F474277

General Info

Members Datasets Scaffolds Average Seq Length
673 399 647 152

Family's Representative Sequence

Representative Sequence 3300004799|Ga0058863_10022113|Ga0058863_100221131
Length 182
Sequence MAPAVMLEPHTPFIALGTEITAMAVDMFLKLDGIKGESLDATHKDEIDVLAWSWGLSQSGSTHVGGGSGAGKVNIQDISFTKWVDKSSPVLFYDCAAGKHITEATLTVRKAGEKPLEYLKINLKDLIVSSISTGGSGGEDRLTENVTLNFGKVQVTYTPQKKDGSGDAQVVNGWDIQTNQKL

Samples

Sample ID Description Type Environment
1 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221556 Massilia sp. Root1485 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221684 Massilia sp. Root133 Isolate Unclassified
16 2818991435 Caulobacter henricii 536 Isolate Unclassified
17 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
18 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
19 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
20 2904424332 Duganella sp. 1411 Isolate Rhizosphere
21 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
22 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
23 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
37 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
38 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
200 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
201 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
228 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
343 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
344 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
387 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
388 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
389 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
392 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
393 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 639633007 Azoarcus olearius BH72 Isolate Unclassified
399 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.23
Metatranscriptomes 5.05
Isolates 3.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0.45
Rhizoplane 2.67
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 6.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002469 3300002773 Bacteria 7006
2 JGI25150J39212_1002495 3300002774 Bacteria 4557
3 JGI25153J46596_10005824 3300003215 Bacteria 6404
4 rootL2_10093421 3300003322 Bacteria 4672
5 rootL2_10128998 3300003322 Bacteria 1743
6 rootH1_10132987 3300003323 Bacteria 3341
7 Ga0055526_1005023 3300003771 Bacteria 7737
8 Ga0055526_1005529 3300003771 Bacteria 7229
9 Ga0055537_1007066 3300003773 Bacteria 2761
10 Ga0055524_1000182 3300003775 Bacteria 70730
11 Ga0055524_1006279 3300003775 Bacteria 5174
12 Ga0055524_1082106 3300003775 Bacteria 583
13 Ga0055534_1042626 3300003784 Bacteria 664
14 Ga0055530_10000037 3300003791 Bacteria 116741
15 Ga0055530_10012424 3300003791 Bacteria 2971
16 Ga0055530_10043783 3300003791 Bacteria 1078
17 Ga0055540_1003124 3300003792 Bacteria 8208
18 Ga0055531_10000557 3300003794 Bacteria 32742
19 Ga0055531_10043071 3300003794 Bacteria 1282
20 Ga0058858_1158617 3300004785 Bacteria 863
21 Ga0058859_10842610 3300004798 Unclassified 794
22 Ga0058863_10022113 3300004799 Bacteria 950
23 Ga0058863_11830666 3300004799 Bacteria 4264
24 Ga0058861_10021452 3300004800 Bacteria 901
25 Ga0058861_11921876 3300004800 Bacteria 3764
26 Ga0058860_11397319 3300004801 Bacteria 715
27 Ga0058860_11538292 3300004801 Bacteria 1545
28 Ga0058860_12134235 3300004801 Bacteria 785
29 Ga0058862_10008156 3300004803 Bacteria 1568
30 Ga0058862_12692344 3300004803 Bacteria 3473
31 Ga0058862_12871773 3300004803 Bacteria 1217
32 Ga0065165_1000615 3300005262 Bacteria 51725
33 Ga0070658_10105728 3300005327 Bacteria 2328
34 Ga0070683_100071547 3300005329 Bacteria 3236
35 Ga0068869_100179405 3300005334 Bacteria 1660
36 Ga0070666_10241251 3300005335 Bacteria 1278
37 Ga0070680_100002662 3300005336 Bacteria 13236
38 Ga0070680_100006366 3300005336 Bacteria 8968
39 Ga0070680_100116848 3300005336 Bacteria 2224
40 Ga0070680_100224391 3300005336 Unclassified 1586
41 Ga0070680_100587637 3300005336 Bacteria 956
42 Ga0070680_100807117 3300005336 Unclassified 809
43 Ga0068868_101040511 3300005338 Bacteria 751
44 Ga0070660_100498789 3300005339 Unclassified 1013
45 Ga0070691_10287996 3300005341 Unclassified 893
46 Ga0070687_100723982 3300005343 Bacteria 697
47 Ga0070669_100133338 3300005353 Bacteria 1908
48 Ga0070675_100450676 3300005354 Bacteria 1154
49 Ga0070674_100231661 3300005356 Unclassified 1442
50 Ga0070688_100048473 3300005365 Bacteria 2640
51 Ga0070667_100197769 3300005367 Bacteria 1783
52 Ga0070709_10198086 3300005434 Bacteria 1421
53 Ga0070714_100546863 3300005435 Bacteria 1108
54 Ga0070694_100012071 3300005444 Bacteria 5365
55 Ga0070708_100044519 3300005445 Bacteria 3903
56 Ga0070708_100143747 3300005445 Bacteria 2214
57 Ga0070678_100031236 3300005456 Bacteria 3671
58 Ga0070678_100091416 3300005456 Bacteria 2335
59 Ga0070678_100165666 3300005456 Bacteria 1795
60 Ga0070678_100256737 3300005456 Unclassified 1468
61 Ga0070662_100264234 3300005457 Bacteria 1387
62 Ga0070681_10001907 3300005458 Bacteria 18810
63 Ga0070681_10193820 3300005458 Bacteria 1951
64 Ga0068867_100110734 3300005459 Unclassified 2109
65 Ga0070685_10311616 3300005466 Unclassified 1064
66 Ga0070706_100059014 3300005467 Bacteria 3541
67 Ga0070706_100560864 3300005467 Bacteria 1062
68 Ga0070707_100362489 3300005468 Bacteria 1408
69 Ga0070698_100333961 3300005471 Bacteria 1447
70 Ga0070698_101096864 3300005471 Bacteria 744
71 Ga0070679_100001193 3300005530 Bacteria 22833
72 Ga0070679_100001971 3300005530 Bacteria 18411
73 Ga0070679_100171998 3300005530 Unclassified 2139
74 Ga0070679_100219890 3300005530 Bacteria 1861
75 Ga0070684_100083380 3300005535 Bacteria 2832
76 Ga0070697_100254164 3300005536 Unclassified 1503
77 Ga0070697_101475259 3300005536 Bacteria 608
78 Ga0070672_100331843 3300005543 Bacteria 1294
79 Ga0070665_100027839 3300005548 Bacteria 5692
80 Ga0068855_100135254 3300005563 Bacteria 2813
81 Ga0068855_100324882 3300005563 Bacteria 1700
82 Ga0068855_100748706 3300005563 Unclassified 1042
83 Ga0068855_101143462 3300005563 Bacteria 812
84 Ga0070664_100391096 3300005564 Bacteria 1270
85 Ga0068854_100610014 3300005578 Bacteria 933
86 Ga0068856_100451997 3300005614 Bacteria 1305
87 Ga0068852_100052884 3300005616 Bacteria 3493
88 Ga0068852_101225068 3300005616 Unclassified 772
89 Ga0068859_100007356 3300005617 Bacteria 11171
90 Ga0068859_100100382 3300005617 Bacteria 2950
91 Ga0068864_100070433 3300005618 Bacteria 3043
92 Ga0068864_100083232 3300005618 Bacteria 2809
93 Ga0068866_10025543 3300005718 Bacteria 2778
94 Ga0068851_10083545 3300005834 Bacteria 1671
95 Ga0068863_100088411 3300005841 Bacteria 2936
96 Ga0068863_100153974 3300005841 Bacteria 2200
97 Ga0068863_100373581 3300005841 Bacteria 1391
98 Ga0068863_100409645 3300005841 Bacteria 1327
99 Ga0068863_100930611 3300005841 Bacteria 870
100 Ga0068858_100181912 3300005842 Bacteria 1985
101 Ga0068858_100896103 3300005842 Bacteria 867
102 Ga0068860_100629064 3300005843 Bacteria 1080
103 Ga0068862_100189320 3300005844 Unclassified 1851
104 Ga0081538_10069435 3300005981 Bacteria 1952
105 Ga0075364_10501552 3300006051 Bacteria 830
106 Ga0070716_100549068 3300006173 Bacteria 861
107 Ga0075366_10122003 3300006195 Bacteria 1571
108 Ga0097621_100715318 3300006237 Bacteria 923
109 Ga0075370_10033556 3300006353 Bacteria 2874
110 Ga0075370_10838997 3300006353 Bacteria 561
111 Ga0068871_100251431 3300006358 Bacteria 1540
112 Ga0068871_100432399 3300006358 Unclassified 1177
113 Ga0075428_100022695 3300006844 Bacteria 6946
114 Ga0075430_100015375 3300006846 Bacteria 6515
115 Ga0075431_100000941 3300006847 Bacteria 25660
116 Ga0075433_11423449 3300006852 Unclassified 599
117 Ga0075429_100024405 3300006880 Bacteria 5246
118 Ga0075429_101330961 3300006880 Unclassified 626
119 Ga0068865_100262622 3300006881 Bacteria 1367
120 Ga0097620_100007356 3300006931 Bacteria 11171
121 Ga0097620_100100384 3300006931 Bacteria 2950
122 Ga0079104_1000333 3300006946 Bacteria 57718
123 Ga0105251_10023081 3300009011 Bacteria 3217
124 Ga0105251_10063868 3300009011 Bacteria 1727
125 Ga0105244_10000079 3300009036 Bacteria 107070
126 Ga0105240_10159674 3300009093 Bacteria 2679
127 Ga0111539_10836118 3300009094 Bacteria 1071
128 Ga0105247_10127208 3300009101 Bacteria 1657
129 Ga0105247_11075912 3300009101 Bacteria 633
130 Ga0114129_10131009 3300009147 Bacteria 3444
131 Ga0105243_10772248 3300009148 Unclassified 944
132 Ga0105243_11258507 3300009148 Unclassified 755
133 Ga0105242_10789854 3300009176 Bacteria 939
134 Ga0105248_10045882 3300009177 Bacteria 4899
135 Ga0105248_10225457 3300009177 Bacteria 2109
136 Ga0105248_10983521 3300009177 Bacteria 953
137 Ga0105238_10680362 3300009551 Bacteria 1040
138 Ga0157327_1023884 3300012512 Bacteria 713
139 Ga0157370_10010706 3300013104 Bacteria 9650
140 Ga0157369_10502363 3300013105 Bacteria 1254
141 Ga0157369_10758997 3300013105 Bacteria 997
142 Ga0157374_10258764 3300013296 Bacteria 1714
143 Ga0157378_10205693 3300013297 Bacteria 1864
144 Ga0163162_10001320 3300013306 Bacteria 23166
145 Ga0163162_10022603 3300013306 Bacteria 6199
146 Ga0163162_10088294 3300013306 Bacteria 3180
147 Ga0163162_11681545 3300013306 Bacteria 725
148 Ga0157372_10020425 3300013307 Bacteria 7145
149 Ga0157372_10195755 3300013307 Bacteria 2341
150 Ga0157372_10237871 3300013307 Unclassified 2113
151 Ga0157372_10757280 3300013307 Bacteria 1129
152 Ga0157375_10013360 3300013308 Bacteria 7302
