 58 | 3300013306 | Ga0163162_10345240 | Ga0163162_103452402 | 112 |
| 59 | 3300025273 | Ga0209673_1003416 | Ga0209673_10034161 | 112 |
| 60 | 3300025303 | Ga0209051_1000582 | Ga0209051_10005826 | 112 |
| 61 | 3300025303 | Ga0209051_1007231 | Ga0209051_10072315 | 112 |
| 62 | 3300025303 | Ga0209051_1009421 | Ga0209051_10094213 | 112 |
| 63 | 3300025303 | Ga0209051_1066940 | Ga0209051_10669402 | 112 |
| 64 | 3300025914 | Ga0207671_10078683 | Ga0207671_100786832 | 112 |
| 65 | 3300025924 | Ga0207694_11168984 | Ga0207694_111689841 | 112 |
| 66 | 3300025929 | Ga0207664_10619014 | Ga0207664_106190142 | 112 |
| 67 | 3300025941 | Ga0207711_10685548 | Ga0207711_106855482 | 112 |
| 68 | 3300026035 | Ga0207703_10456380 | Ga0207703_104563802 | 112 |
| 69 | 3300026067 | Ga0207678_10435338 | Ga0207678_104353382 | 112 |
| 70 | 3300026095 | Ga0207676_11231628 | Ga0207676_112316282 | 112 |
| 71 | 3300028379 | Ga0268266_10784606 | Ga0268266_107846062 | 112 |
| 72 | 3300041441 | Ga0451787_497249 | Ga0451787_497249_126_467 | 112 |
| 73 | 3300041459 | Ga0451800_1001123 | Ga0451800_1001123_353_694 | 112 |
| 74 | 3300044683 | Ga0466965_0039330 | Ga0466965_0039330_1143_1481 | 112 |
| 75 | 3300044694 | Ga0466963_0658703 | Ga0466963_0658703_314_652 | 112 |
| 76 | 3300044765 | Ga0466970_0403929 | Ga0466970_0403929_348_686 | 112 |
| 77 | 3300047472 | Ga0495686_0002796 | Ga0495686_0002796_14903_15244 | 112 |
| 78 | 3300048903 | Ga0496100_0053048 | Ga0496100_0053048_883_1224 | 112 |
| 79 | 3300048904 | Ga0496101_0097653 | Ga0496101_0097653_1354_1695 | 112 |
| 80 | 3300048905 | Ga0496102_0321969 | Ga0496102_0321969_536_877 | 112 |
| 81 | 3300048907 | Ga0496104_0147687 | Ga0496104_0147687_1666_2007 | 112 |
| 82 | 3300048907 | Ga0496104_1606150 | Ga0496104_1606150_109_450 | 112 |
| 83 | 3300048908 | Ga0496105_0395334 | Ga0496105_0395334_430_771 | 112 |
| 84 | 3300048909 | Ga0496106_0087670 | Ga0496106_0087670_939_1280 | 112 |
| 85 | 3300048910 | Ga0496107_0129132 | Ga0496107_0129132_559_900 | 112 |
| 86 | 3300048911 | Ga0496108_0185297 | Ga0496108_0185297_1332_1673 | 112 |
| 87 | 3300048913 | Ga0496110_0837232 | Ga0496110_0837232_173_514 | 112 |
| 88 | 3300048915 | Ga0496112_0071297 | Ga0496112_0071297_278_619 | 112 |
| 89 | 3300048915 | Ga0496112_0612864 | Ga0496112_0612864_131_472 | 112 |
| 90 | 3300048916 | Ga0496113_0014039 | Ga0496113_0014039_4431_4772 | 112 |
| 91 | 3300048917 | Ga0496114_0667878 | Ga0496114_0667878_171_512 | 112 |
| 92 | 3300048918 | Ga0496115_0572009 | Ga0496115_0572009_474_815 | 112 |
| 93 | 3300048920 | Ga0496117_0386464 | Ga0496117_0386464_312_653 | 112 |
| 94 | 3300048925 | Ga0496122_0052528 | Ga0496122_0052528_775_1116 | 112 |
| 95 | 3300048926 | Ga0496123_0011411 | Ga0496123_0011411_4941_5282 | 112 |
| 96 | 3300048927 | Ga0496124_0237227 | Ga0496124_0237227_918_1259 | 112 |
| 97 | 3300048929 | Ga0496126_0008660 | Ga0496126_0008660_5401_5742 | 112 |
| 98 | 3300050489 | nmdc:mga03683_352098_c1 | nmdc:mga03683_352098_c1_59_400 | 112 |
| 99 | 3300050491 | nmdc:mga00v17_164356_c1 | nmdc:mga00v17_164356_c1_905_1246 | 112 |
| 100 | 3300050491 | nmdc:mga00v17_553010_c1 | nmdc:mga00v17_553010_c1_236_577 | 112 |
| 101 | 3300050491 | nmdc:mga00v17_874605_c1 | nmdc:mga00v17_874605_c1_185_526 | 112 |
| 102 | 3300053156 | Ga0500622_0454957 | Ga0500622_0454957_54_395 | 112 |
| 103 | iso_pu_bacteria | 2738541274 | 2738705009 | 112 |
| 104 | iso_pu_bacteria | 2738543028 | 2739330184 | 112 |
| 105 | iso_pu_bacteria | 2902792274 | 2902798960 | 112 |
| 106 | iso_pu_bacteria | 2902799365 | 2902803315 | 112 |
| 107 | 3300044719 | Ga0466971_0102777 | Ga0466971_0102777_617_964 | 113 |
| 108 | 3300044842 | Ga0466957_0198387 | Ga0466957_0198387_851_1198 | 113 |
| 109 | 3300045836 | Ga0466958_0161012 | Ga0466958_0161012_707_1054 | 113 |
| 110 | 3300049744 | Ga0501083_0338044 | Ga0501083_0338044_85_426 | 113 |
| 111 | 3300061719 | Ga0466962_0004573 | Ga0466962_0004573_3956_4303 | 113 |
| 112 | 3300006186 | Ga0075369_10017113 | Ga0075369_100171132 | 114 |
| 113 | 3300006186 | Ga0075369_10159680 | Ga0075369_101596802 | 114 |
| 114 | 3300021384 | Ga0213876_10116274 | Ga0213876_101162742 | 114 |
| 115 | 3300031731 | Ga0307405_10240049 | Ga0307405_102400491 | 114 |
| 116 | 3300031824 | Ga0307413_10238879 | Ga0307413_102388792 | 114 |
| 117 | 3300031911 | Ga0307412_10103862 | Ga0307412_101038622 | 114 |
| 118 | 3300031995 | Ga0307409_100353045 | Ga0307409_1003530452 | 114 |
| 119 | 3300032002 | Ga0307416_100918919 | Ga0307416_1009189192 | 114 |
| 120 | 3300032004 | Ga0307414_11137313 | Ga0307414_111373132 | 114 |
| 121 | 3300039437 | Ga0436365_0987088 | Ga0436365_0987088_17246_17593 | 114 |
| 122 | 3300039447 | Ga0436361_0536289 | Ga0436361_0536289_162_509 | 114 |
| 123 | 3300042003 | Ga0439443_118577 | Ga0439443_118577_88_435 | 114 |
| 124 | 3300044683 | Ga0466965_0602232 | Ga0466965_0602232_164_508 | 114 |
| 125 | 3300048905 | Ga0496102_0077646 | Ga0496102_0077646_2041_2388 | 114 |
| 126 | 3300048906 | Ga0496103_0416543 | Ga0496103_0416543_173_520 | 114 |
| 127 | 3300048921 | Ga0496118_0000236 | Ga0496118_0000236_88896_89243 | 114 |
| 128 | 3300048928 | Ga0496125_0347221 | Ga0496125_0347221_300_644 | 114 |
| 129 | 3300048929 | Ga0496126_0073923 | Ga0496126_0073923_1690_2034 | 114 |
| 130 | 3300050491 | nmdc:mga00v17_720340_c1 | nmdc:mga00v17_720340_c1_53_400 | 114 |
| 131 | 3300050516 | nmdc:mga0sz30_4930_c1 | nmdc:mga0sz30_4930_c1_999_1346 | 114 |
| 132 | 3300053136 | Ga0500559_0027206 | Ga0500559_0027206_690_1034 | 114 |
| 133 | 3300053730 | Ga0500645_000014 | Ga0500645_000014_110945_111289 | 114 |
| 134 | iso_pu_bacteria | 2551306166 | 2552107193 | 114 |
| 135 | iso_pu_bacteria | 2643221692 | 2644514395 | 114 |
| 136 | iso_pu_bacteria | 2744054611 | 2744958276 | 114 |
| 137 | 3300006048 | Ga0075363_100140754 | Ga0075363_1001407542 | 115 |
