F474329

General Info

Members Datasets Scaffolds Average Seq Length
673 380 1346 180

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0574654|Ga0496113_0574654_208_837
Length 209
Sequence MSAIVPMAGAAVDLRIIGSLGVTAMPTGRLRAFNFQKWINENEHLLKPPVVNKKVFEDGDMTVQVVGGPNERADYHDDPVEEFFYQLKGDMVLKVGDNGNFYDVPIREGEVFLLPPHVRHSPQRPPGSIGLVVEPSRSDDPIDAFDWYCFECGALVHRIEVKVTHLVRDLPPLYEAFFNNEKARTCKKCGALHPGKRPPAGWGLDALKA

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
249 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
349 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
365 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
366 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
375 2738543024 Aminobacter sp. AP02 Isolate Unclassified
376 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
377 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
378 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
379 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
380 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.15
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 0.15
Rhizoplane 8.02
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0574654 3300048916 Bacteria 903
2 CNAas_1008029 3300000532 Bacteria 691
3 JGI24739J22299_10072123 3300001989 Bacteria 1073
4 JGI24743J22301_10028615 3300001991 Bacteria 1091
5 JGI24735J21928_10155859 3300002067 Bacteria 660
6 JGI24750J21931_1003168 3300002070 Bacteria 1975
7 JGI24745J21846_1020369 3300002073 Bacteria 777
8 JGI24738J21930_10007171 3300002075 Bacteria 2584
9 JGI24744J21845_10006589 3300002077 Bacteria 2408
10 JGI24033J26618_1008239 3300002155 Bacteria 1197
11 JGI24034J26672_10002638 3300002239 Bacteria 2469
12 JGI24742J22300_10003699 3300002244 Bacteria 2483
13 JGI24751J29686_10007798 3300002459 Bacteria 2188
14 JGI24751J29686_10057879 3300002459 Bacteria 799
15 JGI25158J39367_1003410 3300002739 Bacteria 2456
16 JGI25159J45721_1000019 3300002987 Bacteria 127304
17 JGI25153J46596_10011648 3300003215 Bacteria 3869
18 JGI25153J46596_10058639 3300003215 Bacteria 1058
19 JGI25160J50197_1000054 3300003354 Bacteria 127304
20 JGI25161J50226_1004604 3300003374 Bacteria 2850
21 Ga0055526_1000208 3300003771 Bacteria 50614
22 Ga0055531_10000207 3300003794 Bacteria 64818
23 JGI25405J52794_10014328 3300003911 Bacteria 1547
24 Ga0055543_1000214 3300004625 Bacteria 46687
25 Ga0065165_1000136 3300005262 Bacteria 127754
26 Ga0070676_10585881 3300005328 Bacteria 802
27 Ga0070676_10769883 3300005328 Bacteria 708
28 Ga0070683_100581931 3300005329 Bacteria 1071
29 Ga0070690_100022008 3300005330 Bacteria 3897
30 Ga0070690_100610200 3300005330 Bacteria 829
31 Ga0070670_100006128 3300005331 Bacteria 10169
32 Ga0070670_100485235 3300005331 Bacteria 1098
33 Ga0070670_100986740 3300005331 Bacteria 766
34 Ga0070680_100042294 3300005336 Bacteria 3697
35 Ga0070682_100048446 3300005337 Bacteria 2646
36 Ga0070682_100052147 3300005337 Bacteria 2559
37 Ga0070682_100395284 3300005337 Bacteria 1044
38 Ga0068868_100204845 3300005338 Bacteria 1646
39 Ga0070660_100028775 3300005339 Bacteria 4160
40 Ga0070689_100024590 3300005340 Bacteria 4519
41 Ga0070689_100506663 3300005340 Bacteria 1035
42 Ga0070687_100004561 3300005343 Bacteria 5536
43 Ga0070661_100119773 3300005344 Bacteria 1971
44 Ga0070661_101140179 3300005344 Bacteria 651
45 Ga0070692_10037249 3300005345 Bacteria 2472
46 Ga0070668_100064306 3300005347 Bacteria 2844
47 Ga0070668_100225970 3300005347 Bacteria 1546
48 Ga0070668_100244806 3300005347 Bacteria 1486
49 Ga0070668_100422340 3300005347 Bacteria 1142
50 Ga0070668_100693537 3300005347 Bacteria 898
51 Ga0070669_100016022 3300005353 Bacteria 5349
52 Ga0070669_100052907 3300005353 Bacteria 2971
53 Ga0070669_100113146 3300005353 Bacteria 2062
54 Ga0070675_100065779 3300005354 Bacteria 2998
55 Ga0070675_100100450 3300005354 Bacteria 2436
56 Ga0070675_100150002 3300005354 Bacteria 1998
57 Ga0070671_100039244 3300005355 Bacteria 3930
58 Ga0070671_100787255 3300005355 Bacteria 828
59 Ga0070674_100016934 3300005356 Bacteria 4574
60 Ga0070674_100155644 3300005356 Bacteria 1729
61 Ga0070673_100035318 3300005364 Bacteria 3789
62 Ga0070673_100976198 3300005364 Bacteria 788
63 Ga0070688_100030982 3300005365 Bacteria 3214
64 Ga0070688_100035228 3300005365 Bacteria 3040
65 Ga0070688_100273953 3300005365 Bacteria 1210
66 Ga0070659_100081125 3300005366 Bacteria 2590
67 Ga0070667_100061691 3300005367 Bacteria 3174
68 Ga0070667_100422857 3300005367 Bacteria 1215
69 Ga0070703_10004681 3300005406 Bacteria 3826
70 Ga0070709_10007595 3300005434 Bacteria 5953
71 Ga0070709_10855176 3300005434 Bacteria 717
72 Ga0070714_100029460 3300005435 Bacteria 4563
73 Ga0070714_100872382 3300005435 Bacteria 873
74 Ga0070713_100000228 3300005436 Bacteria 37335
75 Ga0070713_100261880 3300005436 Bacteria 1580
76 Ga0070713_100484129 3300005436 Bacteria 1166
77 Ga0070713_100592291 3300005436 Bacteria 1053
78 Ga0070710_10009059 3300005437 Bacteria 4867
79 Ga0070701_10028248 3300005438 Bacteria 2757
80 Ga0070701_10361523 3300005438 Bacteria 910
81 Ga0070711_100007938 3300005439 Bacteria 6473
82 Ga0070705_100196552 3300005440 Bacteria 1379
83 Ga0070705_100273899 3300005440 Bacteria 1197
84 Ga0070700_100059758 3300005441 Bacteria 2401
85 Ga0070700_100059839 3300005441 Bacteria 2399
86 Ga0070694_100276907 3300005444 Bacteria 1278
87 Ga0070708_100556909 3300005445 Bacteria 1081
88 Ga0070663_100342717 3300005455 Bacteria 1208
89 Ga0070678_100025208 3300005456 Bacteria 3997
90 Ga0070678_100052508 3300005456 Bacteria 2960
91 Ga0070662_100125916 3300005457 Bacteria 1969
92 Ga0070662_100412769 3300005457 Bacteria 1116
93 Ga0070681_10010494 3300005458 Bacteria 9147
94 Ga0068867_100028538 3300005459 Bacteria 4018
95 Ga0070699_100011845 3300005518 Bacteria 7526
96 Ga0070699_100763540 3300005518 Bacteria 884
97 Ga0070679_100060893 3300005530 Bacteria 3762
98 Ga0068853_100108364 3300005539 Bacteria 2464
99 Ga0068853_100373696 3300005539 Bacteria 1330
100 Ga0070672_100039686 3300005543 Bacteria 3607
101 Ga0070672_100175932 3300005543 Bacteria 1782
102 Ga0070672_100780147 3300005543 Bacteria 840
103 Ga0070672_101145825 3300005543 Bacteria 692
104 Ga0070686_100078060 3300005544 Bacteria 2185
105 Ga0070695_100033470 3300005545 Bacteria 3215
106 Ga0070696_100370599 3300005546 Bacteria 1114
107 Ga0070696_101168716 3300005546 Bacteria 649
108 Ga0070693_100058533 3300005547 Bacteria 2231
109 Ga0070693_100246890 3300005547 Bacteria 1181
110 Ga0070665_100326207 3300005548 Bacteria 1539
111 Ga0070704_100072155 3300005549 Bacteria 2511
112 Ga0070704_100660268 3300005549 Bacteria 924
113 Ga0068855_100059630 3300005563 Bacteria 4465
114 Ga0070664_100193689 3300005564 Bacteria 1812
115 Ga0068857_100073855 3300005577 Bacteria 3039
116 Ga0068857_100083899 3300005577 Bacteria 2847
117 Ga0068854_100674706 3300005578 Bacteria 890
118 Ga0068856_100047472 3300005614 Bacteria 4229
119 Ga0068856_100334958 3300005614 Bacteria 1531
120 Ga0070702_100038317 3300005615 Bacteria 2668
121 Ga0068852_100051693 3300005616 Bacteria 3528
122 Ga0068859_100196281 3300005617 Bacteria 2103