153 Ga0157375_10161954 3300013308 Bacteria 2380
154 Ga0163163_10000226 3300014325 Bacteria 58312
155 Ga0157380_10078260 3300014326 Bacteria 2697
156 Ga0157380_10454051 3300014326 Bacteria 1232
157 Ga0157376_10281662 3300014969 Bacteria 1566
158 Ga0157376_11069920 3300014969 Bacteria 831
159 Ga0163161_10103296 3300017792 Bacteria 2124
160 Ga0163161_10588390 3300017792 Unclassified 916
161 Ga0206356_11608922 3300020070 Bacteria 1095
162 Ga0154015_1582689 3300020610 Bacteria 630
163 Ga0213872_10159972 3300021361 Unclassified 980
164 Ga0213876_10000155 3300021384 Bacteria 72486
165 Ga0213875_10116180 3300021388 Bacteria 1250
166 Ga0207425_1000452 3300025245 Bacteria 26650
167 Ga0209129_1000027 3300025258 Bacteria 409587
168 Ga0209565_1004369 3300025263 Bacteria 4312
169 Ga0209565_1011078 3300025263 Bacteria 2211
170 Ga0209673_1011233 3300025273 Bacteria 3706
171 Ga0209673_1020665 3300025273 Bacteria 2326
172 Ga0209675_1006973 3300025291 Bacteria 4424
173 Ga0209675_1018926 3300025291 Bacteria 1912
174 Ga0209675_1047707 3300025291 Bacteria 899
175 Ga0209564_1000046 3300025295 Bacteria 373787
176 Ga0209564_1000142 3300025295 Bacteria 178742
177 Ga0209564_1000818 3300025295 Bacteria 42378
178 Ga0209564_1005525 3300025295 Bacteria 7164
179 Ga0209758_1000052 3300025297 Bacteria 338962
180 Ga0209758_1000246 3300025297 Bacteria 111041
181 Ga0209050_1000058 3300025298 Bacteria 325558
182 Ga0209050_1001069 3300025298 Bacteria 33615
183 Ga0209050_1014421 3300025298 Bacteria 3405
184 Ga0209050_1018180 3300025298 Bacteria 2746
185 Ga0209256_1000024 3300025299 Bacteria 448909
186 Ga0209256_1001716 3300025299 Bacteria 21021
187 Ga0209256_1014547 3300025299 Bacteria 2822
188 Ga0209256_1028527 3300025299 Bacteria 1572
189 Ga0209051_1000155 3300025303 Bacteria 129560
190 Ga0209257_1000236 3300025304 Bacteria 129543
191 Ga0209257_1000259 3300025304 Bacteria 122101
192 Ga0207656_10103245 3300025321 Bacteria 1309
193 Ga0207655_1000188 3300025728 Bacteria 109393
194 Ga0207713_1035062 3300025735 Bacteria 2170
195 Ga0207710_10091215 3300025900 Bacteria 1426
196 Ga0207680_10348640 3300025903 Unclassified 1040
197 Ga0207699_10541724 3300025906 Bacteria 843
198 Ga0207643_10378225 3300025908 Bacteria 892
199 Ga0207705_10080606 3300025909 Bacteria 2372
200 Ga0207705_10211804 3300025909 Bacteria 1470
201 Ga0207684_11223657 3300025910 Unclassified 621
202 Ga0207707_10000732 3300025912 Bacteria 32480
203 Ga0207707_10067747 3300025912 Bacteria 3109
204 Ga0207695_10367320 3300025913 Bacteria 1325
205 Ga0207663_10574231 3300025916 Bacteria 884
206 Ga0207660_10014120 3300025917 Bacteria 5245
207 Ga0207660_10032840 3300025917 Bacteria 3585
208 Ga0207660_10113048 3300025917 Bacteria 2046
209 Ga0207660_10647779 3300025917 Bacteria 861
210 Ga0207657_10399050 3300025919 Bacteria 1082
211 Ga0207649_10355808 3300025920 Bacteria 1085
212 Ga0207652_10022573 3300025921 Bacteria 5207
213 Ga0207652_10051639 3300025921 Bacteria 3525
214 Ga0207652_11408186 3300025921 Unclassified 600
215 Ga0207646_10218024 3300025922 Bacteria 1724
216 Ga0207681_10209874 3300025923 Unclassified 1500
217 Ga0207694_11156925 3300025924 Bacteria 655
218 Ga0207659_10418885 3300025926 Unclassified 1123
219 Ga0207659_10446840 3300025926 Bacteria 1088
220 Ga0207664_10466076 3300025929 Bacteria 1129
221 Ga0207690_10581868 3300025932 Bacteria 912
222 Ga0207706_10313860 3300025933 Bacteria 1365
223 Ga0207709_10075225 3300025935 Unclassified 2158
224 Ga0207704_10153059 3300025938 Bacteria 1630
225 Ga0207704_10473609 3300025938 Bacteria 1004
226 Ga0207704_10532023 3300025938 Unclassified 952
227 Ga0207704_10798840 3300025938 Bacteria 788
228 Ga0207665_10036171 3300025939 Bacteria 3282
229 Ga0207665_10099209 3300025939 Bacteria 2031
230 Ga0207691_10003268 3300025940 Bacteria 15788
231 Ga0207691_10357168 3300025940 Bacteria 1250
232 Ga0207711_10021013 3300025941 Bacteria 5451
233 Ga0207711_10877436 3300025941 Bacteria 834
234 Ga0207711_11414388 3300025941 Bacteria 638
235 Ga0207661_10019114 3300025944 Bacteria 5101
236 Ga0207667_10107881 3300025949 Bacteria 2873
237 Ga0207667_10599363 3300025949 Bacteria 1111
238 Ga0207651_10360502 3300025960 Bacteria 1227
239 Ga0207668_10110183 3300025972 Bacteria 2064
240 Ga0207640_10307673 3300025981 Bacteria 1256
241 Ga0207703_10652173 3300026035 Bacteria 999
242 Ga0207639_10216025 3300026041 Bacteria 1653
243 Ga0207702_10069213 3300026078 Bacteria 3034
244 Ga0207641_10024381 3300026088 Bacteria 4986
245 Ga0207641_10314902 3300026088 Bacteria 1482
246 Ga0207641_10364067 3300026088 Bacteria 1381
247 Ga0207641_10666483 3300026088 Bacteria 1023
248 Ga0207648_10046412 3300026089 Unclassified 3809
249 Ga0207648_10558719 3300026089 Unclassified 1052
250 Ga0207676_10110448 3300026095 Bacteria 2300
251 Ga0207676_10155485 3300026095 Bacteria 1975
252 Ga0207676_11867293 3300026095 Unclassified 599
253 Ga0207674_10233765 3300026116 Bacteria 1786
254 Ga0207674_11363754 3300026116 Bacteria 678
255 Ga0207675_100085272 3300026118 Bacteria 2964
256 Ga0207683_10036996 3300026121 Bacteria 4250
257 Ga0207683_10520972 3300026121 Bacteria 1099
258 Ga0207698_10180921 3300026142 Bacteria 1867
259 Ga0207698_11795013 3300026142 Unclassified 628
260 Ga0209281_1000322 3300027111 Bacteria 84374
261 Ga0268265_10639436 3300028380 Bacteria 1021
262 Ga0268264_10019844 3300028381 Bacteria 5491
263 Ga0268264_10891426 3300028381 Unclassified 892
264 Ga0265318_10318036 3300028577 Bacteria 568
265 Ga0265340_10010391 3300031247 Bacteria 4980
266 Ga0307513_10007974 3300031456 Bacteria 13615
267 Ga0307513_10075226 3300031456 Bacteria 3508
268 Ga0307513_10082794 3300031456 Bacteria 3302
269 Ga0307513_10720466 3300031456 Bacteria 703
270 Ga0307509_10004925 3300031507 Bacteria 18905
271 Ga0307408_100035841 3300031548 Bacteria 3483
272 Ga0316575_10002218 3300031665 Bacteria 6482
273 Ga0265342_10497903 3300031712 Bacteria 622
274 Ga0316576_10007196 3300031727 Bacteria 6983
275 Ga0316576_10024025 3300031727 Bacteria 4253
276 Ga0316576_11164423 3300031727 Unclassified 545
277 Ga0316578_10003454 3300031728 Bacteria 7227
278 Ga0316578_10033641 3300031728 Bacteria 2938
279 Ga0316578_10100083 3300031728 Bacteria 1737
280 Ga0316578_10200339 3300031728 Unclassified 1202
281 Ga0316577_10015853 3300031733 Bacteria 4148
282 Ga0307410_10150694 3300031852 Bacteria 1731
283 Ga0307416_100483379 3300032002 Bacteria 1299
284 Ga0307411_10890372 3300032005 Unclassified 790
285 Ga0316585_10000135 3300032137 Bacteria 14374
286 Ga0316585_10015525 3300032137 Bacteria 2286
287 Ga0316580_10003872 3300032139 Bacteria 4295
288 Ga0316593_10000488 3300032168 Bacteria 7342
289 Ga0316593_10012916 3300032168 Bacteria 2461
290 Ga0316592_1008726 3300033524 Bacteria 2013
291 Ga0316592_1045478 3300033524 Bacteria 977
292 Ga0316592_1045972 3300033524 Bacteria 972
293 Ga0316586_1013613 3300033527 Bacteria 1274
294 Ga0316586_1070231 3300033527 Unclassified 644
295 Ga0316586_1110879 3300033527 Unclassified 530
296 Ga0316588_1028846 3300033528 Bacteria 1296
297 Ga0316588_1074923 3300033528 Unclassified 834
298 Ga0316587_1009144 3300033529 Bacteria 1568
299 Ga0316587_1073882 3300033529 Unclassified 640
300 Ga0316596_1001923 3300033541 Bacteria 4353
301 Ga0316596_1006082 3300033541 Bacteria 2791
302 Ga0316596_1039698 3300033541 Bacteria 1235
303 Ga0316596_1191131 3300033541 Unclassified 568
304 Ga0373957_0109252 3300035120 Bacteria 1113
305 Ga0373955_0301483 3300035172 Bacteria 966
306 Ga0316574_0004903 3300035398 Bacteria 7088
307 Ga0316574_0007153 3300035398 Bacteria 6101
308 Ga0316574_0015422 3300035398 Bacteria 4433
309 Ga0316574_0121960 3300035398 Bacteria 1674
310 Ga0373931_0644463 3300035691 Bacteria 696
311 Ga0373937_0032536 3300036401 Bacteria 4730
312 Ga0373937_0066233 3300036401 Bacteria 3326
313 Ga0373937_0542939 3300036401 Bacteria 1104
314 Ga0310109_049593 3300036534 Unclassified 541
315 Ga0316582_0004722 3300036647 Bacteria 6934
316 Ga0316582_0106664 3300036647 Bacteria 1861
317 Ga0316582_0227241 3300036647 Unclassified 1277
318 Ga0316582_0382842 3300036647 Unclassified 969
319 Ga0316584_0055392 3300036712 Bacteria 2969
320 Ga0316584_0236936 3300036712 Unclassified 1337
321 Ga0395899_0121509 3300037312 Bacteria 1870
322 Ga0395900_0061088 3300037418 Bacteria 3875
323 Ga0395900_0286488 3300037418 Bacteria 1637
324 Ga0395900_0329012 3300037418 Bacteria 1506
325 Ga0395900_0912106 3300037418 Bacteria 801
326 Ga0395898_0140228 3300037466 Bacteria 2314
327 Ga0395898_0245260 3300037466 Bacteria 1708
328 Ga0395905_0120906 3300037471 Bacteria 2461
329 Ga0395905_0131211 3300037471 Bacteria 2356
330 Ga0395905_0347648 3300037471 Bacteria 1374
331 Ga0395905_0573681 3300037471 Bacteria 1029
332 Ga0436364_0657416 3300037853 Bacteria 2095
333 Ga0395901_0675161 3300038443 Bacteria 1033
334 Ga0400491_20990 3300038727 Bacteria 6987
335 Ga0436365_0124459 3300039437 Bacteria 1901
336 Ga0436365_1190722 3300039437 Bacteria 68726
337 Ga0436365_1930978 3300039437 Bacteria 2880
338 Ga0436360_0198049 3300039438 Bacteria 2298
339 Ga0436361_0028601 3300039447 Unclassified 4066
340 Ga0436361_1127599 3300039447 Unclassified 3363
341 Ga0439437_024272 3300042000 Bacteria 744
342 Ga0439448_0083741 3300042005 Bacteria 1073
343 Ga0439455_0020843 3300042012 Bacteria 1557
344 Ga0450890_034873 3300042127 Bacteria 728
345 Ga0439435_0027498 3300042436 Bacteria 1522
346 Ga0439459_0002620 3300042438 Bacteria 2789
347 Ga0451577_0001743 3300042876 Bacteria 28044
348 Ga0439440_0086160 3300042993 Bacteria 837