| 138 | 3300031852 | Ga0307410_10304982 | Ga0307410_103049822 | 115 |
| 139 | 3300031901 | Ga0307406_10021356 | Ga0307406_100213562 | 115 |
| 140 | 3300031995 | Ga0307409_100203150 | Ga0307409_1002031502 | 115 |
| 141 | 3300032002 | Ga0307416_100756001 | Ga0307416_1007560012 | 115 |
| 142 | 3300032005 | Ga0307411_10179669 | Ga0307411_101796692 | 115 |
| 143 | 3300041410 | Ga0439461_0000589 | Ga0439461_0000589_4575_4925 | 115 |
| 144 | 3300041411 | Ga0439466_0001299 | Ga0439466_0001299_11_361 | 115 |
| 145 | 3300041413 | Ga0439465_0261742 | Ga0439465_0261742_125_475 | 115 |
| 146 | 3300041997 | Ga0439431_0000730 | Ga0439431_0000730_3962_4312 | 115 |
| 147 | 3300042004 | Ga0439445_0000885 | Ga0439445_0000885_2038_2388 | 115 |
| 148 | 3300042435 | Ga0439434_0104929 | Ga0439434_0104929_145_495 | 115 |
| 149 | 3300045976 | Ga0466967_0490931 | Ga0466967_0490931_843_1190 | 115 |
| 150 | 3300050490 | nmdc:mga03n38_81663_c1 | nmdc:mga03n38_81663_c1_406_768 | 115 |
| 151 | iso_pu_bacteria | 2974315732 | 2974318616 | 115 |
| 152 | iso_pu_bacteria | 2984523437 | 2984526857 | 115 |
| 153 | 3300000545 | CNXas_1008898 | CNXas_10088982 | 116 |
| 154 | 3300000546 | LJNas_1005571 | LJNas_10055712 | 116 |
| 155 | 3300001977 | JGI24746J21847_1007480 | JGI24746J21847_10074802 | 116 |
| 156 | 3300001990 | JGI24737J22298_10029164 | JGI24737J22298_100291641 | 116 |
| 157 | 3300001990 | JGI24737J22298_10063661 | JGI24737J22298_100636612 | 116 |
| 158 | 3300001991 | JGI24743J22301_10001791 | JGI24743J22301_100017914 | 116 |
| 159 | 3300001991 | JGI24743J22301_10002734 | JGI24743J22301_100027342 | 116 |
| 160 | 3300001991 | JGI24743J22301_10011429 | JGI24743J22301_100114292 | 116 |
| 161 | 3300002067 | JGI24735J21928_10141440 | JGI24735J21928_101414402 | 116 |
| 162 | 3300002070 | JGI24750J21931_1007375 | JGI24750J21931_10073752 | 116 |
| 163 | 3300002070 | JGI24750J21931_1036327 | JGI24750J21931_10363271 | 116 |
| 164 | 3300002073 | JGI24745J21846_1001348 | JGI24745J21846_10013482 | 116 |
| 165 | 3300002073 | JGI24745J21846_1010092 | JGI24745J21846_10100922 | 116 |
| 166 | 3300002074 | JGI24748J21848_1031970 | JGI24748J21848_10319701 | 116 |
| 167 | 3300002077 | JGI24744J21845_10015734 | JGI24744J21845_100157342 | 116 |
| 168 | 3300002239 | JGI24034J26672_10057437 | JGI24034J26672_100574372 | 116 |
| 169 | 3300003320 | rootH2_10034644 | rootH2_100346442 | 116 |
| 170 | 3300005327 | Ga0070658_11337055 | Ga0070658_113370551 | 116 |
| 171 | 3300005328 | Ga0070676_10015143 | Ga0070676_100151435 | 116 |
| 172 | 3300005330 | Ga0070690_100059616 | Ga0070690_1000596162 | 116 |
| 173 | 3300005330 | Ga0070690_100303148 | Ga0070690_1003031482 | 116 |
| 174 | 3300005330 | Ga0070690_101628578 | Ga0070690_1016285781 | 116 |
| 175 | 3300005331 | Ga0070670_100090428 | Ga0070670_1000904282 | 116 |
| 176 | 3300005334 | Ga0068869_100008057 | Ga0068869_1000080573 | 116 |
| 177 | 3300005334 | Ga0068869_100021907 | Ga0068869_1000219073 | 116 |
| 178 | 3300005337 | Ga0070682_100012102 | Ga0070682_1000121022 | 116 |
| 179 | 3300005337 | Ga0070682_100267766 | Ga0070682_1002677661 | 116 |
| 180 | 3300005338 | Ga0068868_100079872 | Ga0068868_1000798722 | 116 |
| 181 | 3300005338 | Ga0068868_102108931 | Ga0068868_1021089311 | 116 |
| 182 | 3300005339 | Ga0070660_100238175 | Ga0070660_1002381752 | 116 |
| 183 | 3300005340 | Ga0070689_100095533 | Ga0070689_1000955332 | 116 |
| 184 | 3300005341 | Ga0070691_10035636 | Ga0070691_100356362 | 116 |
| 185 | 3300005345 | Ga0070692_10078416 | Ga0070692_100784162 | 116 |
| 186 | 3300005345 | Ga0070692_10107574 | Ga0070692_101075742 | 116 |
| 187 | 3300005347 | Ga0070668_100324173 | Ga0070668_1003241732 | 116 |
| 188 | 3300005347 | Ga0070668_100656973 | Ga0070668_1006569731 | 116 |
| 189 | 3300005347 | Ga0070668_100747153 | Ga0070668_1007471531 | 116 |
| 190 | 3300005353 | Ga0070669_100038971 | Ga0070669_1000389713 | 116 |
| 191 | 3300005353 | Ga0070669_100237998 | Ga0070669_1002379982 | 116 |
| 192 | 3300005353 | Ga0070669_101272459 | Ga0070669_1012724592 | 116 |
| 193 | 3300005354 | Ga0070675_100625215 | Ga0070675_1006252152 | 116 |
| 194 | 3300005355 | Ga0070671_100000857 | Ga0070671_1000008576 | 116 |
| 195 | 3300005355 | Ga0070671_100141076 | Ga0070671_1001410762 | 116 |
| 196 | 3300005355 | Ga0070671_100436034 | Ga0070671_1004360341 | 116 |
| 197 | 3300005356 | Ga0070674_100122704 | Ga0070674_1001227042 | 116 |
| 198 | 3300005356 | Ga0070674_100141080 | Ga0070674_1001410802 | 116 |
| 199 | 3300005356 | Ga0070674_100874008 | Ga0070674_1008740081 | 116 |
| 200 | 3300005364 | Ga0070673_100038612 | Ga0070673_1000386123 | 116 |
| 201 | 3300005365 | Ga0070688_100008672 | Ga0070688_1000086722 | 116 |
| 202 | 3300005365 | Ga0070688_100287600 | Ga0070688_1002876002 | 116 |
| 203 | 3300005366 | Ga0070659_100046646 | Ga0070659_1000466462 | 116 |
| 204 | 3300005366 | Ga0070659_101013032 | Ga0070659_1010130321 | 116 |
| 205 | 3300005367 | Ga0070667_100014633 | Ga0070667_1000146333 | 116 |
| 206 | 3300005367 | Ga0070667_100024791 | Ga0070667_1000247913 | 116 |
| 207 | 3300005367 | Ga0070667_100046868 | Ga0070667_1000468682 | 116 |
| 208 | 3300005367 | Ga0070667_100172254 | Ga0070667_1001722542 | 116 |
| 209 | 3300005406 | Ga0070703_10044398 | Ga0070703_100443981 | 116 |
| 210 | 3300005434 | Ga0070709_10020853 | Ga0070709_100208533 | 116 |
| 211 | 3300005434 | Ga0070709_10044036 | Ga0070709_100440362 | 116 |
| 212 | 3300005435 | Ga0070714_100204251 | Ga0070714_1002042512 | 116 |
| 213 | 3300005437 | Ga0070710_10025085 | Ga0070710_100250852 | 116 |
| 214 | 3300005437 | Ga0070710_10255745 | Ga0070710_102557452 | 116 |
| 215 | 3300005438 | Ga0070701_10006664 | Ga0070701_100066642 | 116 |
| 216 | 3300005438 | Ga0070701_10402488 | Ga0070701_104024881 | 116 |
| 217 | 3300005439 | Ga0070711_100009282 | Ga0070711_1000092825 | 116 |
| 218 | 3300005439 | Ga0070711_100045137 | Ga0070711_1000451372 | 116 |