123 Ga0068859_100269121 3300005617 Bacteria 1796
124 Ga0068859_100408512 3300005617 Bacteria 1454
125 Ga0068859_101197622 3300005617 Bacteria 836
126 Ga0068864_100018180 3300005618 Bacteria 5867
127 Ga0068864_100048407 3300005618 Bacteria 3654
128 Ga0068866_10010103 3300005718 Bacteria 4036
129 Ga0068866_10409708 3300005718 Bacteria 877
130 Ga0068861_100018910 3300005719 Bacteria 4912
131 Ga0068861_100084721 3300005719 Bacteria 2489
132 Ga0068851_10061921 3300005834 Bacteria 1919
133 Ga0068851_10305918 3300005834 Bacteria 915
134 Ga0068851_10444772 3300005834 Bacteria 769
135 Ga0068870_10022186 3300005840 Bacteria 3117
136 Ga0068870_10666480 3300005840 Bacteria 714
137 Ga0068870_10680932 3300005840 Bacteria 707
138 Ga0068863_100022431 3300005841 Bacteria 6029
139 Ga0068863_100088578 3300005841 Bacteria 2933
140 Ga0068858_100029103 3300005842 Bacteria 5129
141 Ga0068860_100088868 3300005843 Bacteria 2941
142 Ga0068860_100397782 3300005843 Bacteria 1362
143 Ga0068860_100517814 3300005843 Bacteria 1192
144 Ga0068860_100924972 3300005843 Bacteria 889
145 Ga0068862_100014631 3300005844 Bacteria 6516
146 Ga0068862_100030441 3300005844 Bacteria 4549
147 Ga0068862_100275301 3300005844 Bacteria 1541
148 Ga0081455_10003886 3300005937 Bacteria 17015
149 Ga0081455_10013304 3300005937 Bacteria 8144
150 Ga0081455_10013389 3300005937 Bacteria 8112
151 Ga0081455_10101615 3300005937 Bacteria 2307
152 Ga0081455_10250594 3300005937 Bacteria 1295
153 Ga0081538_10018899 3300005981 Bacteria 5150
154 Ga0081538_10170775 3300005981 Bacteria 949
155 Ga0081540_1004291 3300005983 Bacteria 10923
156 Ga0081539_10025670 3300005985 Bacteria 3785
157 Ga0081539_10236422 3300005985 Bacteria 821
158 Ga0070717_10066912 3300006028 Bacteria 2988
159 Ga0075365_10049753 3300006038 Bacteria 2762
160 Ga0075365_10060115 3300006038 Bacteria 2534
161 Ga0075368_10048655 3300006042 Bacteria 1680
162 Ga0075363_100351605 3300006048 Bacteria 861
163 Ga0075364_10246764 3300006051 Bacteria 1213
164 Ga0075364_10274049 3300006051 Bacteria 1148
165 Ga0075364_10420343 3300006051 Bacteria 912
166 Ga0070715_10001658 3300006163 Bacteria 6602
167 Ga0070716_100015339 3300006173 Bacteria 3936
168 Ga0070712_100005756 3300006175 Bacteria 7658
169 Ga0070712_100016522 3300006175 Bacteria 4769
170 Ga0070712_100045366 3300006175 Bacteria 3034
171 Ga0075362_10010542 3300006177 Bacteria 3611
172 Ga0075362_10047953 3300006177 Bacteria 1904
173 Ga0075362_10059046 3300006177 Bacteria 1732
174 Ga0075362_10227625 3300006177 Bacteria 912
175 Ga0075367_10273363 3300006178 Bacteria 1061
176 Ga0075367_10354432 3300006178 Bacteria 926
177 Ga0075369_10137586 3300006186 Bacteria 1112
178 Ga0097621_100563830 3300006237 Bacteria 1038
179 Ga0075370_10230376 3300006353 Bacteria 1096
180 Ga0068871_100073905 3300006358 Bacteria 2811
181 Ga0075428_100150648 3300006844 Bacteria 2527
182 Ga0075428_100369146 3300006844 Bacteria 1539
183 Ga0075428_100496116 3300006844 Bacteria 1306
184 Ga0075428_100813697 3300006844 Bacteria 993
185 Ga0075430_100000489 3300006846 Bacteria 29724
186 Ga0075430_100416002 3300006846 Bacteria 1110
187 Ga0075431_100032026 3300006847 Bacteria 5418
188 Ga0075431_100267415 3300006847 Bacteria 1734
189 Ga0075431_101182452 3300006847 Bacteria 728
190 Ga0075433_10350960 3300006852 Bacteria 1304
191 Ga0075433_10376881 3300006852 Bacteria 1253
192 Ga0075433_10638768 3300006852 Bacteria 934
193 Ga0075434_100029260 3300006871 Bacteria 5418
194 Ga0075434_100538495 3300006871 Bacteria 1188
195 Ga0075434_100889190 3300006871 Bacteria 906
196 Ga0075429_100358358 3300006880 Bacteria 1277
197 Ga0068865_100076210 3300006881 Bacteria 2393
198 Ga0068865_100837687 3300006881 Bacteria 796
199 Ga0075436_100349795 3300006914 Bacteria 1065
200 Ga0097620_100196285 3300006931 Bacteria 2103
201 Ga0097620_100269125 3300006931 Bacteria 1796
202 Ga0097620_100408510 3300006931 Bacteria 1454
203 Ga0097620_101197672 3300006931 Bacteria 836
204 Ga0075435_100168134 3300007076 Bacteria 1849
205 Ga0075435_100645473 3300007076 Bacteria 919
206 Ga0099794_10013569 3300007265 Bacteria 3549
207 Ga0105251_10182615 3300009011 Bacteria 945
208 Ga0105240_10031655 3300009093 Bacteria 6855
209 Ga0111539_10043503 3300009094 Bacteria 5383
210 Ga0111539_10279404 3300009094 Bacteria 1943
211 Ga0111539_10303129 3300009094 Bacteria 1859
212 Ga0111539_10339700 3300009094 Bacteria 1748
213 Ga0111539_11673606 3300009094 Bacteria 738
214 Ga0105245_10286251 3300009098 Bacteria 1613
215 Ga0105245_11273773 3300009098 Bacteria 784
216 Ga0105247_10003999 3300009101 Bacteria 9488
217 Ga0114129_10022872 3300009147 Bacteria 8865
218 Ga0114129_10056510 3300009147 Bacteria 5496
219 Ga0114129_10123187 3300009147 Bacteria 3566
220 Ga0114129_10187995 3300009147 Bacteria 2806
221 Ga0114129_10472400 3300009147 Bacteria 1642
222 Ga0114129_10927318 3300009147 Bacteria 1102
223 Ga0114129_10938633 3300009147 Bacteria 1094
224 Ga0105243_10404059 3300009148 Bacteria 1270
225 Ga0105243_10982061 3300009148 Bacteria 846
226 Ga0105243_11408081 3300009148 Bacteria 718
227 Ga0105241_10019775 3300009174 Bacteria 4969
228 Ga0105241_10145145 3300009174 Bacteria 1936
229 Ga0105241_10367646 3300009174 Bacteria 1253
230 Ga0105241_10445844 3300009174 Bacteria 1144
231 Ga0105242_10069465 3300009176 Bacteria 2918
232 Ga0105248_10010977 3300009177 Bacteria 9994
233 Ga0105237_10027557 3300009545 Bacteria 5798
234 Ga0105237_10052792 3300009545 Bacteria 4079
235 Ga0105238_10042795 3300009551 Bacteria 4584
236 Ga0105238_10289351 3300009551 Bacteria 1620
237 Ga0105238_10390182 3300009551 Bacteria 1384
238 Ga0105238_10702398 3300009551 Bacteria 1023
239 Ga0105249_10132300 3300009553 Bacteria 2383
240 Ga0105249_10235202 3300009553 Bacteria 1809
241 Ga0105239_10268475 3300010375 Bacteria 1918
242 Ga0157323_1026712 3300012495 Bacteria 588
243 Ga0157371_10357656 3300013102 Bacteria 1064
244 Ga0171462_1008 3300013250 Bacteria 384318
245 Ga0157374_10002466 3300013296 Bacteria 15626
246 Ga0157378_10687651 3300013297 Bacteria 1041
247 Ga0163162_10160664 3300013306 Bacteria 2368
248 Ga0163162_10450383 3300013306 Bacteria 1419
249 Ga0163162_10485326 3300013306 Bacteria 1367
250 Ga0163162_10601763 3300013306 Bacteria 1225
251 Ga0163162_11717081 3300013306 Bacteria 717
252 Ga0163162_11754865 3300013306 Bacteria 709
253 Ga0157372_10107829 3300013307 Bacteria 3187
254 Ga0157372_11465695 3300013307 Bacteria 786
255 Ga0157375_10074980 3300013308 Bacteria 3406
256 Ga0157375_10093953 3300013308 Bacteria 3066
257 Ga0157375_10204179 3300013308 Bacteria 2132
258 Ga0163163_10065244 3300014325 Bacteria 3614
259 Ga0163163_10302645 3300014325 Bacteria 1651
260 Ga0163163_11206942 3300014325 Bacteria 819
261 Ga0157380_10149490 3300014326 Bacteria 2017
262 Ga0157380_11063398 3300014326 Bacteria 846
263 Ga0157377_10009721 3300014745 Bacteria 4732
264 Ga0157379_10051363 3300014968 Bacteria 3683
265 Ga0157376_10740315 3300014969 Bacteria 991
266 Ga0163161_10009261 3300017792 Bacteria 6811
267 Ga0163161_10213042 3300017792 Bacteria 1493
268 Ga0163161_10223536 3300017792 Bacteria 1459