349 Ga0466969_0189687 3300044656 Bacteria 939
350 Ga0466972_0108906 3300044658 Bacteria 1309
351 Ga0466965_0059795 3300044683 Bacteria 1902
352 Ga0466961_0269813 3300044693 Bacteria 1042
353 Ga0466961_0420101 3300044693 Bacteria 810
354 Ga0466964_0112789 3300044706 Bacteria 1215
355 Ga0466968_0452414 3300044735 Bacteria 635
356 Ga0466970_0187859 3300044765 Bacteria 1147
357 Ga0466957_0019001 3300044842 Bacteria 4040
358 Ga0466959_0106308 3300045049 Bacteria 2006
359 Ga0466959_0164492 3300045049 Bacteria 1558
360 Ga0451576_0038173 3300045051 Bacteria 5083
361 Ga0466958_0183561 3300045836 Bacteria 1328
362 Ga0466967_0174395 3300045976 Bacteria 2025
363 Ga0466967_1034409 3300045976 Bacteria 818
364 Ga0495592_0003568 3300046454 Bacteria 11180
365 Ga0495603_0021112 3300046455 Bacteria 3942
366 Ga0495603_0040025 3300046455 Bacteria 2807
367 Ga0495590_0123163 3300046457 Bacteria 929
368 Ga0495591_000806 3300046458 Bacteria 22207
369 Ga0495591_137425 3300046458 Bacteria 590
370 Ga0495629_0000436 3300046459 Bacteria 34789
371 Ga0495629_0008971 3300046459 Bacteria 7343
372 Ga0495629_0110817 3300046459 Bacteria 1913
373 Ga0495638_0001574 3300046460 Bacteria 20441
374 Ga0495638_0004077 3300046460 Bacteria 11193
375 Ga0495638_0004290 3300046460 Bacteria 10819
376 Ga0495638_0011608 3300046460 Bacteria 6066
377 Ga0495638_0506840 3300046460 Bacteria 607
378 Ga0495641_0021538 3300046461 Bacteria 3242
379 Ga0495641_0076252 3300046461 Bacteria 1503
380 Ga0495651_0016516 3300046462 Bacteria 5718
381 Ga0495651_0066336 3300046462 Bacteria 2755
382 Ga0495653_0001432 3300046463 Bacteria 18609
383 Ga0495653_0009893 3300046463 Bacteria 7797
384 Ga0495653_0024886 3300046463 Bacteria 4817
385 Ga0495650_0006227 3300046471 Bacteria 7479
386 Ga0495580_0000454 3300046472 Bacteria 33966
387 Ga0495580_0007150 3300046472 Bacteria 8988
388 Ga0495580_0105818 3300046472 Bacteria 1954
389 Ga0495582_0008680 3300046473 Bacteria 5603
390 Ga0495582_0784309 3300046473 Bacteria 551
391 Ga0495605_0003916 3300046474 Bacteria 8809
392 Ga0495605_0009041 3300046474 Bacteria 5608
393 Ga0495605_0159260 3300046474 Bacteria 1003
394 Ga0495662_0013480 3300046476 Bacteria 3979
395 Ga0495662_0017902 3300046476 Bacteria 3429
396 Ga0495662_0091525 3300046476 Bacteria 1483
397 Ga0495664_0007110 3300046477 Bacteria 6202
398 Ga0495664_0016662 3300046477 Bacteria 4190
399 Ga0495664_0129883 3300046477 Bacteria 1525
400 Ga0495594_0038887 3300046499 Bacteria 2599
401 Ga0495594_0223823 3300046499 Bacteria 1073
402 Ga0495594_0293698 3300046499 Unclassified 926
403 Ga0495596_0038128 3300046500 Bacteria 1900
404 Ga0495596_0044388 3300046500 Bacteria 1749
405 Ga0495607_0037403 3300046501 Bacteria 2916
406 Ga0495583_0022721 3300046506 Bacteria 3190
407 Ga0495606_0041956 3300046507 Bacteria 3064
408 Ga0495606_0074761 3300046507 Bacteria 2122
409 Ga0495606_0092735 3300046507 Bacteria 1854
410 Ga0495606_0265903 3300046507 Bacteria 944
411 Ga0495608_0141134 3300046511 Bacteria 1537
412 Ga0495610_0083855 3300046512 Bacteria 1457
413 Ga0495610_0092869 3300046512 Bacteria 1365
414 Ga0495616_0000031 3300046513 Bacteria 130957
415 Ga0495616_0193990 3300046513 Bacteria 896
416 Ga0495618_0006609 3300046514 Bacteria 7031
417 Ga0495618_0040991 3300046514 Bacteria 2915
418 Ga0495618_0072283 3300046514 Bacteria 2195
419 Ga0495620_0017356 3300046515 Bacteria 3590
420 Ga0495628_0011906 3300046516 Bacteria 7334
421 Ga0495628_0025554 3300046516 Bacteria 4824
422 Ga0495628_0110360 3300046516 Bacteria 2116
423 Ga0495628_0119613 3300046516 Bacteria 2021
424 Ga0495630_0008810 3300046517 Bacteria 7243
425 Ga0495630_0028380 3300046517 Bacteria 4158
426 Ga0495631_0230616 3300046518 Bacteria 790
427 Ga0495632_0011423 3300046519 Bacteria 5181
428 Ga0495632_0069336 3300046519 Bacteria 1698
429 Ga0495643_0361069 3300046522 Bacteria 648
430 Ga0495643_0365649 3300046522 Bacteria 643
431 Ga0495644_0082696 3300046523 Bacteria 1210
432 Ga0495648_0019060 3300046524 Bacteria 4838
433 Ga0495648_0023871 3300046524 Bacteria 4177
434 Ga0495648_0089242 3300046524 Bacteria 1730
435 Ga0495666_0001761 3300046526 Bacteria 10678
436 Ga0495666_0186969 3300046526 Bacteria 955
437 Ga0495642_0131993 3300046528 Bacteria 1075
438 Ga0495642_0161316 3300046528 Bacteria 972
439 Ga0495642_0468128 3300046528 Bacteria 557
440 Ga0495652_0096851 3300046529 Bacteria 2401
441 Ga0495654_0060996 3300046530 Bacteria 1812
442 Ga0495665_0000684 3300046531 Bacteria 17401
443 Ga0495665_0082262 3300046531 Bacteria 1692
444 Ga0495665_0324830 3300046531 Bacteria 785
445 Ga0495640_0120825 3300046533 Bacteria 1703
446 Ga0495586_0006614 3300046535 Bacteria 6190
447 Ga0495586_0243830 3300046535 Bacteria 1024
448 Ga0495587_0000623 3300046536 Bacteria 23941
449 Ga0495587_0004114 3300046536 Bacteria 9621
450 Ga0495609_0051556 3300046538 Bacteria 1832
451 Ga0495597_0027595 3300046542 Bacteria 2603
452 Ga0495597_0039268 3300046542 Bacteria 2120
453 Ga0495645_0002458 3300046543 Bacteria 12581
454 Ga0495645_0051268 3300046543 Bacteria 3003
455 Ga0495622_0000018 3300046557 Bacteria 173985
456 Ga0495667_0036463 3300046559 Bacteria 3283
457 Ga0495667_0216758 3300046559 Bacteria 1222
458 Ga0495668_0000028 3300046616 Bacteria 286629
459 Ga0495668_0008200 3300046616 Bacteria 6558
460 Ga0495668_0043959 3300046616 Bacteria 2483
461 Ga0495668_0102187 3300046616 Bacteria 1568
462 Ga0495668_0473743 3300046616 Bacteria 689
463 Ga0495634_0004462 3300046642 Bacteria 10980
464 Ga0495634_0261936 3300046642 Bacteria 1054
465 Ga0495634_0365306 3300046642 Bacteria 862
466 Ga0495611_0052761 3300046648 Bacteria 1835
467 Ga0495611_0218241 3300046648 Bacteria 887
468 Ga0495625_0060515 3300046660 Bacteria 2683
469 Ga0495625_0068594 3300046660 Bacteria 2492
470 Ga0495625_0213719 3300046660 Bacteria 1267
471 Ga0495635_0003028 3300046663 Bacteria 11548
472 Ga0495635_0015141 3300046663 Bacteria 5394
473 Ga0495661_0003061 3300046665 Bacteria 12582
474 Ga0495661_0003818 3300046665 Bacteria 11024
475 Ga0495661_0043052 3300046665 Bacteria 2778
476 Ga0495661_0074687 3300046665 Bacteria 1972
477 Ga0495588_0268636 3300046674 Bacteria 899
478 Ga0495657_0079428 3300046675 Bacteria 2125
479 Ga0495599_0076400 3300046678 Bacteria 2091
480 Ga0495599_0107804 3300046678 Bacteria 1735
481 Ga0495623_0002881 3300046679 Bacteria 11335
482 Ga0495623_0019699 3300046679 Bacteria 4361
483 Ga0495646_0030921 3300046680 Bacteria 3340
484 Ga0495646_0033452 3300046680 Bacteria 3195
485 Ga0495646_0055206 3300046680 Bacteria 2386
486 Ga0495669_0030615 3300046684 Bacteria 2362
487 Ga0495669_0113642 3300046684 Bacteria 1266
488 Ga0495669_0121767 3300046684 Unclassified 1223
489 Ga0495613_0011548 3300046689 Bacteria 6565
490 Ga0495613_0108647 3300046689 Bacteria 2000
491 Ga0495613_0164360 3300046689 Bacteria 1577
492 Ga0495624_0006943 3300046690 Bacteria 7985
493 Ga0495624_0022029 3300046690 Bacteria 4218
494 Ga0495624_0027504 3300046690 Bacteria 3723
495 Ga0495624_0054486 3300046690 Bacteria 2521
496 Ga0495670_0004408 3300046691 Bacteria 6906
497 Ga0495670_0280063 3300046691 Bacteria 892
498 Ga0495671_0012743 3300046692 Bacteria 4581
499 Ga0495589_0002595 3300046794 Bacteria 10041
500 Ga0495589_0016853 3300046794 Bacteria 3751
501 Ga0495589_0049937 3300046794 Bacteria 2070
502 Ga0495600_0001426 3300046809 Bacteria 13213
503 Ga0495600_0039484 3300046809 Bacteria 3074
504 Ga0495600_0054224 3300046809 Bacteria 2619
505 Ga0495600_0676955 3300046809 Bacteria 622
506 Ga0495660_0002945 3300046810 Bacteria 10660
507 Ga0495660_0037357 3300046810 Bacteria 2705
508 Ga0495660_0201221 3300046810 Bacteria 951
509 Ga0495581_0000308 3300047315 Bacteria 23951
510 Ga0495581_0010566 3300047315 Bacteria 5337
511 Ga0495604_0002498 3300047317 Bacteria 14692
512 Ga0495604_0022448 3300047317 Bacteria 5038
513 Ga0495674_0095829 3300047319 Bacteria 2529
514 Ga0495672_0002721 3300047320 Bacteria 15870
515 Ga0495672_0016868 3300047320 Bacteria 4902
516 Ga0495676_0010249 3300047321 Bacteria 8506
517 Ga0495676_0031983 3300047321 Bacteria 4445
518 Ga0495676_0240225 3300047321 Bacteria 1240
519 Ga0495680_0022450 3300047322 Bacteria 5257
520 Ga0495680_0043303 3300047322 Bacteria 3566
521 Ga0495680_0335970 3300047322 Bacteria 1054
522 Ga0495683_0016611 3300047323 Bacteria 3821
523 Ga0495683_0056996 3300047323 Bacteria 1942
524 Ga0495687_061217 3300047443 Bacteria 1549
525 Ga0495675_0009494 3300047444 Bacteria 6057
526 Ga0495675_0036533 3300047444 Bacteria 3132
527 Ga0495675_0138038 3300047444 Bacteria 1512
528 Ga0495679_000008 3300047446 Bacteria 367186
529 Ga0495679_000300 3300047446 Bacteria 39860
530 Ga0495679_000528 3300047446 Bacteria 27024
531 Ga0495673_0008048 3300047469 Bacteria 5974
532 Ga0495673_0159263 3300047469 Bacteria 867
533 Ga0495673_0213161 3300047469 Bacteria 718
534 Ga0495681_0027734 3300047470 Bacteria 2925
535 Ga0495681_0028017 3300047470 Bacteria 2905
536 Ga0495681_0055594 3300047470 Bacteria 1845
537 Ga0495684_0042294 3300047471 Bacteria 3490
538 Ga0495686_0000080 3300047472 Bacteria 201665
539 Ga0495593_0003365 3300047673 Bacteria 9580
540 Ga0495593_0010047 3300047673 Bacteria 5481
541 Ga0495602_0011757 3300048088 Bacteria 9040
542 Ga0495602_0033683 3300048088 Bacteria 4801
543 Ga0495602_0048159 3300048088 Bacteria 3834
544 Ga0495602_0720530 3300048088 Bacteria 675
545 Ga0495614_0001749 3300048089 Bacteria 9485
546 Ga0495614_0015119 3300048089 Bacteria 3368
547 Ga0495626_0005137 3300048091 Bacteria 7774
548 Ga0495626_0026687 3300048091 Bacteria 2812
549 Ga0495626_0041344 3300048091 Bacteria 2172