| 219 | 3300005440 | Ga0070705_100008684 | Ga0070705_1000086845 | 116 |
| 220 | 3300005440 | Ga0070705_100034476 | Ga0070705_1000344762 | 116 |
| 221 | 3300005440 | Ga0070705_100502240 | Ga0070705_1005022401 | 116 |
| 222 | 3300005441 | Ga0070700_100012377 | Ga0070700_1000123773 | 116 |
| 223 | 3300005441 | Ga0070700_100158511 | Ga0070700_1001585112 | 116 |
| 224 | 3300005444 | Ga0070694_100414025 | Ga0070694_1004140252 | 116 |
| 225 | 3300005444 | Ga0070694_101113937 | Ga0070694_1011139372 | 116 |
| 226 | 3300005445 | Ga0070708_100691813 | Ga0070708_1006918132 | 116 |
| 227 | 3300005445 | Ga0070708_100772925 | Ga0070708_1007729252 | 116 |
| 228 | 3300005455 | Ga0070663_100108732 | Ga0070663_1001087322 | 116 |
| 229 | 3300005455 | Ga0070663_100124028 | Ga0070663_1001240282 | 116 |
| 230 | 3300005455 | Ga0070663_100734306 | Ga0070663_1007343061 | 116 |
| 231 | 3300005455 | Ga0070663_101126384 | Ga0070663_1011263841 | 116 |
| 232 | 3300005456 | Ga0070678_100143543 | Ga0070678_1001435432 | 116 |
| 233 | 3300005456 | Ga0070678_100538377 | Ga0070678_1005383772 | 116 |
| 234 | 3300005456 | Ga0070678_100756139 | Ga0070678_1007561392 | 116 |
| 235 | 3300005456 | Ga0070678_101272135 | Ga0070678_1012721352 | 116 |
| 236 | 3300005457 | Ga0070662_100016536 | Ga0070662_1000165362 | 116 |
| 237 | 3300005459 | Ga0068867_100056119 | Ga0068867_1000561193 | 116 |
| 238 | 3300005459 | Ga0068867_100278860 | Ga0068867_1002788602 | 116 |
| 239 | 3300005459 | Ga0068867_100375852 | Ga0068867_1003758522 | 116 |
| 240 | 3300005466 | Ga0070685_10018635 | Ga0070685_100186353 | 116 |
| 241 | 3300005466 | Ga0070685_10160402 | Ga0070685_101604022 | 116 |
| 242 | 3300005466 | Ga0070685_10446867 | Ga0070685_104468672 | 116 |
| 243 | 3300005467 | Ga0070706_100989546 | Ga0070706_1009895462 | 116 |
| 244 | 3300005535 | Ga0070684_100645324 | Ga0070684_1006453242 | 116 |
| 245 | 3300005536 | Ga0070697_100183356 | Ga0070697_1001833561 | 116 |
| 246 | 3300005539 | Ga0068853_100035712 | Ga0068853_1000357123 | 116 |
| 247 | 3300005539 | Ga0068853_100952425 | Ga0068853_1009524252 | 116 |
| 248 | 3300005543 | Ga0070672_100113767 | Ga0070672_1001137672 | 116 |
| 249 | 3300005543 | Ga0070672_100197703 | Ga0070672_1001977032 | 116 |
| 250 | 3300005543 | Ga0070672_101016539 | Ga0070672_1010165392 | 116 |
| 251 | 3300005544 | Ga0070686_100139150 | Ga0070686_1001391501 | 116 |
| 252 | 3300005544 | Ga0070686_100354286 | Ga0070686_1003542862 | 116 |
| 253 | 3300005545 | Ga0070695_100064159 | Ga0070695_1000641592 | 116 |
| 254 | 3300005545 | Ga0070695_100344571 | Ga0070695_1003445711 | 116 |
| 255 | 3300005546 | Ga0070696_100045285 | Ga0070696_1000452853 | 116 |
| 256 | 3300005546 | Ga0070696_100151457 | Ga0070696_1001514572 | 116 |
| 257 | 3300005547 | Ga0070693_100061425 | Ga0070693_1000614252 | 116 |
| 258 | 3300005547 | Ga0070693_100271288 | Ga0070693_1002712882 | 116 |
| 259 | 3300005548 | Ga0070665_100016906 | Ga0070665_1000169067 | 116 |
| 260 | 3300005548 | Ga0070665_100021400 | Ga0070665_1000214002 | 116 |
| 261 | 3300005548 | Ga0070665_100031399 | Ga0070665_1000313992 | 116 |
| 262 | 3300005548 | Ga0070665_101003272 | Ga0070665_1010032722 | 116 |
| 263 | 3300005549 | Ga0070704_100005943 | Ga0070704_1000059432 | 116 |
| 264 | 3300005563 | Ga0068855_100194985 | Ga0068855_1001949852 | 116 |
| 265 | 3300005563 | Ga0068855_100604067 | Ga0068855_1006040672 | 116 |
| 266 | 3300005578 | Ga0068854_100040527 | Ga0068854_1000405273 | 116 |
| 267 | 3300005578 | Ga0068854_100491939 | Ga0068854_1004919391 | 116 |
| 268 | 3300005614 | Ga0068856_100067702 | Ga0068856_1000677022 | 116 |
| 269 | 3300005614 | Ga0068856_100414663 | Ga0068856_1004146631 | 116 |
| 270 | 3300005615 | Ga0070702_100003765 | Ga0070702_1000037655 | 116 |
| 271 | 3300005615 | Ga0070702_100056656 | Ga0070702_1000566562 | 116 |
| 272 | 3300005615 | Ga0070702_101140048 | Ga0070702_1011400481 | 116 |
| 273 | 3300005615 | Ga0070702_101166469 | Ga0070702_1011664692 | 116 |
| 274 | 3300005616 | Ga0068852_100067766 | Ga0068852_1000677662 | 116 |
| 275 | 3300005616 | Ga0068852_100182432 | Ga0068852_1001824322 | 116 |
| 276 | 3300005617 | Ga0068859_100022466 | Ga0068859_1000224664 | 116 |
| 277 | 3300005617 | Ga0068859_100668204 | Ga0068859_1006682041 | 116 |
| 278 | 3300005617 | Ga0068859_101527603 | Ga0068859_1015276032 | 116 |
| 279 | 3300005617 | Ga0068859_103005510 | Ga0068859_1030055101 | 116 |
| 280 | 3300005618 | Ga0068864_100028130 | Ga0068864_1000281305 | 116 |
| 281 | 3300005618 | Ga0068864_100612579 | Ga0068864_1006125792 | 116 |
| 282 | 3300005718 | Ga0068866_10007981 | Ga0068866_100079812 | 116 |
| 283 | 3300005719 | Ga0068861_100006167 | Ga0068861_1000061674 | 116 |
| 284 | 3300005719 | Ga0068861_100040051 | Ga0068861_1000400513 | 116 |
| 285 | 3300005719 | Ga0068861_100325032 | Ga0068861_1003250322 | 116 |
| 286 | 3300005719 | Ga0068861_101269883 | Ga0068861_1012698832 | 116 |
| 287 | 3300005834 | Ga0068851_10131088 | Ga0068851_101310882 | 116 |
| 288 | 3300005840 | Ga0068870_10081998 | Ga0068870_100819984 | 116 |
| 289 | 3300005841 | Ga0068863_100005929 | Ga0068863_1000059294 | 116 |
| 290 | 3300005841 | Ga0068863_100173939 | Ga0068863_1001739392 | 116 |
| 291 | 3300005841 | Ga0068863_100300342 | Ga0068863_1003003424 | 116 |
| 292 | 3300005841 | Ga0068863_100558697 | Ga0068863_1005586972 | 116 |
| 293 | 3300005842 | Ga0068858_100013663 | Ga0068858_1000136632 | 116 |
| 294 | 3300005842 | Ga0068858_100456722 | Ga0068858_1004567222 | 116 |
| 295 | 3300005842 | Ga0068858_101198998 | Ga0068858_1011989982 | 116 |
| 296 | 3300005842 | Ga0068858_101487028 | Ga0068858_1014870282 | 116 |
| 297 | 3300005843 | Ga0068860_100108853 | Ga0068860_1001088532 | 116 |
| 298 | 3300005843 | Ga0068860_100204393 | Ga0068860_1002043932 | 116 |
| 299 | 3300005843 | Ga0068860_100237707 | Ga0068860_1002377072 | 116 |