269 Ga0163161_11268834 3300017792 Bacteria 639
270 Ga0213872_10009397 3300021361 Bacteria 4690
271 Ga0209436_100377 3300025208 Bacteria 20095
272 Ga0209130_1000120 3300025284 Bacteria 127890
273 Ga0209676_1000470 3300025292 Bacteria 67541
274 Ga0209025_1040310 3300025294 Bacteria 2023
275 Ga0209025_1092003 3300025294 Bacteria 988
276 Ga0209564_1000031 3300025295 Bacteria 494703
277 Ga0209564_1020963 3300025295 Bacteria 2373
278 Ga0209758_1000240 3300025297 Bacteria 114169
279 Ga0209758_1000454 3300025297 Bacteria 68307
280 Ga0209050_1001158 3300025298 Bacteria 31492
281 Ga0207426_1000206 3300025302 Bacteria 140737
282 Ga0209257_1000545 3300025304 Bacteria 64769
283 Ga0207697_10133742 3300025315 Bacteria 1073
284 Ga0207656_10148016 3300025321 Bacteria 1110
285 Ga0207642_10244947 3300025899 Bacteria 1014
286 Ga0207642_10342952 3300025899 Bacteria 879
287 Ga0207710_10003741 3300025900 Bacteria 6735
288 Ga0207688_10198597 3300025901 Bacteria 1202
289 Ga0207680_10373682 3300025903 Bacteria 1004
290 Ga0207647_10000538 3300025904 Bacteria 30267
291 Ga0207647_10017187 3300025904 Bacteria 4922
292 Ga0207685_10001261 3300025905 Bacteria 5170
293 Ga0207685_10074692 3300025905 Bacteria 1385
294 Ga0207645_10005621 3300025907 Bacteria 9063
295 Ga0207645_10156096 3300025907 Bacteria 1491
296 Ga0207645_10653844 3300025907 Bacteria 714
297 Ga0207643_10008578 3300025908 Bacteria 5483
298 Ga0207643_10251931 3300025908 Bacteria 1088
299 Ga0207643_10458920 3300025908 Bacteria 811
300 Ga0207654_10007133 3300025911 Bacteria 5628
301 Ga0207707_10106198 3300025912 Bacteria 2454
302 Ga0207707_10600804 3300025912 Bacteria 931
303 Ga0207695_10029726 3300025913 Bacteria 6029
304 Ga0207671_10187862 3300025914 Bacteria 1610
305 Ga0207693_10006232 3300025915 Bacteria 9894
306 Ga0207693_10010129 3300025915 Bacteria 7657
307 Ga0207693_10031271 3300025915 Bacteria 4205
308 Ga0207660_10005267 3300025917 Bacteria 8408
309 Ga0207662_10002550 3300025918 Bacteria 9172
310 Ga0207662_10126162 3300025918 Bacteria 1609
311 Ga0207657_10014959 3300025919 Bacteria 7539
312 Ga0207657_10155711 3300025919 Bacteria 1858
313 Ga0207649_10261457 3300025920 Bacteria 1251
314 Ga0207652_10061963 3300025921 Bacteria 3231
315 Ga0207681_10083088 3300025923 Bacteria 2266
316 Ga0207694_10247685 3300025924 Bacteria 1457
317 Ga0207694_10783394 3300025924 Bacteria 805
318 Ga0207650_10078560 3300025925 Bacteria 2497
319 Ga0207650_10584193 3300025925 Bacteria 938
320 Ga0207659_10031800 3300025926 Bacteria 3617
321 Ga0207659_10231406 3300025926 Bacteria 1491
322 Ga0207700_10000458 3300025928 Bacteria 23936
323 Ga0207700_10352105 3300025928 Bacteria 1282
324 Ga0207700_10672769 3300025928 Bacteria 923
325 Ga0207664_10014133 3300025929 Bacteria 5756
326 Ga0207664_10796929 3300025929 Bacteria 850
327 Ga0207644_10011094 3300025931 Bacteria 5953
328 Ga0207690_10488842 3300025932 Bacteria 994
329 Ga0207706_10016057 3300025933 Bacteria 6767
330 Ga0207706_10124541 3300025933 Bacteria 2267
331 Ga0207709_10380047 3300025935 Bacteria 1075
332 Ga0207670_10010427 3300025936 Bacteria 5354
333 Ga0207670_10069675 3300025936 Bacteria 2427
334 Ga0207670_10689018 3300025936 Bacteria 845
335 Ga0207669_10336040 3300025937 Bacteria 1161
336 Ga0207704_10036351 3300025938 Bacteria 2833
337 Ga0207704_10050693 3300025938 Bacteria 2505
338 Ga0207665_10062700 3300025939 Bacteria 2523
339 Ga0207665_10239319 3300025939 Bacteria 1337
340 Ga0207691_10034072 3300025940 Bacteria 4739
341 Ga0207691_10088020 3300025940 Bacteria 2785
342 Ga0207691_10637078 3300025940 Bacteria 901
343 Ga0207711_10124287 3300025941 Bacteria 2306
344 Ga0207689_10028029 3300025942 Bacteria 4711
345 Ga0207689_10070958 3300025942 Bacteria 2861
346 Ga0207661_10061516 3300025944 Bacteria 3034
347 Ga0207661_10722930 3300025944 Bacteria 916
348 Ga0207667_10105841 3300025949 Bacteria 2902
349 Ga0207667_10356304 3300025949 Bacteria 1492
350 Ga0207651_10472251 3300025960 Bacteria 1080
351 Ga0207712_10122586 3300025961 Bacteria 1969
352 Ga0207668_10059726 3300025972 Bacteria 2673
353 Ga0207668_10078014 3300025972 Bacteria 2390
354 Ga0207658_10337067 3300025986 Bacteria 1310
355 Ga0207677_10571605 3300026023 Bacteria 988
356 Ga0207703_10097955 3300026035 Bacteria 2479
357 Ga0207703_10242772 3300026035 Bacteria 1620
358 Ga0207639_10569463 3300026041 Bacteria 1042
359 Ga0207639_11056377 3300026041 Bacteria 761
360 Ga0207678_10068557 3300026067 Bacteria 3043
361 Ga0207708_10048938 3300026075 Bacteria 3219
362 Ga0207708_10333523 3300026075 Bacteria 1240
363 Ga0207708_10551265 3300026075 Bacteria 972
364 Ga0207702_10335404 3300026078 Bacteria 1443
365 Ga0207702_10472774 3300026078 Bacteria 1219
366 Ga0207641_10163175 3300026088 Bacteria 2027
367 Ga0207641_10260372 3300026088 Bacteria 1624
368 Ga0207641_10458329 3300026088 Bacteria 1233
369 Ga0207648_10016479 3300026089 Bacteria 6750
370 Ga0207676_10104791 3300026095 Bacteria 2353
371 Ga0207674_10049520 3300026116 Bacteria 4296
372 Ga0207674_10522298 3300026116 Bacteria 1147
373 Ga0207675_100180897 3300026118 Bacteria 2019
374 Ga0207675_100543687 3300026118 Bacteria 1160
375 Ga0207683_10061868 3300026121 Bacteria 3295
376 Ga0207698_10232602 3300026142 Bacteria 1674
377 Ga0207698_11225347 3300026142 Bacteria 765
378 Ga0268266_10718390 3300028379 Bacteria 963
379 Ga0268266_10918573 3300028379 Bacteria 847
380 Ga0268265_10026195 3300028380 Bacteria 4146
381 Ga0268265_10564705 3300028380 Bacteria 1082
382 Ga0268264_10323422 3300028381 Bacteria 1459
383 Ga0268264_10578140 3300028381 Bacteria 1105
384 Ga0265762_1004877 3300030760 Bacteria 2403
385 Ga0265325_10000126 3300031241 Bacteria 52410
386 Ga0265325_10146883 3300031241 Bacteria 1118
387 Ga0265340_10106389 3300031247 Bacteria 1300
388 Ga0307513_10788461 3300031456 Bacteria 656
389 Ga0307508_10360749 3300031616 Bacteria 1044
390 Ga0307516_10002086 3300031730 Bacteria 27199
391 Ga0307406_11235575 3300031901 Bacteria 650
392 Ga0373930_0077872 3300034816 Bacteria 763
393 Ga0373948_0060453 3300034817 Bacteria 831
394 Ga0373958_0034988 3300034819 Bacteria 1004
395 Ga0373938_0148256 3300034957 Bacteria 623
396 Ga0373926_0008293 3300035083 Bacteria 3457
397 Ga0373926_0231917 3300035083 Bacteria 714
398 Ga0373929_0007924 3300035085 Bacteria 1951
399 Ga0373952_0008401 3300035092 Bacteria 1959
400 Ga0373952_0188954 3300035092 Bacteria 598
401 Ga0373923_0019507 3300035111 Bacteria 2627
402 Ga0373936_0045624 3300035113 Bacteria 1766
403 Ga0373939_0040979 3300035114 Bacteria 1394
404 Ga0373941_0046219 3300035115 Bacteria 1367
405 Ga0373945_0003378 3300035116 Bacteria 5016
406 Ga0373945_0200713 3300035116 Bacteria 828
407 Ga0373960_0226958 3300035121 Bacteria 670
408 Ga0373943_0036009 3300035170 Bacteria 2368
409 Ga0373943_0134613 3300035170 Bacteria 1326
410 Ga0373946_0475611 3300035171 Bacteria 638
411 Ga0373955_0380277 3300035172 Bacteria 857
412 Ga0373942_0126814 3300035207 Bacteria 802
413 Ga0373962_0014931 3300035242 Bacteria 1985
414 Ga0373931_0004830 3300035691 Bacteria 6190
415 Ga0373931_0010469 3300035691 Bacteria 4458
416 Ga0373931_0017444 3300035691 Bacteria 3552