550 Ga0495626_0090685 3300048091 Bacteria 1344
551 Ga0496100_0834814 3300048903 Bacteria 722
552 Ga0496101_0183918 3300048904 Bacteria 1610
553 Ga0496101_0224775 3300048904 Bacteria 1458
554 Ga0496102_0207473 3300048905 Bacteria 1847
555 Ga0496102_0354021 3300048905 Bacteria 1382
556 Ga0496104_0513625 3300048907 Bacteria 1109
557 Ga0496104_0909528 3300048907 Unclassified 785
558 Ga0496105_0101656 3300048908 Bacteria 2374
559 Ga0496107_0025214 3300048910 Bacteria 4208
560 Ga0496108_0091387 3300048911 Bacteria 2588
561 Ga0496109_0144539 3300048912 Bacteria 2225
562 Ga0496109_0185128 3300048912 Bacteria 1957
563 Ga0496110_0185911 3300048913 Bacteria 1887
564 Ga0496112_0202447 3300048915 Bacteria 1944
565 Ga0496114_0012808 3300048917 Bacteria 6715
566 Ga0496114_0104534 3300048917 Unclassified 2421
567 Ga0496114_0275663 3300048917 Unclassified 1482
568 Ga0496115_0277947 3300048918 Bacteria 1375
569 Ga0496117_0066625 3300048920 Bacteria 2441
570 Ga0496118_0022027 3300048921 Bacteria 5587
571 Ga0496118_0202237 3300048921 Bacteria 1175
572 Ga0496121_0008159 3300048924 Bacteria 12438
573 Ga0496121_0419662 3300048924 Bacteria 871
574 Ga0496125_0010896 3300048928 Bacteria 9143
575 Ga0496126_0000980 3300048929 Bacteria 48954
576 Ga0496126_0187235 3300048929 Bacteria 1755
577 Ga0501308_015218 3300049128 Bacteria 909
578 Ga0495678_007106 3300049459 Bacteria 5853
579 Ga0495678_019188 3300049459 Bacteria 3056
580 Ga0495682_0025626 3300049460 Bacteria 2194
581 Ga0495682_0190387 3300049460 Bacteria 728
582 Ga0501031_0015019 3300049568 Bacteria 5030
583 Ga0501031_0148125 3300049568 Bacteria 1533
584 Ga0501032_0002974 3300049569 Bacteria 13154
585 Ga0501032_0009021 3300049569 Bacteria 7248
586 Ga0501033_0001594 3300049570 Bacteria 19939
587 Ga0501033_0167046 3300049570 Bacteria 1581
588 Ga0501034_0040006 3300049571 Bacteria 4748
589 Ga0501034_0040330 3300049571 Bacteria 4725
590 Ga0501036_0004807 3300049572 Bacteria 10918
591 Ga0501036_0088629 3300049572 Bacteria 2614
592 Ga0501037_0002776 3300049573 Bacteria 12676
593 Ga0501038_0002215 3300049574 Bacteria 18081
594 Ga0501038_0008444 3300049574 Bacteria 9473
595 Ga0501038_0022440 3300049574 Bacteria 5655
596 Ga0501039_0005521 3300049575 Bacteria 9568
597 Ga0501039_0017532 3300049575 Bacteria 5492
598 Ga0501040_0007076 3300049576 Bacteria 7272
599 Ga0501041_0349276 3300049577 Bacteria 935
600 Ga0501042_0001122 3300049578 Bacteria 15421
601 Ga0501043_0005777 3300049579 Bacteria 9960
602 Ga0501043_0044298 3300049579 Bacteria 3498
603 Ga0501043_0149271 3300049579 Bacteria 1829
604 Ga0501046_0001218 3300049580 Bacteria 24929
605 Ga0501046_0013156 3300049580 Bacteria 7020
606 Ga0501047_0022202 3300049581 Bacteria 6097
607 Ga0501048_0055918 3300049582 Bacteria 2800
608 Ga0501067_0619606 3300049583 Bacteria 607
609 Ga0501068_0010069 3300049584 Bacteria 5305
610 Ga0501073_0729258 3300049589 Bacteria 684
611 Ga0501074_0249880 3300049590 Bacteria 1261
612 Ga0501249_014616 3300049679 Bacteria 1674
613 Ga0501080_0054212 3300049742 Bacteria 3734
614 Ga0501080_0733510 3300049742 Bacteria 870
615 Ga0501241_025048 3300049758 Bacteria 1110
616 Ga0501035_0001588 3300049822 Bacteria 23027
617 Ga0501035_0290622 3300049822 Bacteria 1379
618 Ga0501035_0645934 3300049822 Bacteria 858
619 Ga0501044_0009871 3300049823 Bacteria 10376
620 Ga0501044_0015564 3300049823 Bacteria 8194
621 Ga0501045_0005631 3300049824 Bacteria 8671
622 nmdc:mga0yw44_42787_c1 3300050492 Bacteria 2702
623 nmdc:mga0k408_88087_c1 3300050493 Bacteria 1823
624 nmdc:mga07m45_12402_c1 3300050496 Bacteria 4504
625 nmdc:mga05p37_80858_c1 3300050507 Bacteria 4002
626 nmdc:mga09592_40483_c1 3300050508 Bacteria 3915
627 nmdc:mga0qj67_19318_c1 3300050509 Bacteria 5204
628 nmdc:mga06r32_82249_c1 3300050510 Bacteria 3137
629 nmdc:mga08y16_1010141_c1 3300050511 Bacteria 811
630 nmdc:mga0a205_324751_c1 3300050515 Bacteria 1409
631 nmdc:mga0sz30_133863_c1 3300050516 Bacteria 1093
632 Ga0500578_0249850 3300053086 Bacteria 1069
633 Ga0500644_0400895 3300053088 Bacteria 598
634 Ga0500646_0209133 3300053090 Bacteria 672
635 Ga0500641_0003850 3300053096 Bacteria 5304
636 Ga0500660_176652 3300053100 Bacteria 779
637 Ga0500562_000577 3300053108 Bacteria 8802
638 Ga0500593_111046 3300053117 Bacteria 1127
639 Ga0500642_0087133 3300053130 Bacteria 1440
640 Ga0500559_0193570 3300053136 Bacteria 958
641 Ga0500616_0032201 3300053153 Bacteria 2867
642 Ga0500622_0020392 3300053156 Bacteria 3520
643 Ga0500609_001115 3300053731 Bacteria 4005
644 Ga0501084_1468346 3300054114 Unclassified 571
645 Ga0587085_035384 3300059506 Bacteria 844
646 Ga0587062_047956 3300059639 Bacteria 715
647 Ga0501082_0313310 3300060353 Unclassified 1367

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0112789 Ga0466964_0112789_417_902 116
2 3300046499 Ga0495594_0293698 Ga0495594_0293698_30_452 117
3 3300037418 Ga0395900_0329012 Ga0395900_0329012_369_854 118
4 3300037466 Ga0395898_0245260 Ga0395898_0245260_811_1296 118
5 3300037471 Ga0395905_0347648 Ga0395905_0347648_485_970 118
6 3300046660 Ga0495625_0060515 Ga0495625_0060515_220_594 118
7 3300046665 Ga0495661_0074687 Ga0495661_0074687_44_418 118
8 3300048088 Ga0495602_0720530 Ga0495602_0720530_22_396 118
9 3300049460 Ga0495682_0190387 Ga0495682_0190387_49_423 118
10 3300044658 Ga0466972_0108906 Ga0466972_0108906_369_866 120
11 3300044693 Ga0466961_0269813 Ga0466961_0269813_347_844 120
12 3300044735 Ga0466968_0452414 Ga0466968_0452414_126_623 120
13 3300044765 Ga0466970_0187859 Ga0466970_0187859_264_761 120
14 3300044842 Ga0466957_0019001 Ga0466957_0019001_1172_1666 120
15 3300045049 Ga0466959_0164492 Ga0466959_0164492_425_922 120
16 3300045836 Ga0466958_0183561 Ga0466958_0183561_504_1001 120
17 3300045976 Ga0466967_0174395 Ga0466967_0174395_1092_1589 120
18 3300046665 Ga0495661_0043052 Ga0495661_0043052_503_1000 120
19 3300005536 Ga0070697_100254164 Ga0070697_1002541642 122
20 3300046507 Ga0495606_0265903 Ga0495606_0265903_345_842 122
21 3300025909 Ga0207705_10211804 Ga0207705_102118042 124
22 3300006880 Ga0075429_101330961 Ga0075429_1013309612 126
23 3300014969 Ga0157376_11069920 Ga0157376_110699202 126
24 3300005334 Ga0068869_100179405 Ga0068869_1001794052 128
25 3300005335 Ga0070666_10241251 Ga0070666_102412512 128
26 3300005338 Ga0068868_101040511 Ga0068868_1010405111 128
27 3300005365 Ga0070688_100048473 Ga0070688_1000484732 128
28 3300005456 Ga0070678_100031236 Ga0070678_1000312362 128
29 3300005459 Ga0068867_100110734 Ga0068867_1001107342 128
30 3300005617 Ga0068859_100100382 Ga0068859_1001003822 128
31 3300005718 Ga0068866_10025543 Ga0068866_100255432 128
32 3300005844 Ga0068862_100189320 Ga0068862_1001893201 128
33 3300006237 Ga0097621_100715318 Ga0097621_1007153181 128
34 3300006881 Ga0068865_100262622 Ga0068865_1002626222 128
35 3300006931 Ga0097620_100100384 Ga0097620_1001003842 128
36 3300017792 Ga0163161_10588390 Ga0163161_105883902 128
37 3300025903 Ga0207680_10348640 Ga0207680_103486402 128
38 3300025926 Ga0207659_10418885 Ga0207659_104188851 128
39 3300025935 Ga0207709_10075225 Ga0207709_100752251 128
40 3300025938 Ga0207704_10798840 Ga0207704_107988401 128
41 3300026089 Ga0207648_10046412 Ga0207648_100464123 128
42 3300026121 Ga0207683_10520972 Ga0207683_105209722 128
43 3300028381 Ga0268264_10019844 Ga0268264_100198443 128
44 3300046528 Ga0495642_0468128 Ga0495642_0468128_97_546 128
45 3300005618 Ga0068864_100083232 Ga0068864_1000832323 129
46 3300005841 Ga0068863_100153974 Ga0068863_1001539743 129
47 3300026095 Ga0207676_10155485 Ga0207676_101554852 129
48 3300026118 Ga0207675_100085272 Ga0207675_1000852722 129
49 3300005842 Ga0068858_100181912 Ga0068858_1001819122 130
50 3300037312 Ga0395899_0121509 Ga0395899_0121509_1236_1772 130
51 3300037418 Ga0395900_0286488 Ga0395900_0286488_113_649 130
52 3300037471 Ga0395905_0573681 Ga0395905_0573681_131_667 130
53 3300038443 Ga0395901_0675161 Ga0395901_0675161_378_914 130
54 3300049589 Ga0501073_0729258 Ga0501073_0729258_26_508 130
55 3300049590 Ga0501074_0249880 Ga0501074_0249880_60_542 130
56 3300049742 Ga0501080_0054212 Ga0501080_0054212_2637_3119 130
57 3300060353 Ga0501082_0313310 Ga0501082_0313310_730_1194 130
58 3300005339 Ga0070660_100498789 Ga0070660_1004987891 131
59 3300005563 Ga0068855_100748706 Ga0068855_1007487061 131
60 3300005564 Ga0070664_100391096 Ga0070664_1003910961 131
61 3300005616 Ga0068852_101225068 Ga0068852_1012250682 131
62 3300013104 Ga0157370_10010706 Ga0157370_1001070610 131
63 3300013105 Ga0157369_10758997 Ga0157369_107589972 131
64 3300013307 Ga0157372_10237871 Ga0157372_102378712 131
65 3300025919 Ga0207657_10399050 Ga0207657_103990502 131
66 3300025921 Ga0207652_11408186 Ga0207652_114081861 131
67 3300026142 Ga0207698_11795013 Ga0207698_117950131 131
68 3300046809 Ga0495600_0039484 Ga0495600_0039484_1693_2160 131
69 3300048091 Ga0495626_0041344 Ga0495626_0041344_651_1121 131
70 3300048929 Ga0496126_0187235 Ga0496126_0187235_804_1274 131
71 3300054114 Ga0501084_1468346 Ga0501084_1468346_19_498 132
72 3300005445 Ga0070708_100044519 Ga0070708_1000445192 133
73 3300005445 Ga0070708_100143747 Ga0070708_1001437474 133
74 3300005467 Ga0070706_100059014 Ga0070706_1000590143 133
75 3300005467 Ga0070706_100560864 Ga0070706_1005608641 133
76 3300005468 Ga0070707_100362489 Ga0070707_1003624892 133
77 3300005471 Ga0070698_100333961 Ga0070698_1003339612 133
78 3300025910 Ga0207684_11223657 Ga0207684_112236571 133
79 3300025922 Ga0207646_10218024 Ga0207646_102180242 133