| 300 | 3300005843 | Ga0068860_100728776 | Ga0068860_1007287762 | 116 |
| 301 | 3300005844 | Ga0068862_100081840 | Ga0068862_1000818403 | 116 |
| 302 | 3300005844 | Ga0068862_100219149 | Ga0068862_1002191492 | 116 |
| 303 | 3300005844 | Ga0068862_100230913 | Ga0068862_1002309132 | 116 |
| 304 | 3300005844 | Ga0068862_101025704 | Ga0068862_1010257041 | 116 |
| 305 | 3300005937 | Ga0081455_10342537 | Ga0081455_103425372 | 116 |
| 306 | 3300006038 | Ga0075365_10010694 | Ga0075365_100106943 | 116 |
| 307 | 3300006038 | Ga0075365_10710686 | Ga0075365_107106862 | 116 |
| 308 | 3300006051 | Ga0075364_10002232 | Ga0075364_1000223211 | 116 |
| 309 | 3300006051 | Ga0075364_10017167 | Ga0075364_100171674 | 116 |
| 310 | 3300006051 | Ga0075364_10071145 | Ga0075364_100711452 | 116 |
| 311 | 3300006051 | Ga0075364_10811186 | Ga0075364_108111861 | 116 |
| 312 | 3300006163 | Ga0070715_10011748 | Ga0070715_100117483 | 116 |
| 313 | 3300006173 | Ga0070716_100004343 | Ga0070716_1000043439 | 116 |
| 314 | 3300006173 | Ga0070716_100080091 | Ga0070716_1000800912 | 116 |
| 315 | 3300006173 | Ga0070716_101484731 | Ga0070716_1014847311 | 116 |
| 316 | 3300006175 | Ga0070712_100014032 | Ga0070712_1000140323 | 116 |
| 317 | 3300006175 | Ga0070712_100036147 | Ga0070712_1000361472 | 116 |
| 318 | 3300006177 | Ga0075362_10010772 | Ga0075362_100107722 | 116 |
| 319 | 3300006177 | Ga0075362_10192077 | Ga0075362_101920772 | 116 |
| 320 | 3300006178 | Ga0075367_10471429 | Ga0075367_104714292 | 116 |
| 321 | 3300006186 | Ga0075369_10000801 | Ga0075369_1000080110 | 116 |
| 322 | 3300006186 | Ga0075369_10003710 | Ga0075369_100037108 | 116 |
| 323 | 3300006186 | Ga0075369_10004851 | Ga0075369_100048514 | 116 |
| 324 | 3300006186 | Ga0075369_10070805 | Ga0075369_100708052 | 116 |
| 325 | 3300006186 | Ga0075369_10106036 | Ga0075369_101060361 | 116 |
| 326 | 3300006186 | Ga0075369_10107221 | Ga0075369_101072212 | 116 |
| 327 | 3300006186 | Ga0075369_10341956 | Ga0075369_103419562 | 116 |
| 328 | 3300006186 | Ga0075369_10413936 | Ga0075369_104139362 | 116 |
| 329 | 3300006237 | Ga0097621_100086416 | Ga0097621_1000864162 | 116 |
| 330 | 3300006237 | Ga0097621_100137376 | Ga0097621_1001373762 | 116 |
| 331 | 3300006353 | Ga0075370_10013411 | Ga0075370_100134112 | 116 |
| 332 | 3300006353 | Ga0075370_10042506 | Ga0075370_100425061 | 116 |
| 333 | 3300006353 | Ga0075370_10054036 | Ga0075370_100540364 | 116 |
| 334 | 3300006353 | Ga0075370_10588892 | Ga0075370_105888922 | 116 |
| 335 | 3300006358 | Ga0068871_100053608 | Ga0068871_1000536084 | 116 |
| 336 | 3300006358 | Ga0068871_100158450 | Ga0068871_1001584502 | 116 |
| 337 | 3300006846 | Ga0075430_100004258 | Ga0075430_10000425810 | 116 |
| 338 | 3300006847 | Ga0075431_100036015 | Ga0075431_1000360155 | 116 |
| 339 | 3300006852 | Ga0075433_10848879 | Ga0075433_108488792 | 116 |
| 340 | 3300006881 | Ga0068865_100067444 | Ga0068865_1000674443 | 116 |
| 341 | 3300006881 | Ga0068865_100100518 | Ga0068865_1001005182 | 116 |
| 342 | 3300006881 | Ga0068865_100103728 | Ga0068865_1001037282 | 116 |
| 343 | 3300006881 | Ga0068865_100924054 | Ga0068865_1009240542 | 116 |
| 344 | 3300006931 | Ga0097620_100022468 | Ga0097620_1000224684 | 116 |
| 345 | 3300006931 | Ga0097620_100668176 | Ga0097620_1006681762 | 116 |
| 346 | 3300006931 | Ga0097620_101527560 | Ga0097620_1015275602 | 116 |
| 347 | 3300006931 | Ga0097620_103003244 | Ga0097620_1030032441 | 116 |
| 348 | 3300009092 | Ga0105250_10071661 | Ga0105250_100716612 | 116 |
| 349 | 3300009092 | Ga0105250_10216707 | Ga0105250_102167072 | 116 |
| 350 | 3300009094 | Ga0111539_10347611 | Ga0111539_103476112 | 116 |
| 351 | 3300009098 | Ga0105245_10080640 | Ga0105245_100806403 | 116 |
| 352 | 3300009098 | Ga0105245_10475146 | Ga0105245_104751462 | 116 |
| 353 | 3300009098 | Ga0105245_11511294 | Ga0105245_115112942 | 116 |
| 354 | 3300009101 | Ga0105247_10007780 | Ga0105247_100077802 | 116 |
| 355 | 3300009101 | Ga0105247_10023605 | Ga0105247_100236054 | 116 |
| 356 | 3300009147 | Ga0114129_10002202 | Ga0114129_1000220219 | 116 |
| 357 | 3300009148 | Ga0105243_10042382 | Ga0105243_100423822 | 116 |
| 358 | 3300009148 | Ga0105243_10051033 | Ga0105243_100510332 | 116 |
| 359 | 3300009174 | Ga0105241_11512507 | Ga0105241_115125072 | 116 |
| 360 | 3300009176 | Ga0105242_10386822 | Ga0105242_103868222 | 116 |
| 361 | 3300009176 | Ga0105242_10576480 | Ga0105242_105764802 | 116 |
| 362 | 3300009177 | Ga0105248_10094559 | Ga0105248_100945593 | 116 |
| 363 | 3300009177 | Ga0105248_10230982 | Ga0105248_102309822 | 116 |
| 364 | 3300009177 | Ga0105248_10429279 | Ga0105248_104292793 | 116 |
| 365 | 3300009545 | Ga0105237_10089465 | Ga0105237_100894652 | 116 |
| 366 | 3300009545 | Ga0105237_10181117 | Ga0105237_101811172 | 116 |
| 367 | 3300009551 | Ga0105238_10156407 | Ga0105238_101564072 | 116 |
| 368 | 3300009551 | Ga0105238_10360030 | Ga0105238_103600302 | 116 |
| 369 | 3300009553 | Ga0105249_10007627 | Ga0105249_100076277 | 116 |
| 370 | 3300009553 | Ga0105249_10327740 | Ga0105249_103277402 | 116 |
| 371 | 3300009553 | Ga0105249_10700148 | Ga0105249_107001482 | 116 |
| 372 | 3300009553 | Ga0105249_12448528 | Ga0105249_124485281 | 116 |
| 373 | 3300010375 | Ga0105239_10033724 | Ga0105239_100337243 | 116 |
| 374 | 3300010375 | Ga0105239_10167192 | Ga0105239_101671924 | 116 |
| 375 | 3300011119 | Ga0105246_10019015 | Ga0105246_100190152 | 116 |
| 376 | 3300011119 | Ga0105246_10216940 | Ga0105246_102169402 | 116 |
| 377 | 3300011119 | Ga0105246_11772565 | Ga0105246_117725651 | 116 |
| 378 | 3300013100 | Ga0157373_10316988 | Ga0157373_103169881 | 116 |
| 379 | 3300013104 | Ga0157370_11209071 | Ga0157370_112090711 | 116 |
| 380 | 3300013296 | Ga0157374_10008988 | Ga0157374_100089885 | 116 |
| 381 | 3300013297 | Ga0157378_10013540 | Ga0157378_100135402 | 116 |
| 382 | 3300013297 | Ga0157378_10239805 | Ga0157378_102398052 | 116 |