417 Ga0373931_0036291 3300035691 Bacteria 2569
418 Ga0373931_0677814 3300035691 Bacteria 679
419 Ga0373927_0200253 3300035695 Bacteria 1311
420 Ga0373947_0013983 3300035725 Bacteria 4600
421 Ga0373947_0031615 3300035725 Bacteria 3117
422 Ga0316584_0569609 3300036712 Bacteria 789
423 Ga0373925_0024984 3300037068 Bacteria 4363
424 Ga0373925_0388018 3300037068 Bacteria 1138
425 Ga0373925_0444499 3300037068 Bacteria 1061
426 Ga0373925_0802886 3300037068 Bacteria 776
427 Ga0395900_0107375 3300037418 Bacteria 2868
428 Ga0395901_0564145 3300038443 Bacteria 1152
429 Ga0436365_1782075 3300039437 Bacteria 731
430 Ga0436361_0416025 3300039447 Bacteria 7315
431 Ga0439453_0019893 3300041408 Bacteria 1199
432 Ga0451849_1086790 3300041505 Bacteria 774
433 Ga0451853_0334491 3300041512 Bacteria 1316
434 Ga0439431_0177587 3300041997 Bacteria 614
435 Ga0450923_032765 3300042125 Bacteria 1066
436 Ga0466966_0116698 3300044684 Bacteria 1643
437 Ga0466959_0711068 3300045049 Bacteria 673
438 Ga0495617_053038 3300046452 Bacteria 1347
439 Ga0495603_0065677 3300046455 Bacteria 2138
440 Ga0495590_0247988 3300046457 Bacteria 662
441 Ga0495638_0072624 3300046460 Bacteria 2102
442 Ga0495638_0175196 3300046460 Bacteria 1228
443 Ga0495605_0036112 3300046474 Bacteria 2494
444 Ga0495639_0070574 3300046475 Bacteria 1613
445 Ga0495584_0015084 3300046491 Bacteria 3938
446 Ga0495584_0053167 3300046491 Bacteria 2038
447 Ga0495585_0084182 3300046492 Bacteria 1720
448 Ga0495585_0261227 3300046492 Bacteria 861
449 Ga0495594_0086958 3300046499 Bacteria 1749
450 Ga0495607_0057728 3300046501 Bacteria 2223
451 Ga0495616_0040451 3300046513 Bacteria 2382
452 Ga0495616_0177351 3300046513 Bacteria 949
453 Ga0495631_0048199 3300046518 Bacteria 1869
454 Ga0495631_0311132 3300046518 Bacteria 670
455 Ga0495637_0061657 3300046520 Bacteria 1537
456 Ga0495644_0057772 3300046523 Bacteria 1459
457 Ga0495644_0321617 3300046523 Bacteria 607
458 Ga0495652_0092113 3300046529 Bacteria 2477
459 Ga0495652_0283098 3300046529 Bacteria 1213
460 Ga0495665_0427284 3300046531 Bacteria 671
461 Ga0495640_0108514 3300046533 Bacteria 1815
462 Ga0495640_0278465 3300046533 Bacteria 1042
463 Ga0495640_0348161 3300046533 Bacteria 915
464 Ga0495598_0000777 3300046537 Bacteria 6079
465 Ga0495609_0137027 3300046538 Bacteria 1046
466 Ga0495597_0185816 3300046542 Bacteria 838
467 Ga0495622_0098737 3300046557 Bacteria 1339
468 Ga0495656_0004164 3300046615 Bacteria 4933
469 Ga0495634_0378518 3300046642 Bacteria 844
470 Ga0495611_0180105 3300046648 Bacteria 988
471 Ga0495625_0379545 3300046660 Bacteria 887
472 Ga0495661_0186434 3300046665 Bacteria 1096
473 Ga0495647_0054199 3300046681 Bacteria 1566
474 Ga0495658_0070213 3300046683 Bacteria 2032
475 Ga0495658_0528114 3300046683 Bacteria 755
476 Ga0495613_0405439 3300046689 Bacteria 929
477 Ga0495624_0248653 3300046690 Bacteria 1075
478 Ga0495670_0078591 3300046691 Bacteria 1678
479 Ga0495670_0401175 3300046691 Bacteria 741
480 Ga0495671_0459459 3300046692 Bacteria 608
481 Ga0495649_0411744 3300046694 Bacteria 678
482 Ga0495589_0168307 3300046794 Bacteria 1042
483 Ga0495674_0216476 3300047319 Bacteria 1585
484 Ga0495676_0155703 3300047321 Bacteria 1621
485 Ga0495680_0386852 3300047322 Bacteria 968
486 Ga0495683_0194538 3300047323 Bacteria 918
487 Ga0495593_0088210 3300047673 Bacteria 1599
488 Ga0495626_0376522 3300048091 Bacteria 551
489 Ga0496100_0015932 3300048903 Bacteria 4402
490 Ga0496100_0046519 3300048903 Bacteria 2791
491 Ga0496100_0080012 3300048903 Bacteria 2204
492 Ga0496101_0139625 3300048904 Bacteria 1846
493 Ga0496101_0337375 3300048904 Bacteria 1183
494 Ga0496102_0057638 3300048905 Bacteria 3547
495 Ga0496103_0010821 3300048906 Bacteria 5400
496 Ga0496103_0066521 3300048906 Bacteria 2249
497 Ga0496103_0128567 3300048906 Bacteria 1617
498 Ga0496104_0015591 3300048907 Bacteria 6888
499 Ga0496104_0015989 3300048907 Bacteria 6810
500 Ga0496104_0048636 3300048907 Bacteria 3998
501 Ga0496104_0052489 3300048907 Bacteria 3851
502 Ga0496104_0345113 3300048907 Bacteria 1401
503 Ga0496105_0005141 3300048908 Bacteria 9925
504 Ga0496105_0147543 3300048908 Bacteria 1934
505 Ga0496105_0180942 3300048908 Bacteria 1726
506 Ga0496105_0203572 3300048908 Bacteria 1615
507 Ga0496106_0032160 3300048909 Bacteria 3911
508 Ga0496106_0039818 3300048909 Bacteria 3519
509 Ga0496106_0102538 3300048909 Bacteria 2220
510 Ga0496107_0001577 3300048910 Bacteria 14176
511 Ga0496107_0025888 3300048910 Bacteria 4157
512 Ga0496107_0163340 3300048910 Bacteria 1651
513 Ga0496108_0008734 3300048911 Bacteria 8214
514 Ga0496108_0027965 3300048911 Bacteria 4663
515 Ga0496108_0148307 3300048911 Bacteria 2023
516 Ga0496109_0004059 3300048912 Bacteria 12236
517 Ga0496109_0014958 3300048912 Bacteria 6754
518 Ga0496109_0140130 3300048912 Bacteria 2261
519 Ga0496109_0243344 3300048912 Bacteria 1693
520 Ga0496109_0486032 3300048912 Bacteria 1165
521 Ga0496110_0004172 3300048913 Bacteria 11158
522 Ga0496110_0039546 3300048913 Bacteria 4107
523 Ga0496110_0307483 3300048913 Bacteria 1444
524 Ga0496111_0009803 3300048914 Bacteria 6403
525 Ga0496111_0010375 3300048914 Bacteria 6248
526 Ga0496111_0083357 3300048914 Bacteria 2336
527 Ga0496111_0116725 3300048914 Bacteria 1969
528 Ga0496112_0041684 3300048915 Bacteria 4491
529 Ga0496112_0409928 3300048915 Bacteria 1294
530 Ga0496113_0000303 3300048916 Bacteria 23409
531 Ga0496113_0060121 3300048916 Bacteria 2863
532 Ga0496113_0174924 3300048916 Bacteria 1701
533 Ga0496113_0196439 3300048916 Bacteria 1603
534 Ga0496114_0002405 3300048917 Bacteria 14267
535 Ga0496114_0019881 3300048917 Bacteria 5446
536 Ga0496114_0068986 3300048917 Bacteria 2968
537 Ga0496115_0012850 3300048918 Bacteria 6313
538 Ga0496115_0013318 3300048918 Bacteria 6220
539 Ga0496115_0038165 3300048918 Bacteria 3810
540 Ga0496115_0050964 3300048918 Bacteria 3319
541 Ga0496115_0131588 3300048918 Bacteria 2062
542 Ga0496121_0285890 3300048924 Bacteria 1126
543 Ga0496126_0488226 3300048929 Bacteria 986
544 Ga0501031_0028479 3300049568 Bacteria 3641
545 Ga0501032_0050852 3300049569 Bacteria 2794
546 Ga0501033_0052727 3300049570 Bacteria 3015
547 Ga0501033_0076944 3300049570 Bacteria 2449
548 Ga0501033_0129712 3300049570 Bacteria 1827
549 Ga0501033_0187411 3300049570 Bacteria 1481
550 Ga0501034_0078119 3300049571 Bacteria 3315
551 Ga0501034_0111384 3300049571 Bacteria 2727
552 Ga0501034_0429486 3300049571 Bacteria 1241
553 Ga0501036_0059207 3300049572 Bacteria 3245
554 Ga0501036_0075262 3300049572 Bacteria 2855
555 Ga0501037_0016358 3300049573 Bacteria 5458
556 Ga0501038_0004917 3300049574 Bacteria 12413
557 Ga0501038_0006006 3300049574 Bacteria 11234
558 Ga0501038_0574630 3300049574 Bacteria 855
559 Ga0501038_0621849 3300049574 Bacteria 815
560 Ga0501039_0044118 3300049575 Bacteria 3443
561 Ga0501039_0107525 3300049575 Bacteria 2179
562 Ga0501039_0595695 3300049575 Bacteria 866
563 Ga0501040_0463910 3300049576 Bacteria 912
564 Ga0501040_0474833 3300049576 Bacteria 901
565 Ga0501041_0046816 3300049577 Bacteria 2632
566 Ga0501042_0041853 3300049578 Bacteria 3259