80 3300005336 Ga0070680_100116848 Ga0070680_1001168483 134
81 3300005341 Ga0070691_10287996 Ga0070691_102879962 134
82 3300005444 Ga0070694_100012071 Ga0070694_1000120716 134
83 3300005471 Ga0070698_101096864 Ga0070698_1010968641 134
84 3300005843 Ga0068860_100629064 Ga0068860_1006290641 134
85 3300025917 Ga0207660_10113048 Ga0207660_101130482 134
86 3300031456 Ga0307513_10007974 Ga0307513_100079747 134
87 3300031507 Ga0307509_10004925 Ga0307509_100049255 134
88 3300037418 Ga0395900_0061088 Ga0395900_0061088_3179_3670 134
89 3300037418 Ga0395900_0912106 Ga0395900_0912106_132_623 134
90 3300037466 Ga0395898_0140228 Ga0395898_0140228_1455_1946 134
91 3300037471 Ga0395905_0120906 Ga0395905_0120906_777_1268 134
92 3300037471 Ga0395905_0131211 Ga0395905_0131211_461_952 134
93 3300042005 Ga0439448_0083741 Ga0439448_0083741_210_701 134
94 3300042012 Ga0439455_0020843 Ga0439455_0020843_605_1096 134
95 3300044656 Ga0466969_0189687 Ga0466969_0189687_161_652 134
96 3300044683 Ga0466965_0059795 Ga0466965_0059795_376_867 134
97 3300044693 Ga0466961_0420101 Ga0466961_0420101_207_698 134
98 3300045049 Ga0466959_0106308 Ga0466959_0106308_1082_1573 134
99 3300046518 Ga0495631_0230616 Ga0495631_0230616_206_676 134
100 3300046616 Ga0495668_0102187 Ga0495668_0102187_584_1063 134
101 3300046616 Ga0495668_0473743 Ga0495668_0473743_208_678 134
102 3300047469 Ga0495673_0213161 Ga0495673_0213161_130_609 134
103 3300048091 Ga0495626_0090685 Ga0495626_0090685_376_855 134
104 3300049571 Ga0501034_0040006 Ga0501034_0040006_1101_1580 134
105 3300053096 Ga0500641_0003850 Ga0500641_0003850_4354_4833 134
106 iso_pu_bacteria 2582581280 2585153789 134
107 iso_pu_bacteria 2582581293 2585198002 134
108 iso_pu_bacteria 2585428106 2587918688 134
109 iso_pu_bacteria 2643221552 2643778334 134
110 iso_pu_bacteria 2643221583 2643925471 134
111 iso_pu_bacteria 2643221584 2643927406 134
112 iso_pu_bacteria 2643221640 2644225334 134
113 iso_pu_bacteria 2643221642 2644232642 134
114 iso_pu_bacteria 2818991435 2819535819 134
115 iso_pu_bacteria 2818991454 2819646051 134
116 iso_pu_bacteria 2857504554 2857507790 134
117 iso_pu_bacteria 2928531327 2928535624 134
118 3300020610 Ga0154015_1582689 Ga0154015_15826891 135
119 3300021361 Ga0213872_10159972 Ga0213872_101599722 135
120 3300025941 Ga0207711_11414388 Ga0207711_114143881 135
121 3300048911 Ga0496108_0091387 Ga0496108_0091387_1024_1494 135
122 3300048917 Ga0496114_0012808 Ga0496114_0012808_5741_6214 135
123 3300049742 Ga0501080_0733510 Ga0501080_0733510_123_593 135
124 3300049758 Ga0501241_025048 Ga0501241_025048_389_862 135
125 iso_pu_bacteria 2515154189 2516023484 135
126 iso_pu_bacteria 2588253510 2588290921 135
127 iso_pu_bacteria 2643221556 2643801247 135
128 iso_pu_bacteria 2643221592 2643972138 135
129 iso_pu_bacteria 2643221625 2644142337 135
130 iso_pu_bacteria 2643221648 2644276031 135
131 iso_pu_bacteria 2643221684 2644471665 135
132 iso_pu_bacteria 2883087390 2883093429 135
133 iso_pu_bacteria 2904424332 2904425137 135
134 iso_pu_bacteria 2912963787 2912968802 135
135 iso_pu_bacteria 2939651529 2939654137 135
136 iso_pu_bacteria 639633007 639789064 135
137 iso_pu_bacteria 643348564 643600731 135
138 3300006358 Ga0068871_100251431 Ga0068871_1002514312 136
139 3300031456 Ga0307513_10082794 Ga0307513_100827942 136
140 3300031456 Ga0307513_10720466 Ga0307513_107204661 136
141 3300046460 Ga0495638_0004077 Ga0495638_0004077_5638_6114 136
142 3300046660 Ga0495625_0213719 Ga0495625_0213719_16_492 136
143 3300047320 Ga0495672_0016868 Ga0495672_0016868_2980_3456 136
144 3300050516 nmdc:mga0sz30_133863_c1 nmdc:mga0sz30_133863_c1_472_948 136
145 3300053088 Ga0500644_0400895 Ga0500644_0400895_42_518 136
146 3300053090 Ga0500646_0209133 Ga0500646_0209133_103_579 136
147 3300053130 Ga0500642_0087133 Ga0500642_0087133_729_1205 136
148 3300004801 Ga0058860_11538292 Ga0058860_115382922 137
149 3300005343 Ga0070687_100723982 Ga0070687_1007239821 137
150 3300005548 Ga0070665_100027839 Ga0070665_1000278392 137
151 3300005617 Ga0068859_100007356 Ga0068859_1000073565 137
152 3300005618 Ga0068864_100070433 Ga0068864_1000704331 137
153 3300005841 Ga0068863_100409645 Ga0068863_1004096452 137
154 3300005841 Ga0068863_100930611 Ga0068863_1009306111 137
155 3300005842 Ga0068858_100896103 Ga0068858_1008961031 137
156 3300006931 Ga0097620_100007356 Ga0097620_1000073565 137
157 3300009101 Ga0105247_10127208 Ga0105247_101272082 137
158 3300009176 Ga0105242_10789854 Ga0105242_107898541 137
159 3300009177 Ga0105248_10983521 Ga0105248_109835212 137
160 3300014325 Ga0163163_10000226 Ga0163163_100002268 137
161 3300025900 Ga0207710_10091215 Ga0207710_100912152 137
162 3300025941 Ga0207711_10877436 Ga0207711_108774362 137
163 3300026035 Ga0207703_10652173 Ga0207703_106521731 137
164 3300026088 Ga0207641_10364067 Ga0207641_103640672 137
165 3300026116 Ga0207674_11363754 Ga0207674_113637541 137
166 3300028381 Ga0268264_10891426 Ga0268264_108914262 137
167 3300031247 Ga0265340_10010391 Ga0265340_100103912 137
168 3300031728 Ga0316578_10100083 Ga0316578_101000832 137
169 3300031728 Ga0316578_10200339 Ga0316578_102003392 137
170 3300032139 Ga0316580_10003872 Ga0316580_100038723 137
171 3300032168 Ga0316593_10000488 Ga0316593_100004884 137
172 3300035398 Ga0316574_0007153 Ga0316574_0007153_5173_5655 137
173 3300035398 Ga0316574_0015422 Ga0316574_0015422_2751_3266 137
174 3300036647 Ga0316582_0382842 Ga0316582_0382842_13_528 137
175 3300036712 Ga0316584_0055392 Ga0316584_0055392_826_1308 137
176 3300046454 Ga0495592_0003568 Ga0495592_0003568_753_1244 137
177 3300046455 Ga0495603_0040025 Ga0495603_0040025_903_1394 137
178 3300046458 Ga0495591_000806 Ga0495591_000806_17995_18486 137
179 3300046459 Ga0495629_0008971 Ga0495629_0008971_6362_6853 137
180 3300046460 Ga0495638_0506840 Ga0495638_0506840_18_509 137
181 3300046461 Ga0495641_0076252 Ga0495641_0076252_537_1028 137
182 3300046462 Ga0495651_0016516 Ga0495651_0016516_3955_4446 137
183 3300046463 Ga0495653_0024886 Ga0495653_0024886_3584_4075 137
184 3300046474 Ga0495605_0159260 Ga0495605_0159260_481_972 137
185 3300046476 Ga0495662_0017902 Ga0495662_0017902_1476_1967 137
186 3300046477 Ga0495664_0016662 Ga0495664_0016662_2995_3486 137
187 3300046499 Ga0495594_0223823 Ga0495594_0223823_130_621 137
188 3300046500 Ga0495596_0044388 Ga0495596_0044388_817_1308 137
189 3300046511 Ga0495608_0141134 Ga0495608_0141134_584_1075 137
190 3300046514 Ga0495618_0006609 Ga0495618_0006609_1649_2140 137
191 3300046516 Ga0495628_0119613 Ga0495628_0119613_258_749 137
192 3300046517 Ga0495630_0008810 Ga0495630_0008810_463_954 137
193 3300046524 Ga0495648_0089242 Ga0495648_0089242_615_1106 137
194 3300046531 Ga0495665_0000684 Ga0495665_0000684_11314_11805 137
195 3300046536 Ga0495587_0000623 Ga0495587_0000623_7938_8429 137
196 3300046543 Ga0495645_0051268 Ga0495645_0051268_1234_1725 137
197 3300046559 Ga0495667_0036463 Ga0495667_0036463_1333_1824 137
198 3300046642 Ga0495634_0261936 Ga0495634_0261936_457_948 137
199 3300046648 Ga0495611_0052761 Ga0495611_0052761_357_848 137
200 3300046663 Ga0495635_0015141 Ga0495635_0015141_1580_2071 137
201 3300046665 Ga0495661_0003818 Ga0495661_0003818_9242_9733 137
202 3300046674 Ga0495588_0268636 Ga0495588_0268636_257_748 137
203 3300046679 Ga0495623_0019699 Ga0495623_0019699_677_1168 137
204 3300046680 Ga0495646_0055206 Ga0495646_0055206_258_749 137
205 3300046689 Ga0495613_0011548 Ga0495613_0011548_3194_3685 137
206 3300046690 Ga0495624_0022029 Ga0495624_0022029_1466_1957 137
207 3300046809 Ga0495600_0001426 Ga0495600_0001426_4500_4991 137
208 3300047315 Ga0495581_0010566 Ga0495581_0010566_4258_4749 137
209 3300047321 Ga0495676_0010249 Ga0495676_0010249_1580_2071 137
210 3300047322 Ga0495680_0335970 Ga0495680_0335970_107_598 137
211 3300047323 Ga0495683_0016611 Ga0495683_0016611_235_726 137
212 3300047444 Ga0495675_0009494 Ga0495675_0009494_1832_2323 137
213 3300047446 Ga0495679_000528 Ga0495679_000528_107_598 137
214 3300047469 Ga0495673_0008048 Ga0495673_0008048_2540_3031 137
215 3300047673 Ga0495593_0010047 Ga0495593_0010047_1461_1952 137
216 3300048088 Ga0495602_0033683 Ga0495602_0033683_1117_1608 137
217 3300048089 Ga0495614_0001749 Ga0495614_0001749_1530_2021 137
218 3300048905 Ga0496102_0207473 Ga0496102_0207473_594_1085 137
219 3300048912 Ga0496109_0144539 Ga0496109_0144539_1164_1637 137
220 3300048913 Ga0496110_0185911 Ga0496110_0185911_15_488 137
221 3300049128 Ga0501308_015218 Ga0501308_015218_241_732 137
222 3300049460 Ga0495682_0025626 Ga0495682_0025626_1637_2128 137
223 3300003322 rootL2_10093421 rootL2_100934215 138
224 3300003322 rootL2_10128998 rootL2_101289982 138
225 3300003794 Ga0055531_10000557 Ga0055531_1000055721 138
226 3300005262 Ga0065165_1000615 Ga0065165_100061544 138
227 3300005336 Ga0070680_100587637 Ga0070680_1005876372 138
228 3300005336 Ga0070680_100807117 Ga0070680_1008071171 138
229 3300005354 Ga0070675_100450676 Ga0070675_1004506762 138
230 3300005435 Ga0070714_100546863 Ga0070714_1005468632 138
231 3300005456 Ga0070678_100091416 Ga0070678_1000914163 138
232 3300005456 Ga0070678_100165666 Ga0070678_1001656662 138
233 3300005530 Ga0070679_100171998 Ga0070679_1001719982 138
234 3300005530 Ga0070679_100219890 Ga0070679_1002198902 138
235 3300005543 Ga0070672_100331843 Ga0070672_1003318432 138
236 3300005563 Ga0068855_100135254 Ga0068855_1001352542 138
237 3300005563 Ga0068855_101143462 Ga0068855_1011434622 138
238 3300005578 Ga0068854_100610014 Ga0068854_1006100142 138