| 383 | 3300013306 | Ga0163162_10704726 | Ga0163162_107047262 | 116 |
| 384 | 3300013306 | Ga0163162_12869155 | Ga0163162_128691551 | 116 |
| 385 | 3300013307 | Ga0157372_10034051 | Ga0157372_100340512 | 116 |
| 386 | 3300013307 | Ga0157372_10048715 | Ga0157372_100487155 | 116 |
| 387 | 3300013308 | Ga0157375_10026596 | Ga0157375_100265964 | 116 |
| 388 | 3300013308 | Ga0157375_10230852 | Ga0157375_102308521 | 116 |
| 389 | 3300014325 | Ga0163163_10078441 | Ga0163163_100784413 | 116 |
| 390 | 3300014325 | Ga0163163_10291943 | Ga0163163_102919434 | 116 |
| 391 | 3300014325 | Ga0163163_11219562 | Ga0163163_112195622 | 116 |
| 392 | 3300014325 | Ga0163163_11383120 | Ga0163163_113831201 | 116 |
| 393 | 3300014326 | Ga0157380_10156676 | Ga0157380_101566762 | 116 |
| 394 | 3300014326 | Ga0157380_10181210 | Ga0157380_101812102 | 116 |
| 395 | 3300014745 | Ga0157377_10007569 | Ga0157377_100075695 | 116 |
| 396 | 3300014745 | Ga0157377_10028023 | Ga0157377_100280232 | 116 |
| 397 | 3300014968 | Ga0157379_10005060 | Ga0157379_100050605 | 116 |
| 398 | 3300014968 | Ga0157379_10188698 | Ga0157379_101886982 | 116 |
| 399 | 3300014969 | Ga0157376_10124505 | Ga0157376_101245052 | 116 |
| 400 | 3300014969 | Ga0157376_10424581 | Ga0157376_104245812 | 116 |
| 401 | 3300017792 | Ga0163161_10060621 | Ga0163161_100606212 | 116 |
| 402 | 3300017792 | Ga0163161_10118740 | Ga0163161_101187404 | 116 |
| 403 | 3300017792 | Ga0163161_10417287 | Ga0163161_104172873 | 116 |
| 404 | 3300017792 | Ga0163161_10424957 | Ga0163161_104249572 | 116 |
| 405 | 3300021384 | Ga0213876_10008455 | Ga0213876_100084555 | 116 |
| 406 | 3300025885 | Ga0207653_10021277 | Ga0207653_100212772 | 116 |
| 407 | 3300025898 | Ga0207692_10056043 | Ga0207692_100560432 | 116 |
| 408 | 3300025898 | Ga0207692_10106246 | Ga0207692_101062462 | 116 |
| 409 | 3300025900 | Ga0207710_10319674 | Ga0207710_103196741 | 116 |
| 410 | 3300025901 | Ga0207688_10000065 | Ga0207688_1000006529 | 116 |
| 411 | 3300025901 | Ga0207688_10020310 | Ga0207688_100203101 | 116 |
| 412 | 3300025901 | Ga0207688_10049235 | Ga0207688_100492352 | 116 |
| 413 | 3300025904 | Ga0207647_10033458 | Ga0207647_100334582 | 116 |
| 414 | 3300025905 | Ga0207685_10005908 | Ga0207685_100059082 | 116 |
| 415 | 3300025905 | Ga0207685_10304202 | Ga0207685_103042021 | 116 |
| 416 | 3300025906 | Ga0207699_10747600 | Ga0207699_107476002 | 116 |
| 417 | 3300025907 | Ga0207645_10261169 | Ga0207645_102611692 | 116 |
| 418 | 3300025908 | Ga0207643_10028172 | Ga0207643_100281722 | 116 |
| 419 | 3300025909 | Ga0207705_11333251 | Ga0207705_113332511 | 116 |
| 420 | 3300025911 | Ga0207654_10495909 | Ga0207654_104959092 | 116 |
| 421 | 3300025914 | Ga0207671_10158046 | Ga0207671_101580462 | 116 |
| 422 | 3300025914 | Ga0207671_11254625 | Ga0207671_112546251 | 116 |
| 423 | 3300025915 | Ga0207693_10001726 | Ga0207693_1000172625 | 116 |
| 424 | 3300025915 | Ga0207693_10023850 | Ga0207693_100238502 | 116 |
| 425 | 3300025916 | Ga0207663_10036882 | Ga0207663_100368823 | 116 |
| 426 | 3300025916 | Ga0207663_10184051 | Ga0207663_101840512 | 116 |
| 427 | 3300025919 | Ga0207657_10087486 | Ga0207657_100874862 | 116 |
| 428 | 3300025919 | Ga0207657_10611390 | Ga0207657_106113902 | 116 |
| 429 | 3300025923 | Ga0207681_10100487 | Ga0207681_101004872 | 116 |
| 430 | 3300025923 | Ga0207681_10166464 | Ga0207681_101664642 | 116 |
| 431 | 3300025923 | Ga0207681_11755124 | Ga0207681_117551241 | 116 |
| 432 | 3300025924 | Ga0207694_10101524 | Ga0207694_101015242 | 116 |
| 433 | 3300025924 | Ga0207694_10260973 | Ga0207694_102609732 | 116 |
| 434 | 3300025925 | Ga0207650_10049033 | Ga0207650_100490332 | 116 |
| 435 | 3300025927 | Ga0207687_10867540 | Ga0207687_108675402 | 116 |
| 436 | 3300025928 | Ga0207700_10814887 | Ga0207700_108148872 | 116 |
| 437 | 3300025931 | Ga0207644_10003277 | Ga0207644_1000327710 | 116 |
| 438 | 3300025931 | Ga0207644_10109818 | Ga0207644_101098182 | 116 |
| 439 | 3300025931 | Ga0207644_10262597 | Ga0207644_102625972 | 116 |
| 440 | 3300025931 | Ga0207644_10375984 | Ga0207644_103759842 | 116 |
| 441 | 3300025932 | Ga0207690_10833293 | Ga0207690_108332931 | 116 |
| 442 | 3300025933 | Ga0207706_10011834 | Ga0207706_100118347 | 116 |
| 443 | 3300025933 | Ga0207706_10036470 | Ga0207706_100364702 | 116 |
| 444 | 3300025934 | Ga0207686_10364792 | Ga0207686_103647921 | 116 |
| 445 | 3300025934 | Ga0207686_10401446 | Ga0207686_104014462 | 116 |
| 446 | 3300025934 | Ga0207686_10715430 | Ga0207686_107154301 | 116 |
| 447 | 3300025935 | Ga0207709_10307012 | Ga0207709_103070122 | 116 |
| 448 | 3300025936 | Ga0207670_10191100 | Ga0207670_101911002 | 116 |
| 449 | 3300025936 | Ga0207670_11511669 | Ga0207670_115116691 | 116 |
| 450 | 3300025936 | Ga0207670_11715189 | Ga0207670_117151891 | 116 |
| 451 | 3300025937 | Ga0207669_10311715 | Ga0207669_103117152 | 116 |
| 452 | 3300025937 | Ga0207669_11628184 | Ga0207669_116281841 | 116 |
| 453 | 3300025938 | Ga0207704_10088130 | Ga0207704_100881304 | 116 |
| 454 | 3300025938 | Ga0207704_10205845 | Ga0207704_102058452 | 116 |
| 455 | 3300025939 | Ga0207665_10004137 | Ga0207665_100041376 | 116 |
| 456 | 3300025939 | Ga0207665_10009561 | Ga0207665_100095612 | 116 |
| 457 | 3300025939 | Ga0207665_11273491 | Ga0207665_112734911 | 116 |
| 458 | 3300025940 | Ga0207691_10033722 | Ga0207691_100337225 | 116 |
| 459 | 3300025940 | Ga0207691_10044140 | Ga0207691_100441402 | 116 |
| 460 | 3300025940 | Ga0207691_10517640 | Ga0207691_105176402 | 116 |
| 461 | 3300025941 | Ga0207711_10148383 | Ga0207711_101483832 | 116 |
| 462 | 3300025941 | Ga0207711_10924382 | Ga0207711_109243821 | 116 |
| 463 | 3300025941 | Ga0207711_11605567 | Ga0207711_116055672 | 116 |
| 464 | 3300025942 | Ga0207689_10009506 | Ga0207689_100095063 | 116 |
| 465 | 3300025942 | Ga0207689_10013320 | Ga0207689_100133207 | 116 |