567 Ga0501042_0062344 3300049578 Bacteria 2664
568 Ga0501042_0655573 3300049578 Bacteria 763
569 Ga0501043_0052385 3300049579 Bacteria 3205
570 Ga0501046_0003578 3300049580 Bacteria 14237
571 Ga0501046_0134442 3300049580 Bacteria 1874
572 Ga0501046_0171663 3300049580 Bacteria 1627
573 Ga0501047_0033499 3300049581 Bacteria 4959
574 Ga0501047_0077495 3300049581 Bacteria 3197
575 Ga0501047_0513549 3300049581 Bacteria 1024
576 Ga0501048_0041938 3300049582 Bacteria 3278
577 Ga0501067_0018989 3300049583 Bacteria 3804
578 Ga0501068_0003407 3300049584 Bacteria 8553
579 Ga0501068_0243999 3300049584 Bacteria 1144
580 Ga0501068_0361172 3300049584 Bacteria 934
581 Ga0501069_0001463 3300049585 Bacteria 11615
582 Ga0501070_0049802 3300049586 Bacteria 3478
583 Ga0501070_0051719 3300049586 Bacteria 3409
584 Ga0501070_0123852 3300049586 Bacteria 2136
585 Ga0501071_0003435 3300049587 Bacteria 9896
586 Ga0501072_0018948 3300049588 Bacteria 5312
587 Ga0501072_0209575 3300049588 Bacteria 1553
588 Ga0501073_0028427 3300049589 Bacteria 3995
589 Ga0501074_0020750 3300049590 Bacteria 4772
590 Ga0501074_0388924 3300049590 Bacteria 989
591 Ga0501075_0005502 3300049591 Bacteria 8667
592 Ga0501076_0045199 3300049592 Bacteria 3477
593 Ga0501079_0017803 3300049741 Bacteria 5429
594 Ga0501079_0029459 3300049741 Bacteria 4215
595 Ga0501080_0017590 3300049742 Bacteria 6611
596 Ga0501080_0031179 3300049742 Bacteria 4967
597 Ga0501080_0206458 3300049742 Bacteria 1802
598 Ga0501080_0483261 3300049742 Bacteria 1108
599 Ga0501081_0148912 3300049743 Bacteria 1681
600 Ga0501081_0207092 3300049743 Bacteria 1424
601 Ga0501083_0055509 3300049744 Bacteria 2655
602 Ga0501035_0043116 3300049822 Bacteria 4066
603 Ga0501035_0133868 3300049822 Bacteria 2159
604 Ga0501035_0318912 3300049822 Bacteria 1306
605 Ga0501044_0001177 3300049823 Bacteria 30995
606 Ga0501044_0031595 3300049823 Bacteria 5572
607 Ga0501044_0080184 3300049823 Bacteria 3306
608 Ga0501044_0110352 3300049823 Bacteria 2759
609 Ga0501044_0133050 3300049823 Bacteria 2480
610 Ga0501044_0207506 3300049823 Bacteria 1915
611 Ga0501045_0028684 3300049824 Bacteria 4016
612 Ga0501045_0792814 3300049824 Bacteria 698
613 Ga0501045_0893309 3300049824 Bacteria 653
614 nmdc:mga03683_60075_c1 3300050489 Bacteria 1605
615 nmdc:mga00v17_25830_c1 3300050491 Bacteria 3417
616 nmdc:mga00v17_453263_c1 3300050491 Bacteria 832
617 nmdc:mga00v17_476247_c1 3300050491 Bacteria 810
618 nmdc:mga0yw44_58335_c1 3300050492 Bacteria 2358
619 nmdc:mga0yw44_620585_c1 3300050492 Bacteria 735
620 nmdc:mga0k408_85228_c1 3300050493 Bacteria 1854
621 nmdc:mga06z11_32820_c1 3300050494 Bacteria 2535
622 nmdc:mga06z11_56423_c1 3300050494 Bacteria 1483
623 nmdc:mga06z11_58112_c1 3300050494 Bacteria 2006
624 nmdc:mga04h51_141604_c1 3300050495 Bacteria 913
625 nmdc:mga07m45_172662_c1 3300050496 Bacteria 1257
626 nmdc:mga07m45_202586_c1 3300050496 Bacteria 1155
627 nmdc:mga07m45_243138_c1 3300050496 Bacteria 1047
628 nmdc:mga07m45_37272_c1 3300050496 Bacteria 2711
629 nmdc:mga07m45_393165_c1 3300050496 Bacteria 805
630 nmdc:mga05p37_189567_c1 3300050507 Bacteria 2497
631 nmdc:mga05p37_410483_c1 3300050507 Bacteria 1579
632 nmdc:mga05p37_559579_c1 3300050507 Bacteria 1300
633 nmdc:mga05p37_738170_c1 3300050507 Bacteria 1087
634 nmdc:mga09592_481590_c1 3300050508 Bacteria 1069
635 nmdc:mga0qj67_300_c1 3300050509 Bacteria 34395
636 nmdc:mga0qj67_433696_c1 3300050509 Bacteria 1059
637 nmdc:mga06r32_12886_c1 3300050510 Bacteria 7557
638 nmdc:mga08y16_239918_c1 3300050511 Bacteria 1874
639 nmdc:mga08y16_241079_c1 3300050511 Bacteria 1869
640 nmdc:mga08y16_327913_c1 3300050511 Bacteria 1575
641 nmdc:mga08y16_408166_c1 3300050511 Bacteria 1389
642 nmdc:mga0n895_18313_c1 3300050512 Bacteria 6476
643 nmdc:mga0n895_910203_c1 3300050512 Bacteria 865
644 nmdc:mga0rr50_60952_c1 3300050513 Bacteria 2840
645 nmdc:mga0a205_442573_c1 3300050515 Bacteria 1160
646 nmdc:mga0sz30_33694_c1 3300050516 Bacteria 1902
647 Ga0495601_0016134 3300053077 Bacteria 4523
648 Ga0495601_0506658 3300053077 Bacteria 778
649 Ga0495612_0024902 3300053078 Bacteria 2403
650 Ga0495612_0342124 3300053078 Bacteria 675
651 Ga0495595_0474275 3300053084 Bacteria 637
652 Ga0495619_0139202 3300053085 Bacteria 1670
653 Ga0495619_0209706 3300053085 Bacteria 1349
654 Ga0500641_0057226 3300053096 Bacteria 1617
655 Ga0500562_118200 3300053108 Bacteria 722
656 Ga0500593_011716 3300053117 Bacteria 3707
657 Ga0500595_048163 3300053119 Bacteria 1332
658 Ga0500642_0011582 3300053130 Bacteria 3161
659 Ga0500642_0072425 3300053130 Bacteria 1570
660 Ga0500568_0034776 3300053139 Bacteria 2060
661 Ga0500616_0107249 3300053153 Bacteria 1355
662 Ga0501084_0670385 3300054114 Bacteria 875
663 Ga0590071_128445 3300059421 Bacteria 650
664 Ga0501082_0045033 3300060353 Bacteria 3805
665 Ga0501082_0383547 3300060353 Bacteria 1226
666 Ga0530510_0016661 3300061734 Bacteria 5204
667 Ga0530510_0524216 3300061734 Bacteria 899
668 2739305969 2738543024 Bacteria 5603683
669 2838128127 2838122688 Bacteria 8803140
670 2840882657 2840878972 Bacteria 5483153
671 2917704099 2917699015 Bacteria 7043791
672 2919682668 2919679072 Bacteria 4629602
673 3005450332 3005445848 Bacteria 6906074
674 Ga0496113_0574654
675 CNAas_1008029
676 JGI24739J22299_10072123
677 JGI24743J22301_10028615
678 JGI24735J21928_10155859
679 JGI24750J21931_1003168
680 JGI24745J21846_1020369
681 JGI24738J21930_10007171
682 JGI24744J21845_10006589
683 JGI24033J26618_1008239
684 JGI24034J26672_10002638
685 JGI24742J22300_10003699
686 JGI24751J29686_10007798
687 JGI24751J29686_10057879
688 JGI25158J39367_1003410
689 JGI25159J45721_1000019
690 JGI25153J46596_10011648
691 JGI25153J46596_10058639
692 JGI25160J50197_1000054
693 JGI25161J50226_1004604
694 Ga0055526_1000208
695 Ga0055531_10000207
696 JGI25405J52794_10014328
697 Ga0055543_1000214
698 Ga0065165_1000136
699 Ga0070676_10585881
700 Ga0070676_10769883
701 Ga0070683_100581931
702 Ga0070690_100022008
703 Ga0070690_100610200
704 Ga0070670_100006128
705 Ga0070670_100485235
706 Ga0070670_100986740
707 Ga0070680_100042294
708 Ga0070682_100048446
709 Ga0070682_100052147
710 Ga0070682_100395284
711 Ga0068868_100204845
712 Ga0070660_100028775
713 Ga0070689_100024590
714 Ga0070689_100506663
715 Ga0070687_100004561
716 Ga0070661_100119773
717 Ga0070661_101140179
718 Ga0070692_10037249
719 Ga0070668_100064306
720 Ga0070668_100225970
721 Ga0070668_100244806
722 Ga0070668_100422340
723 Ga0070668_100693537
724 Ga0070669_100016022
725 Ga0070669_100052907
726 Ga0070669_100113146
727 Ga0070675_100065779
728 Ga0070675_100100450
729 Ga0070675_100150002
730 Ga0070671_100039244
731 Ga0070671_100787255
732 Ga0070674_100016934
733 Ga0070674_100155644
734 Ga0070673_100035318
735 Ga0070673_100976198
736 Ga0070688_100030982
737 Ga0070688_100035228
738 Ga0070688_100273953
739 Ga0070659_100081125
740 Ga0070667_100061691
741 Ga0070667_100422857
742 Ga0070703_10004681
743 Ga0070709_10007595
744 Ga0070709_10855176
745 Ga0070714_100029460
746 Ga0070714_100872382
747 Ga0070713_100000228
748 Ga0070713_100261880