239 3300005614 Ga0068856_100451997 Ga0068856_1004519972 138
240 3300005616 Ga0068852_100052884 Ga0068852_1000528843 138
241 3300005834 Ga0068851_10083545 Ga0068851_100835453 138
242 3300006051 Ga0075364_10501552 Ga0075364_105015522 138
243 3300006195 Ga0075366_10122003 Ga0075366_101220031 138
244 3300006353 Ga0075370_10033556 Ga0075370_100335563 138
245 3300006353 Ga0075370_10838997 Ga0075370_108389971 138
246 3300006358 Ga0068871_100432399 Ga0068871_1004323992 138
247 3300009011 Ga0105251_10023081 Ga0105251_100230813 138
248 3300009011 Ga0105251_10063868 Ga0105251_100638683 138
249 3300009093 Ga0105240_10159674 Ga0105240_101596743 138
250 3300009101 Ga0105247_11075912 Ga0105247_110759121 138
251 3300009148 Ga0105243_10772248 Ga0105243_107722482 138
252 3300009177 Ga0105248_10045882 Ga0105248_100458823 138
253 3300012512 Ga0157327_1023884 Ga0157327_10238841 138
254 3300013105 Ga0157369_10502363 Ga0157369_105023632 138
255 3300013296 Ga0157374_10258764 Ga0157374_102587642 138
256 3300013297 Ga0157378_10205693 Ga0157378_102056932 138
257 3300013306 Ga0163162_10001320 Ga0163162_1000132017 138
258 3300013306 Ga0163162_10022603 Ga0163162_100226037 138
259 3300013307 Ga0157372_10195755 Ga0157372_101957552 138
260 3300013308 Ga0157375_10013360 Ga0157375_100133602 138
261 3300013308 Ga0157375_10161954 Ga0157375_101619542 138
262 3300014326 Ga0157380_10078260 Ga0157380_100782602 138
263 3300014326 Ga0157380_10454051 Ga0157380_104540512 138
264 3300014969 Ga0157376_10281662 Ga0157376_102816621 138
265 3300017792 Ga0163161_10103296 Ga0163161_101032962 138
266 3300025291 Ga0209675_1047707 Ga0209675_10477072 138
267 3300025295 Ga0209564_1000818 Ga0209564_100081810 138
268 3300025295 Ga0209564_1005525 Ga0209564_10055251 138
269 3300025297 Ga0209758_1000246 Ga0209758_10002467 138
270 3300025298 Ga0209050_1018180 Ga0209050_10181802 138
271 3300025299 Ga0209256_1014547 Ga0209256_10145473 138
272 3300025304 Ga0209257_1000259 Ga0209257_100025916 138
273 3300025321 Ga0207656_10103245 Ga0207656_101032452 138
274 3300025735 Ga0207713_1035062 Ga0207713_10350622 138
275 3300025913 Ga0207695_10367320 Ga0207695_103673203 138
276 3300025917 Ga0207660_10647779 Ga0207660_106477792 138
277 3300025920 Ga0207649_10355808 Ga0207649_103558082 138
278 3300025929 Ga0207664_10466076 Ga0207664_104660762 138
279 3300025932 Ga0207690_10581868 Ga0207690_105818682 138
280 3300025938 Ga0207704_10153059 Ga0207704_101530592 138
281 3300025939 Ga0207665_10099209 Ga0207665_100992091 138
282 3300025940 Ga0207691_10357168 Ga0207691_103571682 138
283 3300025949 Ga0207667_10107881 Ga0207667_101078812 138
284 3300025949 Ga0207667_10599363 Ga0207667_105993631 138
285 3300025972 Ga0207668_10110183 Ga0207668_101101832 138
286 3300025981 Ga0207640_10307673 Ga0207640_103076732 138
287 3300026078 Ga0207702_10069213 Ga0207702_100692134 138
288 3300026088 Ga0207641_10666483 Ga0207641_106664832 138
289 3300026095 Ga0207676_10110448 Ga0207676_101104482 138
290 3300026095 Ga0207676_11867293 Ga0207676_118672931 138
291 3300026121 Ga0207683_10036996 Ga0207683_100369964 138
292 3300026142 Ga0207698_10180921 Ga0207698_101809212 138
293 3300035691 Ga0373931_0644463 Ga0373931_0644463_127_606 138
294 3300036534 Ga0310109_049593 Ga0310109_049593_40_522 138
295 3300042000 Ga0439437_024272 Ga0439437_024272_251_733 138
296 3300042127 Ga0450890_034873 Ga0450890_034873_50_532 138
297 3300042436 Ga0439435_0027498 Ga0439435_0027498_171_653 138
298 3300042438 Ga0439459_0002620 Ga0439459_0002620_1760_2242 138
299 3300046458 Ga0495591_137425 Ga0495591_137425_34_522 138
300 3300046460 Ga0495638_0001574 Ga0495638_0001574_19920_20402 138
301 3300046460 Ga0495638_0011608 Ga0495638_0011608_5451_5939 138
302 3300046474 Ga0495605_0003916 Ga0495605_0003916_7954_8442 138
303 3300046501 Ga0495607_0037403 Ga0495607_0037403_127_609 138
304 3300046507 Ga0495606_0074761 Ga0495606_0074761_1250_1738 138
305 3300046512 Ga0495610_0092869 Ga0495610_0092869_299_781 138
306 3300046513 Ga0495616_0000031 Ga0495616_0000031_58778_59260 138
307 3300046513 Ga0495616_0193990 Ga0495616_0193990_136_624 138
308 3300046516 Ga0495628_0110360 Ga0495628_0110360_1471_1962 138
309 3300046519 Ga0495632_0011423 Ga0495632_0011423_1518_2000 138
310 3300046522 Ga0495643_0365649 Ga0495643_0365649_115_597 138
311 3300046523 Ga0495644_0082696 Ga0495644_0082696_426_914 138
312 3300046528 Ga0495642_0131993 Ga0495642_0131993_374_862 138
313 3300046530 Ga0495654_0060996 Ga0495654_0060996_666_1148 138
314 3300046542 Ga0495597_0039268 Ga0495597_0039268_1281_1769 138
315 3300046559 Ga0495667_0216758 Ga0495667_0216758_256_747 138
316 3300046616 Ga0495668_0008200 Ga0495668_0008200_2640_3122 138
317 3300046616 Ga0495668_0043959 Ga0495668_0043959_895_1377 138
318 3300046660 Ga0495625_0068594 Ga0495625_0068594_1360_1842 138
319 3300046684 Ga0495669_0030615 Ga0495669_0030615_1611_2099 138
320 3300046684 Ga0495669_0121767 Ga0495669_0121767_265_747 138
321 3300046691 Ga0495670_0004408 Ga0495670_0004408_1134_1622 138
322 3300046691 Ga0495670_0280063 Ga0495670_0280063_31_513 138
323 3300046794 Ga0495589_0002595 Ga0495589_0002595_9168_9656 138
324 3300046794 Ga0495589_0049937 Ga0495589_0049937_177_668 138
325 3300046809 Ga0495600_0676955 Ga0495600_0676955_85_576 138
326 3300046810 Ga0495660_0002945 Ga0495660_0002945_9288_9770 138
327 3300046810 Ga0495660_0037357 Ga0495660_0037357_2076_2564 138
328 3300047470 Ga0495681_0027734 Ga0495681_0027734_461_949 138
329 3300047470 Ga0495681_0028017 Ga0495681_0028017_17_499 138
330 3300047472 Ga0495686_0000080 Ga0495686_0000080_42970_43461 138
331 3300048091 Ga0495626_0026687 Ga0495626_0026687_565_1053 138
332 3300048903 Ga0496100_0834814 Ga0496100_0834814_210_698 138
333 3300048904 Ga0496101_0183918 Ga0496101_0183918_664_1152 138
334 3300048904 Ga0496101_0224775 Ga0496101_0224775_441_923 138
335 3300048905 Ga0496102_0354021 Ga0496102_0354021_512_1000 138
336 3300048907 Ga0496104_0513625 Ga0496104_0513625_156_644 138
337 3300048908 Ga0496105_0101656 Ga0496105_0101656_1366_1854 138
338 3300048910 Ga0496107_0025214 Ga0496107_0025214_3316_3804 138
339 3300048912 Ga0496109_0185128 Ga0496109_0185128_647_1129 138
340 3300048915 Ga0496112_0202447 Ga0496112_0202447_135_617 138
341 3300048917 Ga0496114_0275663 Ga0496114_0275663_13_495 138
342 3300048918 Ga0496115_0277947 Ga0496115_0277947_526_1014 138
343 3300048921 Ga0496118_0202237 Ga0496118_0202237_395_883 138
344 3300048924 Ga0496121_0419662 Ga0496121_0419662_147_635 138
345 3300048928 Ga0496125_0010896 Ga0496125_0010896_2597_3079 138
346 3300048929 Ga0496126_0000980 Ga0496126_0000980_13405_13887 138
347 3300050492 nmdc:mga0yw44_42787_c1 nmdc:mga0yw44_42787_c1_2206_2688 138
348 3300050493 nmdc:mga0k408_88087_c1 nmdc:mga0k408_88087_c1_156_638 138
349 3300050496 nmdc:mga07m45_12402_c1 nmdc:mga07m45_12402_c1_221_703 138
350 3300053086 Ga0500578_0249850 Ga0500578_0249850_209_691 138
351 3300053100 Ga0500660_176652 Ga0500660_176652_170_652 138
352 3300053136 Ga0500559_0193570 Ga0500559_0193570_149_631 138
353 3300053156 Ga0500622_0020392 Ga0500622_0020392_104_586 138
354 3300053731 Ga0500609_001115 Ga0500609_001115_860_1342 138
355 3300002773 JGI25152J39213_1002469 JGI25152J39213_10024695 139
356 3300002774 JGI25150J39212_1002495 JGI25150J39212_10024953 139
357 3300003215 JGI25153J46596_10005824 JGI25153J46596_100058243 139
358 3300003323 rootH1_10132987 rootH1_101329872 139
359 3300003771 Ga0055526_1005023 Ga0055526_10050237 139
360 3300003771 Ga0055526_1005529 Ga0055526_10055294 139
361 3300003773 Ga0055537_1007066 Ga0055537_10070663 139
362 3300003775 Ga0055524_1000182 Ga0055524_100018211 139
363 3300003775 Ga0055524_1006279 Ga0055524_10062793 139
364 3300003775 Ga0055524_1082106 Ga0055524_10821061 139
365 3300003784 Ga0055534_1042626 Ga0055534_10426261 139
366 3300003791 Ga0055530_10000037 Ga0055530_1000003738 139
367 3300003791 Ga0055530_10012424 Ga0055530_100124243 139
368 3300003791 Ga0055530_10043783 Ga0055530_100437831 139
369 3300003792 Ga0055540_1003124 Ga0055540_10031242 139
370 3300003794 Ga0055531_10043071 Ga0055531_100430711 139
371 3300004785 Ga0058858_1158617 Ga0058858_11586172 139
372 3300004798 Ga0058859_10842610 Ga0058859_108426101 139
373 3300004799 Ga0058863_10022113 Ga0058863_100221131 139
374 3300004799 Ga0058863_11830666 Ga0058863_118306663 139
375 3300004800 Ga0058861_10021452 Ga0058861_100214521 139
376 3300004800 Ga0058861_11921876 Ga0058861_119218763 139
377 3300004801 Ga0058860_11397319 Ga0058860_113973191 139
378 3300004801 Ga0058860_12134235 Ga0058860_121342351 139
379 3300004803 Ga0058862_10008156 Ga0058862_100081561 139
380 3300004803 Ga0058862_12692344 Ga0058862_126923443 139
381 3300004803 Ga0058862_12871773 Ga0058862_128717732 139
382 3300005327 Ga0070658_10105728 Ga0070658_101057283 139
383 3300005329 Ga0070683_100071547 Ga0070683_1000715473 139
384 3300005336 Ga0070680_100002662 Ga0070680_1000026627 139
385 3300005336 Ga0070680_100006366 Ga0070680_1000063666 139
386 3300005336 Ga0070680_100224391 Ga0070680_1002243913 139
387 3300005353 Ga0070669_100133338 Ga0070669_1001333381 139
388 3300005356 Ga0070674_100231661 Ga0070674_1002316612 139
389 3300005367 Ga0070667_100197769 Ga0070667_1001977691 139
390 3300005434 Ga0070709_10198086 Ga0070709_101980862 139
391 3300005456 Ga0070678_100256737 Ga0070678_1002567372 139
392 3300005457 Ga0070662_100264234 Ga0070662_1002642342 139
393 3300005458 Ga0070681_10001907 Ga0070681_1000190712 139
394 3300005458 Ga0070681_10193820 Ga0070681_101938202 139