| 466 | 3300025949 | Ga0207667_10107828 | Ga0207667_101078283 | 116 |
| 467 | 3300025949 | Ga0207667_10448321 | Ga0207667_104483212 | 116 |
| 468 | 3300025961 | Ga0207712_10525710 | Ga0207712_105257102 | 116 |
| 469 | 3300025961 | Ga0207712_10907934 | Ga0207712_109079342 | 116 |
| 470 | 3300025972 | Ga0207668_10322500 | Ga0207668_103225002 | 116 |
| 471 | 3300025972 | Ga0207668_10534520 | Ga0207668_105345202 | 116 |
| 472 | 3300025972 | Ga0207668_11999033 | Ga0207668_119990331 | 116 |
| 473 | 3300025981 | Ga0207640_10050976 | Ga0207640_100509762 | 116 |
| 474 | 3300025986 | Ga0207658_10007890 | Ga0207658_1000789010 | 116 |
| 475 | 3300025986 | Ga0207658_10106296 | Ga0207658_101062962 | 116 |
| 476 | 3300025986 | Ga0207658_10183170 | Ga0207658_101831702 | 116 |
| 477 | 3300025986 | Ga0207658_10185707 | Ga0207658_101857072 | 116 |
| 478 | 3300026023 | Ga0207677_10065309 | Ga0207677_100653092 | 116 |
| 479 | 3300026023 | Ga0207677_10130254 | Ga0207677_101302542 | 116 |
| 480 | 3300026023 | Ga0207677_10146556 | Ga0207677_101465564 | 116 |
| 481 | 3300026035 | Ga0207703_10238958 | Ga0207703_102389583 | 116 |
| 482 | 3300026035 | Ga0207703_11054861 | Ga0207703_110548611 | 116 |
| 483 | 3300026041 | Ga0207639_10127105 | Ga0207639_101271051 | 116 |
| 484 | 3300026067 | Ga0207678_10027949 | Ga0207678_100279495 | 116 |
| 485 | 3300026067 | Ga0207678_10030159 | Ga0207678_100301594 | 116 |
| 486 | 3300026067 | Ga0207678_10654059 | Ga0207678_106540593 | 116 |
| 487 | 3300026067 | Ga0207678_11154605 | Ga0207678_111546051 | 116 |
| 488 | 3300026075 | Ga0207708_10001834 | Ga0207708_100018346 | 116 |
| 489 | 3300026075 | Ga0207708_10036418 | Ga0207708_100364181 | 116 |
| 490 | 3300026078 | Ga0207702_10368087 | Ga0207702_103680872 | 116 |
| 491 | 3300026078 | Ga0207702_11872890 | Ga0207702_118728902 | 116 |
| 492 | 3300026088 | Ga0207641_10017084 | Ga0207641_100170846 | 116 |
| 493 | 3300026088 | Ga0207641_10364065 | Ga0207641_103640652 | 116 |
| 494 | 3300026088 | Ga0207641_10484525 | Ga0207641_104845252 | 116 |
| 495 | 3300026088 | Ga0207641_10535798 | Ga0207641_105357982 | 116 |
| 496 | 3300026088 | Ga0207641_10795337 | Ga0207641_107953371 | 116 |
| 497 | 3300026089 | Ga0207648_10075782 | Ga0207648_100757822 | 116 |
| 498 | 3300026089 | Ga0207648_10082205 | Ga0207648_100822052 | 116 |
| 499 | 3300026089 | Ga0207648_10538071 | Ga0207648_105380711 | 116 |
| 500 | 3300026095 | Ga0207676_10055132 | Ga0207676_100551323 | 116 |
| 501 | 3300026118 | Ga0207675_100007395 | Ga0207675_1000073955 | 116 |
| 502 | 3300026118 | Ga0207675_100077852 | Ga0207675_1000778522 | 116 |
| 503 | 3300026118 | Ga0207675_100400880 | Ga0207675_1004008802 | 116 |
| 504 | 3300026118 | Ga0207675_100928953 | Ga0207675_1009289531 | 116 |
| 505 | 3300026121 | Ga0207683_10007249 | Ga0207683_100072497 | 116 |
| 506 | 3300026121 | Ga0207683_10061095 | Ga0207683_100610953 | 116 |
| 507 | 3300026142 | Ga0207698_10093348 | Ga0207698_100933482 | 116 |
| 508 | 3300026142 | Ga0207698_10331232 | Ga0207698_103312323 | 116 |
| 509 | 3300028379 | Ga0268266_10003919 | Ga0268266_1000391915 | 116 |
| 510 | 3300028379 | Ga0268266_10025990 | Ga0268266_100259903 | 116 |
| 511 | 3300028379 | Ga0268266_10120380 | Ga0268266_101203802 | 116 |
| 512 | 3300028379 | Ga0268266_10779366 | Ga0268266_107793662 | 116 |
| 513 | 3300028380 | Ga0268265_10065964 | Ga0268265_100659642 | 116 |
| 514 | 3300028380 | Ga0268265_10573526 | Ga0268265_105735262 | 116 |
| 515 | 3300028380 | Ga0268265_10730222 | Ga0268265_107302221 | 116 |
| 516 | 3300028380 | Ga0268265_10770872 | Ga0268265_107708722 | 116 |
| 517 | 3300028381 | Ga0268264_10069268 | Ga0268264_100692682 | 116 |
| 518 | 3300028381 | Ga0268264_10390284 | Ga0268264_103902842 | 116 |
| 519 | 3300028381 | Ga0268264_10534760 | Ga0268264_105347602 | 116 |
| 520 | 3300028381 | Ga0268264_11033272 | Ga0268264_110332721 | 116 |
| 521 | 3300031731 | Ga0307405_11091281 | Ga0307405_110912812 | 116 |
| 522 | 3300032002 | Ga0307416_103461341 | Ga0307416_1034613411 | 116 |
| 523 | 3300034820 | Ga0373959_0073846 | Ga0373959_0073846_220_570 | 116 |
| 524 | 3300035084 | Ga0373928_0174053 | Ga0373928_0174053_82_435 | 116 |
| 525 | 3300035121 | Ga0373960_0062491 | Ga0373960_0062491_658_1008 | 116 |
| 526 | 3300035207 | Ga0373942_0087120 | Ga0373942_0087120_446_796 | 116 |
| 527 | 3300035207 | Ga0373942_0113639 | Ga0373942_0113639_52_405 | 116 |
| 528 | 3300035241 | Ga0373961_0208109 | Ga0373961_0208109_316_666 | 116 |
| 529 | 3300035241 | Ga0373961_0427135 | Ga0373961_0427135_117_470 | 116 |
| 530 | 3300035242 | Ga0373962_0130260 | Ga0373962_0130260_254_604 | 116 |
| 531 | 3300035691 | Ga0373931_0014323 | Ga0373931_0014323_606_956 | 116 |
| 532 | 3300035691 | Ga0373931_0025634 | Ga0373931_0025634_1863_2216 | 116 |
| 533 | 3300035725 | Ga0373947_0308302 | Ga0373947_0308302_472_873 | 116 |
| 534 | 3300036647 | Ga0316582_0148261 | Ga0316582_0148261_763_1113 | 116 |
| 535 | 3300036712 | Ga0316584_0014880 | Ga0316584_0014880_3797_4147 | 116 |
| 536 | 3300037853 | Ga0436364_1504233 | Ga0436364_1504233_283_636 | 116 |
| 537 | 3300039437 | Ga0436365_0772403 | Ga0436365_0772403_9295_9648 | 116 |
| 538 | 3300039438 | Ga0436360_0360375 | Ga0436360_0360375_110_463 | 116 |
| 539 | 3300039447 | Ga0436361_0556079 | Ga0436361_0556079_109_462 | 116 |
| 540 | 3300041410 | Ga0439461_0045365 | Ga0439461_0045365_150_500 | 116 |
| 541 | 3300041411 | Ga0439466_0021836 | Ga0439466_0021836_1398_1751 | 116 |
| 542 | 3300041411 | Ga0439466_0030016 | Ga0439466_0030016_230_580 | 116 |
| 543 | 3300041413 | Ga0439465_0009519 | Ga0439465_0009519_2661_3014 | 116 |
| 544 | 3300041413 | Ga0439465_0017121 | Ga0439465_0017121_1726_2076 | 116 |
| 545 | 3300041997 | Ga0439431_0068457 | Ga0439431_0068457_315_665 | 116 |
| 546 | 3300042002 | Ga0439442_010560 | Ga0439442_010560_616_966 | 116 |
| 547 | 3300042004 | Ga0439445_0011393 | Ga0439445_0011393_1725_2078 | 116 |