749 Ga0070713_100484129
750 Ga0070713_100592291
751 Ga0070710_10009059
752 Ga0070701_10028248
753 Ga0070701_10361523
754 Ga0070711_100007938
755 Ga0070705_100196552
756 Ga0070705_100273899
757 Ga0070700_100059758
758 Ga0070700_100059839
759 Ga0070694_100276907
760 Ga0070708_100556909
761 Ga0070663_100342717
762 Ga0070678_100025208
763 Ga0070678_100052508
764 Ga0070662_100125916
765 Ga0070662_100412769
766 Ga0070681_10010494
767 Ga0068867_100028538
768 Ga0070699_100011845
769 Ga0070699_100763540
770 Ga0070679_100060893
771 Ga0068853_100108364
772 Ga0068853_100373696
773 Ga0070672_100039686
774 Ga0070672_100175932
775 Ga0070672_100780147
776 Ga0070672_101145825
777 Ga0070686_100078060
778 Ga0070695_100033470
779 Ga0070696_100370599
780 Ga0070696_101168716
781 Ga0070693_100058533
782 Ga0070693_100246890
783 Ga0070665_100326207
784 Ga0070704_100072155
785 Ga0070704_100660268
786 Ga0068855_100059630
787 Ga0070664_100193689
788 Ga0068857_100073855
789 Ga0068857_100083899
790 Ga0068854_100674706
791 Ga0068856_100047472
792 Ga0068856_100334958
793 Ga0070702_100038317
794 Ga0068852_100051693
795 Ga0068859_100196281
796 Ga0068859_100269121
797 Ga0068859_100408512
798 Ga0068859_101197622
799 Ga0068864_100018180
800 Ga0068864_100048407
801 Ga0068866_10010103
802 Ga0068866_10409708
803 Ga0068861_100018910
804 Ga0068861_100084721
805 Ga0068851_10061921
806 Ga0068851_10305918
807 Ga0068851_10444772
808 Ga0068870_10022186
809 Ga0068870_10666480
810 Ga0068870_10680932
811 Ga0068863_100022431
812 Ga0068863_100088578
813 Ga0068858_100029103
814 Ga0068860_100088868
815 Ga0068860_100397782
816 Ga0068860_100517814
817 Ga0068860_100924972
818 Ga0068862_100014631
819 Ga0068862_100030441
820 Ga0068862_100275301
821 Ga0081455_10003886
822 Ga0081455_10013304
823 Ga0081455_10013389
824 Ga0081455_10101615
825 Ga0081455_10250594
826 Ga0081538_10018899
827 Ga0081538_10170775
828 Ga0081540_1004291
829 Ga0081539_10025670
830 Ga0081539_10236422
831 Ga0070717_10066912
832 Ga0075365_10049753
833 Ga0075365_10060115
834 Ga0075368_10048655
835 Ga0075363_100351605
836 Ga0075364_10246764
837 Ga0075364_10274049
838 Ga0075364_10420343
839 Ga0070715_10001658
840 Ga0070716_100015339
841 Ga0070712_100005756
842 Ga0070712_100016522
843 Ga0070712_100045366
844 Ga0075362_10010542
845 Ga0075362_10047953
846 Ga0075362_10059046
847 Ga0075362_10227625
848 Ga0075367_10273363
849 Ga0075367_10354432
850 Ga0075369_10137586
851 Ga0097621_100563830
852 Ga0075370_10230376
853 Ga0068871_100073905
854 Ga0075428_100150648
855 Ga0075428_100369146
856 Ga0075428_100496116
857 Ga0075428_100813697
858 Ga0075430_100000489
859 Ga0075430_100416002
860 Ga0075431_100032026
861 Ga0075431_100267415
862 Ga0075431_101182452
863 Ga0075433_10350960
864 Ga0075433_10376881
865 Ga0075433_10638768
866 Ga0075434_100029260
867 Ga0075434_100538495
868 Ga0075434_100889190
869 Ga0075429_100358358
870 Ga0068865_100076210
871 Ga0068865_100837687
872 Ga0075436_100349795
873 Ga0097620_100196285
874 Ga0097620_100269125
875 Ga0097620_100408510
876 Ga0097620_101197672
877 Ga0075435_100168134
878 Ga0075435_100645473
879 Ga0099794_10013569
880 Ga0105251_10182615
881 Ga0105240_10031655
882 Ga0111539_10043503
883 Ga0111539_10279404
884 Ga0111539_10303129
885 Ga0111539_10339700
886 Ga0111539_11673606
887 Ga0105245_10286251
888 Ga0105245_11273773
889 Ga0105247_10003999
890 Ga0114129_10022872
891 Ga0114129_10056510
892 Ga0114129_10123187
893 Ga0114129_10187995
894 Ga0114129_10472400
895 Ga0114129_10927318
896 Ga0114129_10938633
897 Ga0105243_10404059
898 Ga0105243_10982061
899 Ga0105243_11408081
900 Ga0105241_10019775
901 Ga0105241_10145145
902 Ga0105241_10367646
903 Ga0105241_10445844
904 Ga0105242_10069465
905 Ga0105248_10010977
906 Ga0105237_10027557
907 Ga0105237_10052792
908 Ga0105238_10042795
909 Ga0105238_10289351
910 Ga0105238_10390182
911 Ga0105238_10702398
912 Ga0105249_10132300
913 Ga0105249_10235202
914 Ga0105239_10268475
915 Ga0157323_1026712
916 Ga0157371_10357656
917 Ga0171462_1008
918 Ga0157374_10002466
919 Ga0157378_10687651
920 Ga0163162_10160664
921 Ga0163162_10450383
922 Ga0163162_10485326
923 Ga0163162_10601763
924 Ga0163162_11717081
925 Ga0163162_11754865
926 Ga0157372_10107829
927 Ga0157372_11465695
928 Ga0157375_10074980
929 Ga0157375_10093953
930 Ga0157375_10204179
931 Ga0163163_10065244
932 Ga0163163_10302645
933 Ga0163163_11206942
934 Ga0157380_10149490
935 Ga0157380_11063398
936 Ga0157377_10009721
937 Ga0157379_10051363
938 Ga0157376_10740315
939 Ga0163161_10009261
940 Ga0163161_10213042
941 Ga0163161_10223536
942 Ga0163161_11268834
943 Ga0213872_10009397
944 Ga0209436_100377
945 Ga0209130_1000120
946 Ga0209676_1000470
947 Ga0209025_1040310
948 Ga0209025_1092003
949 Ga0209564_1000031
950 Ga0209564_1020963
951 Ga0209758_1000240
952 Ga0209758_1000454
953 Ga0209050_1001158
954 Ga0207426_1000206
955 Ga0209257_1000545
956 Ga0207697_10133742
957 Ga0207656_10148016
958 Ga0207642_10244947
959 Ga0207642_10342952
960 Ga0207710_10003741
961 Ga0207688_10198597
962 Ga0207680_10373682
963 Ga0207647_10000538
964 Ga0207647_10017187
965 Ga0207685_10001261
966 Ga0207685_10074692
967 Ga0207645_10005621
968 Ga0207645_10156096
969 Ga0207645_10653844
970 Ga0207643_10008578
971 Ga0207643_10251931
972 Ga0207643_10458920
973 Ga0207654_10007133
974 Ga0207707_10106198
975 Ga0207707_10600804
976 Ga0207695_10029726
977 Ga0207671_10187862
978 Ga0207693_10006232
979 Ga0207693_10010129
980 Ga0207693_10031271
981 Ga0207660_10005267
982 Ga0207662_10002550
983 Ga0207662_10126162
984 Ga0207657_10014959
985 Ga0207657_10155711
986 Ga0207649_10261457
987 Ga0207652_10061963
988 Ga0207681_10083088
989 Ga0207694_10247685
990 Ga0207694_10783394
991 Ga0207650_10078560
992 Ga0207650_10584193
993 Ga0207659_10031800
994 Ga0207659_10231406
995 Ga0207700_10000458
996 Ga0207700_10352105
997 Ga0207700_10672769
998 Ga0207664_10014133
999 Ga0207664_10796929
1000 Ga0207644_10011094
1001 Ga0207690_10488842
1002 Ga0207706_10016057
1003 Ga0207706_10124541
1004 Ga0207709_10380047
1005 Ga0207670_10010427
1006 Ga0207670_10069675
1007 Ga0207670_10689018
1008 Ga0207669_10336040
1009 Ga0207704_10036351
1010 Ga0207704_10050693
1011 Ga0207665_10062700
1012 Ga0207665_10239319
1013 Ga0207691_10034072
1014 Ga0207691_10088020
1015 Ga0207691_10637078
1016 Ga0207711_10124287
1017 Ga0207689_10028029
1018 Ga0207689_10070958
1019 Ga0207661_10061516
1020 Ga0207661_10722930
1021 Ga0207667_10105841
1022 Ga0207667_10356304
1023 Ga0207651_10472251
1024 Ga0207712_10122586
1025 Ga0207668_10059726
1026 Ga0207668_10078014
1027 Ga0207658_10337067
1028 Ga0207677_10571605
1029 Ga0207703_10097955
1030 Ga0207703_10242772
1031 Ga0207639_10569463
1032 Ga0207639_11056377
1033 Ga0207678_10068557
1034 Ga0207708_10048938
1035 Ga0207708_10333523
1036 Ga0207708_10551265
1037 Ga0207702_10335404
1038 Ga0207702_10472774
1039 Ga0207641_10163175
1040 Ga0207641_10260372
1041 Ga0207641_10458329
1042 Ga0207648_10016479
1043 Ga0207676_10104791
1044 Ga0207674_10049520
1045 Ga0207674_10522298
1046 Ga0207675_100180897
1047 Ga0207675_100543687
1048 Ga0207683_10061868
1049 Ga0207698_10232602