395 3300005466 Ga0070685_10311616 Ga0070685_103116161 139
396 3300005530 Ga0070679_100001193 Ga0070679_10000119315 139
397 3300005530 Ga0070679_100001971 Ga0070679_1000019719 139
398 3300005535 Ga0070684_100083380 Ga0070684_1000833802 139
399 3300005536 Ga0070697_101475259 Ga0070697_1014752591 139
400 3300005563 Ga0068855_100324882 Ga0068855_1003248822 139
401 3300005841 Ga0068863_100088411 Ga0068863_1000884112 139
402 3300005841 Ga0068863_100373581 Ga0068863_1003735811 139
403 3300005981 Ga0081538_10069435 Ga0081538_100694351 139
404 3300006173 Ga0070716_100549068 Ga0070716_1005490682 139
405 3300006844 Ga0075428_100022695 Ga0075428_1000226953 139
406 3300006846 Ga0075430_100015375 Ga0075430_1000153753 139
407 3300006847 Ga0075431_100000941 Ga0075431_10000094119 139
408 3300006852 Ga0075433_11423449 Ga0075433_114234491 139
409 3300006880 Ga0075429_100024405 Ga0075429_1000244053 139
410 3300006946 Ga0079104_1000333 Ga0079104_100033353 139
411 3300009036 Ga0105244_10000079 Ga0105244_1000007962 139
412 3300009094 Ga0111539_10836118 Ga0111539_108361181 139
413 3300009147 Ga0114129_10131009 Ga0114129_101310092 139
414 3300009148 Ga0105243_11258507 Ga0105243_112585071 139
415 3300009177 Ga0105248_10225457 Ga0105248_102254572 139
416 3300009551 Ga0105238_10680362 Ga0105238_106803622 139
417 3300013306 Ga0163162_10088294 Ga0163162_100882943 139
418 3300013306 Ga0163162_11681545 Ga0163162_116815451 139
419 3300013307 Ga0157372_10020425 Ga0157372_100204254 139
420 3300013307 Ga0157372_10757280 Ga0157372_107572802 139
421 3300020070 Ga0206356_11608922 Ga0206356_116089222 139
422 3300021384 Ga0213876_10000155 Ga0213876_1000015533 139
423 3300021388 Ga0213875_10116180 Ga0213875_101161801 139
424 3300025245 Ga0207425_1000452 Ga0207425_100045217 139
425 3300025258 Ga0209129_1000027 Ga0209129_10000275 139
426 3300025263 Ga0209565_1004369 Ga0209565_10043692 139
427 3300025263 Ga0209565_1011078 Ga0209565_10110782 139
428 3300025273 Ga0209673_1011233 Ga0209673_10112335 139
429 3300025273 Ga0209673_1020665 Ga0209673_10206653 139
430 3300025291 Ga0209675_1006973 Ga0209675_10069735 139
431 3300025291 Ga0209675_1018926 Ga0209675_10189261 139
432 3300025295 Ga0209564_1000046 Ga0209564_1000046348 139
433 3300025295 Ga0209564_1000142 Ga0209564_100014270 139
434 3300025297 Ga0209758_1000052 Ga0209758_1000052115 139
435 3300025298 Ga0209050_1000058 Ga0209050_1000058259 139
436 3300025298 Ga0209050_1001069 Ga0209050_100106918 139
437 3300025298 Ga0209050_1014421 Ga0209050_10144214 139
438 3300025299 Ga0209256_1000024 Ga0209256_1000024392 139
439 3300025299 Ga0209256_1001716 Ga0209256_10017165 139
440 3300025299 Ga0209256_1028527 Ga0209256_10285272 139
441 3300025303 Ga0209051_1000155 Ga0209051_100015554 139
442 3300025304 Ga0209257_1000236 Ga0209257_100023654 139
443 3300025728 Ga0207655_1000188 Ga0207655_100018889 139
444 3300025906 Ga0207699_10541724 Ga0207699_105417242 139
445 3300025908 Ga0207643_10378225 Ga0207643_103782252 139
446 3300025909 Ga0207705_10080606 Ga0207705_100806062 139
447 3300025912 Ga0207707_10000732 Ga0207707_1000073223 139
448 3300025912 Ga0207707_10067747 Ga0207707_100677473 139
449 3300025916 Ga0207663_10574231 Ga0207663_105742311 139
450 3300025917 Ga0207660_10014120 Ga0207660_100141205 139
451 3300025917 Ga0207660_10032840 Ga0207660_100328404 139
452 3300025921 Ga0207652_10022573 Ga0207652_100225735 139
453 3300025921 Ga0207652_10051639 Ga0207652_100516392 139
454 3300025923 Ga0207681_10209874 Ga0207681_102098742 139
455 3300025924 Ga0207694_11156925 Ga0207694_111569251 139
456 3300025926 Ga0207659_10446840 Ga0207659_104468402 139
457 3300025933 Ga0207706_10313860 Ga0207706_103138602 139
458 3300025938 Ga0207704_10473609 Ga0207704_104736092 139
459 3300025938 Ga0207704_10532023 Ga0207704_105320231 139
460 3300025939 Ga0207665_10036171 Ga0207665_100361711 139
461 3300025940 Ga0207691_10003268 Ga0207691_100032686 139
462 3300025941 Ga0207711_10021013 Ga0207711_100210135 139
463 3300025944 Ga0207661_10019114 Ga0207661_100191144 139
464 3300025960 Ga0207651_10360502 Ga0207651_103605022 139
465 3300026041 Ga0207639_10216025 Ga0207639_102160252 139
466 3300026088 Ga0207641_10024381 Ga0207641_100243812 139
467 3300026088 Ga0207641_10314902 Ga0207641_103149021 139
468 3300026089 Ga0207648_10558719 Ga0207648_105587192 139
469 3300026116 Ga0207674_10233765 Ga0207674_102337654 139
470 3300027111 Ga0209281_1000322 Ga0209281_100032252 139
471 3300028380 Ga0268265_10639436 Ga0268265_106394361 139
472 3300028577 Ga0265318_10318036 Ga0265318_103180361 139
473 3300031456 Ga0307513_10075226 Ga0307513_100752263 139
474 3300031548 Ga0307408_100035841 Ga0307408_1000358415 139
475 3300031665 Ga0316575_10002218 Ga0316575_100022185 139
476 3300031712 Ga0265342_10497903 Ga0265342_104979031 139
477 3300031727 Ga0316576_10007196 Ga0316576_100071966 139
478 3300031727 Ga0316576_10024025 Ga0316576_100240255 139
479 3300031727 Ga0316576_11164423 Ga0316576_111644231 139
480 3300031728 Ga0316578_10003454 Ga0316578_100034546 139
481 3300031728 Ga0316578_10033641 Ga0316578_100336414 139
482 3300031733 Ga0316577_10015853 Ga0316577_100158534 139
483 3300031852 Ga0307410_10150694 Ga0307410_101506942 139
484 3300032002 Ga0307416_100483379 Ga0307416_1004833792 139
485 3300032005 Ga0307411_10890372 Ga0307411_108903721 139
486 3300032137 Ga0316585_10000135 Ga0316585_1000013512 139
487 3300032137 Ga0316585_10015525 Ga0316585_100155252 139
488 3300032168 Ga0316593_10012916 Ga0316593_100129161 139
489 3300033524 Ga0316592_1008726 Ga0316592_10087262 139
490 3300033524 Ga0316592_1045478 Ga0316592_10454781 139
491 3300033524 Ga0316592_1045972 Ga0316592_10459722 139
492 3300033527 Ga0316586_1013613 Ga0316586_10136132 139
493 3300033527 Ga0316586_1070231 Ga0316586_10702311 139
494 3300033527 Ga0316586_1110879 Ga0316586_11108791 139
495 3300033528 Ga0316588_1028846 Ga0316588_10288462 139
496 3300033528 Ga0316588_1074923 Ga0316588_10749232 139
497 3300033529 Ga0316587_1009144 Ga0316587_10091442 139
498 3300033529 Ga0316587_1073882 Ga0316587_10738821 139
499 3300033541 Ga0316596_1001923 Ga0316596_10019233 139
500 3300033541 Ga0316596_1006082 Ga0316596_10060823 139
501 3300033541 Ga0316596_1039698 Ga0316596_10396982 139
502 3300033541 Ga0316596_1191131 Ga0316596_11911311 139
503 3300035120 Ga0373957_0109252 Ga0373957_0109252_437_922 139
504 3300035172 Ga0373955_0301483 Ga0373955_0301483_406_894 139
505 3300035398 Ga0316574_0004903 Ga0316574_0004903_5687_6175 139
506 3300035398 Ga0316574_0121960 Ga0316574_0121960_1020_1502 139
507 3300036401 Ga0373937_0032536 Ga0373937_0032536_4138_4626 139
508 3300036401 Ga0373937_0066233 Ga0373937_0066233_2110_2595 139
509 3300036401 Ga0373937_0542939 Ga0373937_0542939_576_1058 139
510 3300036647 Ga0316582_0004722 Ga0316582_0004722_1213_1701 139
511 3300036647 Ga0316582_0106664 Ga0316582_0106664_477_959 139
512 3300036647 Ga0316582_0227241 Ga0316582_0227241_402_890 139
513 3300036712 Ga0316584_0236936 Ga0316584_0236936_797_1285 139
514 3300037853 Ga0436364_0657416 Ga0436364_0657416_94_582 139
515 3300038727 Ga0400491_20990 Ga0400491_20990_5143_5640 139
516 3300039437 Ga0436365_0124459 Ga0436365_0124459_526_1014 139
517 3300039437 Ga0436365_1190722 Ga0436365_1190722_37706_38236 139
518 3300039437 Ga0436365_1930978 Ga0436365_1930978_1488_1979 139
519 3300039438 Ga0436360_0198049 Ga0436360_0198049_447_935 139
520 3300039447 Ga0436361_0028601 Ga0436361_0028601_2408_2893 139
521 3300039447 Ga0436361_0028601 Ga0436361_0028601_3101_3589 139
522 3300039447 Ga0436361_1127599 Ga0436361_1127599_2206_2691 139
523 3300042876 Ga0451577_0001743 Ga0451577_0001743_14695_15177 139
524 3300042993 Ga0439440_0086160 Ga0439440_0086160_127_612 139
525 3300045051 Ga0451576_0038173 Ga0451576_0038173_3638_4123 139
526 3300045976 Ga0466967_1034409 Ga0466967_1034409_269_751 139
527 3300046455 Ga0495603_0021112 Ga0495603_0021112_2163_2654 139
528 3300046457 Ga0495590_0123163 Ga0495590_0123163_109_600 139
529 3300046459 Ga0495629_0000436 Ga0495629_0000436_21451_21942 139
530 3300046459 Ga0495629_0110817 Ga0495629_0110817_662_1153 139
531 3300046460 Ga0495638_0004290 Ga0495638_0004290_4849_5340 139
532 3300046461 Ga0495641_0021538 Ga0495641_0021538_2404_2895 139
533 3300046462 Ga0495651_0066336 Ga0495651_0066336_723_1214 139
534 3300046463 Ga0495653_0001432 Ga0495653_0001432_12798_13289 139
535 3300046463 Ga0495653_0009893 Ga0495653_0009893_4172_4663 139
536 3300046471 Ga0495650_0006227 Ga0495650_0006227_397_888 139
537 3300046472 Ga0495580_0000454 Ga0495580_0000454_21066_21557 139
538 3300046472 Ga0495580_0007150 Ga0495580_0007150_7810_8301 139
539 3300046472 Ga0495580_0105818 Ga0495580_0105818_1184_1675 139
540 3300046473 Ga0495582_0008680 Ga0495582_0008680_734_1225 139
541 3300046473 Ga0495582_0784309 Ga0495582_0784309_14_505 139
542 3300046474 Ga0495605_0009041 Ga0495605_0009041_332_823 139
543 3300046476 Ga0495662_0013480 Ga0495662_0013480_3341_3832 139
544 3300046476 Ga0495662_0091525 Ga0495662_0091525_864_1355 139
545 3300046477 Ga0495664_0007110 Ga0495664_0007110_5375_5866 139
546 3300046477 Ga0495664_0129883 Ga0495664_0129883_195_686 139
547 3300046499 Ga0495594_0038887 Ga0495594_0038887_300_791 139
548 3300046500 Ga0495596_0038128 Ga0495596_0038128_1265_1756 139
549 3300046506 Ga0495583_0022721 Ga0495583_0022721_2460_2951 139
550 3300046507 Ga0495606_0041956 Ga0495606_0041956_159_650 139
551 3300046507 Ga0495606_0092735 Ga0495606_0092735_827_1318 139
552 3300046512 Ga0495610_0083855 Ga0495610_0083855_666_1172 139
553 3300046514 Ga0495618_0040991 Ga0495618_0040991_2168_2659 139
554 3300046514 Ga0495618_0072283 Ga0495618_0072283_1232_1723 139
555 3300046515 Ga0495620_0017356 Ga0495620_0017356_1344_1835 139
556 3300046516 Ga0495628_0011906 Ga0495628_0011906_3228_3719 139
557 3300046516 Ga0495628_0025554 Ga0495628_0025554_2948_3439 139
558 3300046517 Ga0495630_0028380 Ga0495630_0028380_761_1252 139
559 3300046519 Ga0495632_0069336 Ga0495632_0069336_406_897 139
560 3300046522 Ga0495643_0361069 Ga0495643_0361069_128_619 139
561 3300046524 Ga0495648_0019060 Ga0495648_0019060_3982_4473 139
562 3300046524 Ga0495648_0023871 Ga0495648_0023871_416_907 139
563 3300046526 Ga0495666_0001761 Ga0495666_0001761_3082_3573 139
564 3300046526 Ga0495666_0186969 Ga0495666_0186969_219_710 139
565 3300046528 Ga0495642_0161316 Ga0495642_0161316_205_696 139
566 3300046529 Ga0495652_0096851 Ga0495652_0096851_622_1113 139
567 3300046531 Ga0495665_0082262 Ga0495665_0082262_750_1241 139
568 3300046531 Ga0495665_0324830 Ga0495665_0324830_226_717 139
569 3300046533 Ga0495640_0120825 Ga0495640_0120825_364_855 139
570 3300046535 Ga0495586_0006614 Ga0495586_0006614_2623_3114 139
571 3300046535 Ga0495586_0243830 Ga0495586_0243830_196_687 139
572 3300046536 Ga0495587_0004114 Ga0495587_0004114_1125_1616 139
573 3300046538 Ga0495609_0051556 Ga0495609_0051556_347_838 139
574 3300046542 Ga0495597_0027595 Ga0495597_0027595_1521_2012 139
575 3300046543 Ga0495645_0002458 Ga0495645_0002458_7615_8106 139
576 3300046557 Ga0495622_0000018 Ga0495622_0000018_77849_78340 139
577 3300046616 Ga0495668_0000028 Ga0495668_0000028_166272_166754 139
578 3300046642 Ga0495634_0004462 Ga0495634_0004462_649_1140 139
579 3300046642 Ga0495634_0365306 Ga0495634_0365306_281_772 139
580 3300046648 Ga0495611_0218241 Ga0495611_0218241_336_827 139
581 3300046663 Ga0495635_0003028 Ga0495635_0003028_7371_7862 139
582 3300046665 Ga0495661_0003061 Ga0495661_0003061_7895_8386 139
583 3300046675 Ga0495657_0079428 Ga0495657_0079428_1361_1852 139
584 3300046678 Ga0495599_0076400 Ga0495599_0076400_749_1240 139
585 3300046678 Ga0495599_0107804 Ga0495599_0107804_167_658 139
586 3300046679 Ga0495623_0002881 Ga0495623_0002881_8848_9339 139
587 3300046680 Ga0495646_0030921 Ga0495646_0030921_1680_2171 139
588 3300046680 Ga0495646_0033452 Ga0495646_0033452_2240_2731 139
589 3300046684 Ga0495669_0113642 Ga0495669_0113642_408_899 139
590 3300046689 Ga0495613_0108647 Ga0495613_0108647_514_1005 139
591 3300046689 Ga0495613_0164360 Ga0495613_0164360_337_828 139
592 3300046690 Ga0495624_0006943 Ga0495624_0006943_6835_7326 139
593 3300046690 Ga0495624_0027504 Ga0495624_0027504_1289_1780 139
594 3300046690 Ga0495624_0054486 Ga0495624_0054486_185_676 139
595 3300046692 Ga0495671_0012743 Ga0495671_0012743_63_554 139
596 3300046794 Ga0495589_0016853 Ga0495589_0016853_2677_3168 139
597 3300046809 Ga0495600_0054224 Ga0495600_0054224_1595_2083 139
598 3300046810 Ga0495660_0201221 Ga0495660_0201221_357_839 139
599 3300047315 Ga0495581_0000308 Ga0495581_0000308_8938_9429 139
600 3300047317 Ga0495604_0002498 Ga0495604_0002498_5770_6261 139
601 3300047317 Ga0495604_0022448 Ga0495604_0022448_2030_2521 139
602 3300047319 Ga0495674_0095829 Ga0495674_0095829_750_1241 139
603 3300047320 Ga0495672_0002721 Ga0495672_0002721_11875_12366 139
604 3300047321 Ga0495676_0031983 Ga0495676_0031983_3312_3803 139
605 3300047321 Ga0495676_0240225 Ga0495676_0240225_380_871 139
606 3300047322 Ga0495680_0022450 Ga0495680_0022450_2405_2896 139
607 3300047322 Ga0495680_0043303 Ga0495680_0043303_899_1390 139
608 3300047323 Ga0495683_0056996 Ga0495683_0056996_277_768 139
609 3300047443 Ga0495687_061217 Ga0495687_061217_492_983 139
610 3300047444 Ga0495675_0036533 Ga0495675_0036533_1606_2097 139
611 3300047444 Ga0495675_0138038 Ga0495675_0138038_54_545 139
612 3300047446 Ga0495679_000008 Ga0495679_000008_144720_145211 139
613 3300047446 Ga0495679_000300 Ga0495679_000300_25889_26380 139
614 3300047469 Ga0495673_0159263 Ga0495673_0159263_275_766 139
615 3300047470 Ga0495681_0055594 Ga0495681_0055594_612_1103 139
616 3300047471 Ga0495684_0042294 Ga0495684_0042294_2112_2603 139
617 3300047673 Ga0495593_0003365 Ga0495593_0003365_5631_6122 139
618 3300048088 Ga0495602_0011757 Ga0495602_0011757_1130_1621 139
619 3300048088 Ga0495602_0048159 Ga0495602_0048159_2421_2912 139
620 3300048089 Ga0495614_0015119 Ga0495614_0015119_1148_1639 139
621 3300048091 Ga0495626_0005137 Ga0495626_0005137_3580_4071 139
622 3300048907 Ga0496104_0909528 Ga0496104_0909528_153_656 139
623 3300048917 Ga0496114_0104534 Ga0496114_0104534_589_1092 139
624 3300048920 Ga0496117_0066625 Ga0496117_0066625_1521_2012 139
625 3300048921 Ga0496118_0022027 Ga0496118_0022027_2460_2951 139
626 3300048924 Ga0496121_0008159 Ga0496121_0008159_356_847 139
627 3300049459 Ga0495678_007106 Ga0495678_007106_1521_2012 139
628 3300049459 Ga0495678_019188 Ga0495678_019188_1971_2453 139
629 3300049568 Ga0501031_0015019 Ga0501031_0015019_4329_4811 139
630 3300049568 Ga0501031_0148125 Ga0501031_0148125_494_976 139
631 3300049569 Ga0501032_0002974 Ga0501032_0002974_6200_6682 139
632 3300049569 Ga0501032_0009021 Ga0501032_0009021_6663_7145 139
633 3300049570 Ga0501033_0001594 Ga0501033_0001594_13050_13532 139
634 3300049570 Ga0501033_0167046 Ga0501033_0167046_203_685 139
635 3300049571 Ga0501034_0040330 Ga0501034_0040330_539_1021 139
636 3300049572 Ga0501036_0004807 Ga0501036_0004807_5094_5576 139
637 3300049572 Ga0501036_0088629 Ga0501036_0088629_494_976 139
638 3300049573 Ga0501037_0002776 Ga0501037_0002776_8087_8569 139
639 3300049574 Ga0501038_0002215 Ga0501038_0002215_4148_4630 139
640 3300049574 Ga0501038_0008444 Ga0501038_0008444_7675_8157 139
641 3300049574 Ga0501038_0022440 Ga0501038_0022440_1249_1731 139
642 3300049575 Ga0501039_0005521 Ga0501039_0005521_2730_3212 139
643 3300049575 Ga0501039_0017532 Ga0501039_0017532_686_1168 139
644 3300049576 Ga0501040_0007076 Ga0501040_0007076_248_730 139
645 3300049577 Ga0501041_0349276 Ga0501041_0349276_61_543 139
646 3300049578 Ga0501042_0001122 Ga0501042_0001122_3672_4154 139
647 3300049579 Ga0501043_0005777 Ga0501043_0005777_5775_6257 139
648 3300049579 Ga0501043_0044298 Ga0501043_0044298_1253_1735 139
649 3300049579 Ga0501043_0149271 Ga0501043_0149271_1328_1810 139
650 3300049580 Ga0501046_0001218 Ga0501046_0001218_14934_15416 139
651 3300049580 Ga0501046_0013156 Ga0501046_0013156_2650_3132 139
652 3300049581 Ga0501047_0022202 Ga0501047_0022202_5256_5738 139
653 3300049582 Ga0501048_0055918 Ga0501048_0055918_904_1386 139
654 3300049583 Ga0501067_0619606 Ga0501067_0619606_110_592 139
655 3300049584 Ga0501068_0010069 Ga0501068_0010069_4759_5241 139
656 3300049679 Ga0501249_014616 Ga0501249_014616_605_1111 139
657 3300049822 Ga0501035_0001588 Ga0501035_0001588_20347_20829 139
658 3300049822 Ga0501035_0290622 Ga0501035_0290622_212_694 139
659 3300049822 Ga0501035_0645934 Ga0501035_0645934_84_566 139
660 3300049823 Ga0501044_0009871 Ga0501044_0009871_2058_2540 139
661 3300049823 Ga0501044_0015564 Ga0501044_0015564_6474_6956 139
662 3300049824 Ga0501045_0005631 Ga0501045_0005631_1639_2121 139
663 3300050507 nmdc:mga05p37_80858_c1 nmdc:mga05p37_80858_c1_539_1024 139
664 3300050508 nmdc:mga09592_40483_c1 nmdc:mga09592_40483_c1_308_793 139
665 3300050509 nmdc:mga0qj67_19318_c1 nmdc:mga0qj67_19318_c1_2014_2499 139
666 3300050510 nmdc:mga06r32_82249_c1 nmdc:mga06r32_82249_c1_1661_2146 139
667 3300050511 nmdc:mga08y16_1010141_c1 nmdc:mga08y16_1010141_c1_149_628 139
668 3300050515 nmdc:mga0a205_324751_c1 nmdc:mga0a205_324751_c1_338_823 139
669 3300053108 Ga0500562_000577 Ga0500562_000577_4700_5191 139
670 3300053117 Ga0500593_111046 Ga0500593_111046_245_736 139
671 3300053153 Ga0500616_0032201 Ga0500616_0032201_412_894 139
672 3300059506 Ga0587085_035384 Ga0587085_035384_92_577 139
673 3300059639 Ga0587062_047956 Ga0587062_047956_119_604 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05638

T6SS_HCP

Type VI secretion system effector, Hcp

28

157

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y12-assembly1.cif.gz_A structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9271 2 139
1y12-assembly2.cif.gz_B structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9249 2 139
1y12-assembly1.cif.gz_C structure of a hemolysin-coregulated protein from pseudomonas aeruginosa 0.9229 2 139
4tv4-assembly1.cif.gz_A-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9205 2 139
4tv4-assembly1.cif.gz_C-2 crystal structure of a putative uncharacterized protein from burkholderia pseudomallei 0.9201 2 139
ID Description Score Start End Superfamily
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9201 2 139 2.30.110.20
3eaaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9075 2 139 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.9033 2 139 2.30.110.20
1y12B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8908 2 139 2.30.110.20
5xeuF00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like 0.8692 4 137 2.30.110.20
ID Description Score Start End GO Terms
AF-K8A3X2-F1-model_v4 Uncharacterized protein ImpD 0.9585 38 139
AF-A0A3D5AS39-F1-model_v4 Type VI secretion system tube protein Hcp 0.9565 3 139
AF-A0A535EEU2-F1-model_v4 Type VI secretion system tube protein Hcp 0.9536 1 139
AF-A0A5C7M321-F1-model_v4 deleted 0.952 1 139
AF-A0A379CWI1-F1-model_v4 deleted 0.9513 34 139

Feature Viewer

pLDDT pTM Quality
90.31 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map