| 548 | 3300042004 | Ga0439445_0099403 | Ga0439445_0099403_96_446 | 116 |
| 549 | 3300042438 | Ga0439459_0027248 | Ga0439459_0027248_54_410 | 116 |
| 550 | 3300044901 | Ga0466960_0111425 | Ga0466960_0111425_965_1348 | 116 |
| 551 | 3300046500 | Ga0495596_0251562 | Ga0495596_0251562_213_563 | 116 |
| 552 | 3300046507 | Ga0495606_0177833 | Ga0495606_0177833_68_424 | 116 |
| 553 | 3300046515 | Ga0495620_0246934 | Ga0495620_0246934_35_391 | 116 |
| 554 | 3300046515 | Ga0495620_0291617 | Ga0495620_0291617_66_416 | 116 |
| 555 | 3300046524 | Ga0495648_0006972 | Ga0495648_0006972_3759_4115 | 116 |
| 556 | 3300046528 | Ga0495642_0126622 | Ga0495642_0126622_303_659 | 116 |
| 557 | 3300046530 | Ga0495654_0051006 | Ga0495654_0051006_445_801 | 116 |
| 558 | 3300046530 | Ga0495654_0398672 | Ga0495654_0398672_22_372 | 116 |
| 559 | 3300046616 | Ga0495668_0170228 | Ga0495668_0170228_744_1100 | 116 |
| 560 | 3300046616 | Ga0495668_0469349 | Ga0495668_0469349_79_432 | 116 |
| 561 | 3300046648 | Ga0495611_0049495 | Ga0495611_0049495_1095_1451 | 116 |
| 562 | 3300046660 | Ga0495625_0091922 | Ga0495625_0091922_498_851 | 116 |
| 563 | 3300046692 | Ga0495671_0072724 | Ga0495671_0072724_92_442 | 116 |
| 564 | 3300046794 | Ga0495589_0330460 | Ga0495589_0330460_55_405 | 116 |
| 565 | 3300047320 | Ga0495672_0002254 | Ga0495672_0002254_12461_12817 | 116 |
| 566 | 3300047320 | Ga0495672_0492561 | Ga0495672_0492561_20_403 | 116 |
| 567 | 3300047469 | Ga0495673_0004032 | Ga0495673_0004032_3726_4082 | 116 |
| 568 | 3300048903 | Ga0496100_0001679 | Ga0496100_0001679_7689_8045 | 116 |
| 569 | 3300048903 | Ga0496100_0087183 | Ga0496100_0087183_405_758 | 116 |
| 570 | 3300048903 | Ga0496100_0099173 | Ga0496100_0099173_849_1232 | 116 |
| 571 | 3300048903 | Ga0496100_0707139 | Ga0496100_0707139_392_754 | 116 |
| 572 | 3300048904 | Ga0496101_0000126 | Ga0496101_0000126_12454_12810 | 116 |
| 573 | 3300048904 | Ga0496101_0028338 | Ga0496101_0028338_2162_2545 | 116 |
| 574 | 3300048904 | Ga0496101_0273259 | Ga0496101_0273259_213_563 | 116 |
| 575 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_60065_60421 | 116 |
| 576 | 3300048905 | Ga0496102_0030442 | Ga0496102_0030442_3593_3976 | 116 |
| 577 | 3300048905 | Ga0496102_0114555 | Ga0496102_0114555_514_864 | 116 |
| 578 | 3300048905 | Ga0496102_0120605 | Ga0496102_0120605_1372_1755 | 116 |
| 579 | 3300048905 | Ga0496102_0185379 | Ga0496102_0185379_1036_1386 | 116 |
| 580 | 3300048905 | Ga0496102_0988609 | Ga0496102_0988609_206_556 | 116 |
| 581 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_59892_60248 | 116 |
| 582 | 3300048906 | Ga0496103_0058033 | Ga0496103_0058033_421_774 | 116 |
| 583 | 3300048907 | Ga0496104_0021922 | Ga0496104_0021922_1509_1862 | 116 |
| 584 | 3300048907 | Ga0496104_0025837 | Ga0496104_0025837_1329_1712 | 116 |
| 585 | 3300048907 | Ga0496104_0570284 | Ga0496104_0570284_610_960 | 116 |
| 586 | 3300048907 | Ga0496104_0759638 | Ga0496104_0759638_32_388 | 116 |
| 587 | 3300048907 | Ga0496104_1726964 | Ga0496104_1726964_46_396 | 116 |
| 588 | 3300048908 | Ga0496105_0047082 | Ga0496105_0047082_1909_2262 | 116 |
| 589 | 3300048908 | Ga0496105_0074997 | Ga0496105_0074997_1347_1730 | 116 |
| 590 | 3300048908 | Ga0496105_0704217 | Ga0496105_0704217_330_680 | 116 |
| 591 | 3300048909 | Ga0496106_0024628 | Ga0496106_0024628_186_536 | 116 |
| 592 | 3300048909 | Ga0496106_0040391 | Ga0496106_0040391_2009_2365 | 116 |
| 593 | 3300048909 | Ga0496106_0065440 | Ga0496106_0065440_35_388 | 116 |
| 594 | 3300048909 | Ga0496106_0820230 | Ga0496106_0820230_270_653 | 116 |
| 595 | 3300048910 | Ga0496107_0043581 | Ga0496107_0043581_1133_1489 | 116 |
| 596 | 3300048910 | Ga0496107_0097513 | Ga0496107_0097513_1312_1662 | 116 |
| 597 | 3300048910 | Ga0496107_0913937 | Ga0496107_0913937_78_461 | 116 |
| 598 | 3300048911 | Ga0496108_0001533 | Ga0496108_0001533_3475_3825 | 116 |
| 599 | 3300048911 | Ga0496108_0008920 | Ga0496108_0008920_1447_1800 | 116 |
| 600 | 3300048911 | Ga0496108_0023809 | Ga0496108_0023809_2543_2926 | 116 |
| 601 | 3300048911 | Ga0496108_0102183 | Ga0496108_0102183_1837_2187 | 116 |
| 602 | 3300048911 | Ga0496108_0158829 | Ga0496108_0158829_1294_1677 | 116 |
| 603 | 3300048911 | Ga0496108_0178767 | Ga0496108_0178767_306_662 | 116 |
| 604 | 3300048911 | Ga0496108_0203177 | Ga0496108_0203177_647_1009 | 116 |
| 605 | 3300048912 | Ga0496109_0014683 | Ga0496109_0014683_3202_3552 | 116 |
| 606 | 3300048912 | Ga0496109_0039360 | Ga0496109_0039360_1080_1433 | 116 |
| 607 | 3300048912 | Ga0496109_0045533 | Ga0496109_0045533_209_565 | 116 |
| 608 | 3300048912 | Ga0496109_0058592 | Ga0496109_0058592_1654_2004 | 116 |
| 609 | 3300048912 | Ga0496109_0289918 | Ga0496109_0289918_966_1349 | 116 |
| 610 | 3300048912 | Ga0496109_1762432 | Ga0496109_1762432_11_394 | 116 |
| 611 | 3300048913 | Ga0496110_0022181 | Ga0496110_0022181_4711_5064 | 116 |
| 612 | 3300048913 | Ga0496110_0026881 | Ga0496110_0026881_859_1242 | 116 |
| 613 | 3300048913 | Ga0496110_0036193 | Ga0496110_0036193_1194_1544 | 116 |
| 614 | 3300048913 | Ga0496110_0103220 | Ga0496110_0103220_92_448 | 116 |
| 615 | 3300048913 | Ga0496110_0324902 | Ga0496110_0324902_588_971 | 116 |
| 616 | 3300048913 | Ga0496110_1568987 | Ga0496110_1568987_91_453 | 116 |
| 617 | 3300048914 | Ga0496111_0071549 | Ga0496111_0071549_1710_2093 | 116 |
| 618 | 3300048914 | Ga0496111_0334569 | Ga0496111_0334569_450_803 | 116 |
| 619 | 3300048915 | Ga0496112_0006014 | Ga0496112_0006014_2919_3269 | 116 |
| 620 | 3300048915 | Ga0496112_0085169 | Ga0496112_0085169_1743_2096 | 116 |
| 621 | 3300048916 | Ga0496113_0372301 | Ga0496113_0372301_135_485 | 116 |
| 622 | 3300048917 | Ga0496114_0024804 | Ga0496114_0024804_2058_2408 | 116 |
| 623 | 3300048917 | Ga0496114_0050905 | Ga0496114_0050905_2527_2889 | 116 |
| 624 | 3300048917 | Ga0496114_0487927 | Ga0496114_0487927_360_713 | 116 |