1050 Ga0207698_11225347
1051 Ga0268266_10718390
1052 Ga0268266_10918573
1053 Ga0268265_10026195
1054 Ga0268265_10564705
1055 Ga0268264_10323422
1056 Ga0268264_10578140
1057 Ga0265762_1004877
1058 Ga0265325_10000126
1059 Ga0265325_10146883
1060 Ga0265340_10106389
1061 Ga0307513_10788461
1062 Ga0307508_10360749
1063 Ga0307516_10002086
1064 Ga0307406_11235575
1065 Ga0373930_0077872
1066 Ga0373948_0060453
1067 Ga0373958_0034988
1068 Ga0373938_0148256
1069 Ga0373926_0008293
1070 Ga0373926_0231917
1071 Ga0373929_0007924
1072 Ga0373952_0008401
1073 Ga0373952_0188954
1074 Ga0373923_0019507
1075 Ga0373936_0045624
1076 Ga0373939_0040979
1077 Ga0373941_0046219
1078 Ga0373945_0003378
1079 Ga0373945_0200713
1080 Ga0373960_0226958
1081 Ga0373943_0036009
1082 Ga0373943_0134613
1083 Ga0373946_0475611
1084 Ga0373955_0380277
1085 Ga0373942_0126814
1086 Ga0373962_0014931
1087 Ga0373931_0004830
1088 Ga0373931_0010469
1089 Ga0373931_0017444
1090 Ga0373931_0036291
1091 Ga0373931_0677814
1092 Ga0373927_0200253
1093 Ga0373947_0013983
1094 Ga0373947_0031615
1095 Ga0316584_0569609
1096 Ga0373925_0024984
1097 Ga0373925_0388018
1098 Ga0373925_0444499
1099 Ga0373925_0802886
1100 Ga0395900_0107375
1101 Ga0395901_0564145
1102 Ga0436365_1782075
1103 Ga0436361_0416025
1104 Ga0439453_0019893
1105 Ga0451849_1086790
1106 Ga0451853_0334491
1107 Ga0439431_0177587
1108 Ga0450923_032765
1109 Ga0466966_0116698
1110 Ga0466959_0711068
1111 Ga0495617_053038
1112 Ga0495603_0065677
1113 Ga0495590_0247988
1114 Ga0495638_0072624
1115 Ga0495638_0175196
1116 Ga0495605_0036112
1117 Ga0495639_0070574
1118 Ga0495584_0015084
1119 Ga0495584_0053167
1120 Ga0495585_0084182
1121 Ga0495585_0261227
1122 Ga0495594_0086958
1123 Ga0495607_0057728
1124 Ga0495616_0040451
1125 Ga0495616_0177351
1126 Ga0495631_0048199
1127 Ga0495631_0311132
1128 Ga0495637_0061657
1129 Ga0495644_0057772
1130 Ga0495644_0321617
1131 Ga0495652_0092113
1132 Ga0495652_0283098
1133 Ga0495665_0427284
1134 Ga0495640_0108514
1135 Ga0495640_0278465
1136 Ga0495640_0348161
1137 Ga0495598_0000777
1138 Ga0495609_0137027
1139 Ga0495597_0185816
1140 Ga0495622_0098737
1141 Ga0495656_0004164
1142 Ga0495634_0378518
1143 Ga0495611_0180105
1144 Ga0495625_0379545
1145 Ga0495661_0186434
1146 Ga0495647_0054199
1147 Ga0495658_0070213
1148 Ga0495658_0528114
1149 Ga0495613_0405439
1150 Ga0495624_0248653
1151 Ga0495670_0078591
1152 Ga0495670_0401175
1153 Ga0495671_0459459
1154 Ga0495649_0411744
1155 Ga0495589_0168307
1156 Ga0495674_0216476
1157 Ga0495676_0155703
1158 Ga0495680_0386852
1159 Ga0495683_0194538
1160 Ga0495593_0088210
1161 Ga0495626_0376522
1162 Ga0496100_0015932
1163 Ga0496100_0046519
1164 Ga0496100_0080012
1165 Ga0496101_0139625
1166 Ga0496101_0337375
1167 Ga0496102_0057638
1168 Ga0496103_0010821
1169 Ga0496103_0066521
1170 Ga0496103_0128567
1171 Ga0496104_0015591
1172 Ga0496104_0015989
1173 Ga0496104_0048636
1174 Ga0496104_0052489
1175 Ga0496104_0345113
1176 Ga0496105_0005141
1177 Ga0496105_0147543
1178 Ga0496105_0180942
1179 Ga0496105_0203572
1180 Ga0496106_0032160
1181 Ga0496106_0039818
1182 Ga0496106_0102538
1183 Ga0496107_0001577
1184 Ga0496107_0025888
1185 Ga0496107_0163340
1186 Ga0496108_0008734
1187 Ga0496108_0027965
1188 Ga0496108_0148307
1189 Ga0496109_0004059
1190 Ga0496109_0014958
1191 Ga0496109_0140130
1192 Ga0496109_0243344
1193 Ga0496109_0486032
1194 Ga0496110_0004172
1195 Ga0496110_0039546
1196 Ga0496110_0307483
1197 Ga0496111_0009803
1198 Ga0496111_0010375
1199 Ga0496111_0083357
1200 Ga0496111_0116725
1201 Ga0496112_0041684
1202 Ga0496112_0409928
1203 Ga0496113_0000303
1204 Ga0496113_0060121
1205 Ga0496113_0174924
1206 Ga0496113_0196439
1207 Ga0496114_0002405
1208 Ga0496114_0019881
1209 Ga0496114_0068986
1210 Ga0496115_0012850
1211 Ga0496115_0013318
1212 Ga0496115_0038165
1213 Ga0496115_0050964
1214 Ga0496115_0131588
1215 Ga0496121_0285890
1216 Ga0496126_0488226
1217 Ga0501031_0028479
1218 Ga0501032_0050852
1219 Ga0501033_0052727
1220 Ga0501033_0076944
1221 Ga0501033_0129712
1222 Ga0501033_0187411
1223 Ga0501034_0078119
1224 Ga0501034_0111384
1225 Ga0501034_0429486
1226 Ga0501036_0059207
1227 Ga0501036_0075262
1228 Ga0501037_0016358
1229 Ga0501038_0004917
1230 Ga0501038_0006006
1231 Ga0501038_0574630
1232 Ga0501038_0621849
1233 Ga0501039_0044118
1234 Ga0501039_0107525
1235 Ga0501039_0595695
1236 Ga0501040_0463910
1237 Ga0501040_0474833
1238 Ga0501041_0046816
1239 Ga0501042_0041853
1240 Ga0501042_0062344
1241 Ga0501042_0655573
1242 Ga0501043_0052385
1243 Ga0501046_0003578
1244 Ga0501046_0134442
1245 Ga0501046_0171663
1246 Ga0501047_0033499
1247 Ga0501047_0077495
1248 Ga0501047_0513549
1249 Ga0501048_0041938
1250 Ga0501067_0018989
1251 Ga0501068_0003407
1252 Ga0501068_0243999
1253 Ga0501068_0361172
1254 Ga0501069_0001463
1255 Ga0501070_0049802
1256 Ga0501070_0051719
1257 Ga0501070_0123852
1258 Ga0501071_0003435
1259 Ga0501072_0018948
1260 Ga0501072_0209575
1261 Ga0501073_0028427
1262 Ga0501074_0020750
1263 Ga0501074_0388924
1264 Ga0501075_0005502
1265 Ga0501076_0045199
1266 Ga0501079_0017803
1267 Ga0501079_0029459
1268 Ga0501080_0017590
1269 Ga0501080_0031179
1270 Ga0501080_0206458
1271 Ga0501080_0483261
1272 Ga0501081_0148912
1273 Ga0501081_0207092
1274 Ga0501083_0055509
1275 Ga0501035_0043116
1276 Ga0501035_0133868
1277 Ga0501035_0318912
1278 Ga0501044_0001177
1279 Ga0501044_0031595
1280 Ga0501044_0080184
1281 Ga0501044_0110352
1282 Ga0501044_0133050
1283 Ga0501044_0207506
1284 Ga0501045_0028684
1285 Ga0501045_0792814
1286 Ga0501045_0893309
1287 nmdc:mga03683_60075_c1
1288 nmdc:mga00v17_25830_c1
1289 nmdc:mga00v17_453263_c1
1290 nmdc:mga00v17_476247_c1
1291 nmdc:mga0yw44_58335_c1
1292 nmdc:mga0yw44_620585_c1
1293 nmdc:mga0k408_85228_c1
1294 nmdc:mga06z11_32820_c1
1295 nmdc:mga06z11_56423_c1
1296 nmdc:mga06z11_58112_c1
1297 nmdc:mga04h51_141604_c1
1298 nmdc:mga07m45_172662_c1
1299 nmdc:mga07m45_202586_c1
1300 nmdc:mga07m45_243138_c1
1301 nmdc:mga07m45_37272_c1
1302 nmdc:mga07m45_393165_c1
1303 nmdc:mga05p37_189567_c1
1304 nmdc:mga05p37_410483_c1
1305 nmdc:mga05p37_559579_c1
1306 nmdc:mga05p37_738170_c1
1307 nmdc:mga09592_481590_c1
1308 nmdc:mga0qj67_300_c1
1309 nmdc:mga0qj67_433696_c1
1310 nmdc:mga06r32_12886_c1
1311 nmdc:mga08y16_239918_c1
1312 nmdc:mga08y16_241079_c1
1313 nmdc:mga08y16_327913_c1
1314 nmdc:mga08y16_408166_c1
1315 nmdc:mga0n895_18313_c1
1316 nmdc:mga0n895_910203_c1
1317 nmdc:mga0rr50_60952_c1
1318 nmdc:mga0a205_442573_c1
1319 nmdc:mga0sz30_33694_c1
1320 Ga0495601_0016134
1321 Ga0495601_0506658
1322 Ga0495612_0024902
1323 Ga0495612_0342124
1324 Ga0495595_0474275
1325 Ga0495619_0139202
1326 Ga0495619_0209706
1327 Ga0500641_0057226
1328 Ga0500562_118200
1329 Ga0500593_011716
1330 Ga0500595_048163
1331 Ga0500642_0011582
1332 Ga0500642_0072425
1333 Ga0500568_0034776
1334 Ga0500616_0107249
1335 Ga0501084_0670385
1336 Ga0590071_128445
1337 Ga0501082_0045033
1338 Ga0501082_0383547
1339 Ga0530510_0016661
1340 Ga0530510_0524216
1341 2739305969
1342 2838128127
1343 2840882657
1344 2917704099
1345 2919682668
1346 3005450332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06052

3-HAO

3-hydroxyanthranilic acid dioxygenase

28

178

0.96

PF07883

Cupin_2

Cupin domain

58

128

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u57-assembly1.cif.gz_D psf4 in complex with fe2+ and (s)-2-hpp 0.8707 28 113
5v26-assembly1.cif.gz_A 1.78 angstrom crystal structure of p97h 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.8687 6 171
6d60-assembly1.cif.gz_A crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase i142p from cupriavidus metallidurans 0.8659 6 174
6bvr-assembly1.cif.gz_A crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase i142a from cupriavidus metallidurans 0.865 6 174
5v28-assembly1.cif.gz_A 2.72 angstrom crystal structure of p97a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.8641 6 174
ID Description Score Start End Superfamily
1yfuA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8847 10 174 2.60.120.10
1yfuA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8747 10 174 2.60.120.10
af_A0A1D6GLE7_2_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.873 51 108 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8605 37 111 2.60.120.10
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8498 6 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6P7X5F2-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase-like 0.9594 41 121 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874
AF-A0A2D7XF30-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) 0.9559 39 172 GO:0000334
GO:0005506
GO:0019363
AF-R9AUK4-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase 0.9557 41 138 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874
AF-A0A534AN74-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) 0.9484 42 169 GO:0000334
GO:0005506
GO:0019363
AF-A0A800GI75-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) 0.9481 47 175 GO:0000334
GO:0005506
GO:0019363

Map