| 625 | 3300048918 | Ga0496115_0211039 | Ga0496115_0211039_1114_1467 | 116 |
| 626 | 3300048918 | Ga0496115_0268162 | Ga0496115_0268162_994_1350 | 116 |
| 627 | 3300048918 | Ga0496115_0337099 | Ga0496115_0337099_824_1174 | 116 |
| 628 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_410292_410648 | 116 |
| 629 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_410321_410677 | 116 |
| 630 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_410321_410677 | 116 |
| 631 | 3300048922 | Ga0496119_0000041 | Ga0496119_0000041_30960_31316 | 116 |
| 632 | 3300048923 | Ga0496120_0000027 | Ga0496120_0000027_169689_170045 | 116 |
| 633 | 3300048924 | Ga0496121_0000171 | Ga0496121_0000171_4839_5195 | 116 |
| 634 | 3300048929 | Ga0496126_0018679 | Ga0496126_0018679_166_522 | 116 |
| 635 | 3300049823 | Ga0501044_0035107 | Ga0501044_0035107_4277_4627 | 116 |
| 636 | 3300050489 | nmdc:mga03683_213944_c1 | nmdc:mga03683_213944_c1_420_770 | 116 |
| 637 | 3300050490 | nmdc:mga03n38_135766_c1 | nmdc:mga03n38_135766_c1_758_1108 | 116 |
| 638 | 3300050490 | nmdc:mga03n38_141882_c1 | nmdc:mga03n38_141882_c1_112_483 | 116 |
| 639 | 3300050490 | nmdc:mga03n38_292309_c1 | nmdc:mga03n38_292309_c1_469_819 | 116 |
| 640 | 3300050490 | nmdc:mga03n38_3990_c1 | nmdc:mga03n38_3990_c1_200_571 | 116 |
| 641 | 3300050490 | nmdc:mga03n38_53521_c1 | nmdc:mga03n38_53521_c1_1368_1718 | 116 |
| 642 | 3300050490 | nmdc:mga03n38_82101_c1 | nmdc:mga03n38_82101_c1_650_1006 | 116 |
| 643 | 3300050490 | nmdc:mga03n38_99478_c1 | nmdc:mga03n38_99478_c1_428_778 | 116 |
| 644 | 3300050491 | nmdc:mga00v17_1106_c1 | nmdc:mga00v17_1106_c1_4551_4901 | 116 |
| 645 | 3300050491 | nmdc:mga00v17_263606_c1 | nmdc:mga00v17_263606_c1_83_433 | 116 |
| 646 | 3300050491 | nmdc:mga00v17_62580_c1 | nmdc:mga00v17_62580_c1_1384_1755 | 116 |
| 647 | 3300050492 | nmdc:mga0yw44_1217376_c1 | nmdc:mga0yw44_1217376_c1_64_414 | 116 |
| 648 | 3300050492 | nmdc:mga0yw44_222704_c1 | nmdc:mga0yw44_222704_c1_493_843 | 116 |
| 649 | 3300050492 | nmdc:mga0yw44_33606_c1 | nmdc:mga0yw44_33606_c1_2427_2798 | 116 |
| 650 | 3300050492 | nmdc:mga0yw44_506374_c1 | nmdc:mga0yw44_506374_c1_446_796 | 116 |
| 651 | 3300050494 | nmdc:mga06z11_2710_c1 | nmdc:mga06z11_2710_c1_1918_2289 | 116 |
| 652 | 3300050494 | nmdc:mga06z11_518120_c1 | nmdc:mga06z11_518120_c1_242_625 | 116 |
| 653 | 3300050495 | nmdc:mga04h51_113052_c1 | nmdc:mga04h51_113052_c1_70_441 | 116 |
| 654 | 3300050496 | nmdc:mga07m45_252766_c1 | nmdc:mga07m45_252766_c1_94_444 | 116 |
| 655 | 3300050496 | nmdc:mga07m45_29483_c1 | nmdc:mga07m45_29483_c1_179_529 | 116 |
| 656 | 3300050496 | nmdc:mga07m45_82523_c1 | nmdc:mga07m45_82523_c1_594_965 | 116 |
| 657 | 3300050507 | nmdc:mga05p37_10579_c1 | nmdc:mga05p37_10579_c1_2047_2397 | 116 |
| 658 | 3300050509 | nmdc:mga0qj67_2784_c1 | nmdc:mga0qj67_2784_c1_3934_4284 | 116 |
| 659 | 3300050510 | nmdc:mga06r32_67807_c1 | nmdc:mga06r32_67807_c1_1082_1432 | 116 |
| 660 | 3300050511 | nmdc:mga08y16_256741_c1 | nmdc:mga08y16_256741_c1_713_1063 | 116 |
| 661 | 3300050516 | nmdc:mga0sz30_242218_c1 | nmdc:mga0sz30_242218_c1_255_605 | 116 |
| 662 | 3300050516 | nmdc:mga0sz30_3096_c1 | nmdc:mga0sz30_3096_c1_3938_4288 | 116 |
| 663 | 3300050516 | nmdc:mga0sz30_430244_c1 | nmdc:mga0sz30_430244_c1_68_418 | 116 |
| 664 | 3300050516 | nmdc:mga0sz30_56529_c1 | nmdc:mga0sz30_56529_c1_863_1234 | 116 |
| 665 | 3300053079 | Ga0500610_0003136 | Ga0500610_0003136_669_1022 | 116 |
| 666 | 3300053087 | Ga0500643_009522 | Ga0500643_009522_1440_1793 | 116 |
| 667 | 3300053096 | Ga0500641_0165828 | Ga0500641_0165828_417_767 | 116 |
| 668 | 3300053104 | Ga0500556_0022575 | Ga0500556_0022575_1002_1352 | 116 |
| 669 | 3300053104 | Ga0500556_0387107 | Ga0500556_0387107_174_527 | 116 |
| 670 | 3300053119 | Ga0500595_074527 | Ga0500595_074527_345_695 | 116 |
| 671 | 3300053153 | Ga0500616_0024598 | Ga0500616_0024598_2141_2491 | 116 |
| 672 | 3300053158 | Ga0500627_0021180 | Ga0500627_0021180_74_427 | 116 |
| 673 | 3300053158 | Ga0500627_0250521 | Ga0500627_0250521_23_376 | 116 |
| 674 | 3300053730 | Ga0500645_098038 | Ga0500645_098038_311_661 | 116 |
| 675 | 3300059504 | Ga0587082_162021 | Ga0587082_162021_57_407 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nrb-assembly1.cif.gz_2 | htric-hpfd class2 | 0.467 | 20 | 114 |
| 6nrb-assembly1.cif.gz_2 | htric-hpfd class2 | 0.4384 | 20 | 114 |
| 5ndk-assembly2.cif.gz_L5 | crystal structure of aminoglycoside tc007 co-crystallized with 70s ribosome from thermus thermophilus, three trnas and mrna | 0.4193 | 1 | 36 |
| 5tcu-assembly1.cif.gz_LG | methicillin sensitive staphylococcus aureus 70s ribosome | 0.4084 | 1 | 36 |
| 5ip0-assembly1.cif.gz_D | pha binding protein phap (phasin) | 0.3584 | 16 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8Q4E3_11_140_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.4308 | 15 | 107 | 1.20.1270.60 |
| 4wce200 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4199 | 1 | 36 | 1.10.287.3980 |
| af_Q58427_1_163_1.10.287.1490 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3995 | 16 | 115 | 1.10.287.1490 |
| af_O54897_16_359_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.3878 | 1 | 106 | 3.40.50.720 |
| af_A0A2R8Q4E3_11_140_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.3691 | 15 | 107 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A6P0C1-F1-model_v4 | DUF485 domain-containing protein | 0.8658 | 19 | 111 |
GO:0005886
|
| AF-A0A238Y6A9-F1-model_v4 | Uncharacterized membrane protein, DUF485 family | 0.8515 | 16 | 114 |
GO:0005886
|
| AF-A0A7C1P1Z8-F1-model_v4 | DUF485 domain-containing protein | 0.8515 | 19 | 112 |
GO:0005886
|
| AF-A0A837JF64-F1-model_v4 | deleted | 0.85 | 14 | 113 |
|
| AF-A0A2G1YHX8-F1-model_v4 | DUF485 domain-containing protein | 0.8463 | 18 | 110 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar