F474277
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 399 | 647 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300004799|Ga0058863_10022113|Ga0058863_100221131 |
| Length | 182 |
| Sequence | MAPAVMLEPHTPFIALGTEITAMAVDMFLKLDGIKGESLDATHKDEIDVLAWSWGLSQSGSTHVGGGSGAGKVNIQDISFTKWVDKSSPVLFYDCAAGKHITEATLTVRKAGEKPLEYLKINLKDLIVSSISTGGSGGEDRLTENVTLNFGKVQVTYTPQKKDGSGDAQVVNGWDIQTNQKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 2 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 3 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 4 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 7 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 11 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 16 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 17 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 18 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 19 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 20 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 21 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 22 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 23 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 24 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 25 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 37 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 38 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 40 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 41 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 200 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 201 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 228 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 229 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 230 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 339 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 343 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 344 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 383 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 387 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 389 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 393 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 399 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.23 |
| Metatranscriptomes | 5.05 |
| Isolates | 3.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.36 |
| Nodule | 0.45 |
| Rhizoplane | 2.67 |
| Rhizosphere | 80.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1002469 | 3300002773 | Bacteria | 7006 |
| 2 | JGI25150J39212_1002495 | 3300002774 | Bacteria | 4557 |
| 3 | JGI25153J46596_10005824 | 3300003215 | Bacteria | 6404 |
| 4 | rootL2_10093421 | 3300003322 | Bacteria | 4672 |
| 5 | rootL2_10128998 | 3300003322 | Bacteria | 1743 |
| 6 | rootH1_10132987 | 3300003323 | Bacteria | 3341 |
| 7 | Ga0055526_1005023 | 3300003771 | Bacteria | 7737 |
| 8 | Ga0055526_1005529 | 3300003771 | Bacteria | 7229 |
| 9 | Ga0055537_1007066 | 3300003773 | Bacteria | 2761 |
| 10 | Ga0055524_1000182 | 3300003775 | Bacteria | 70730 |
| 11 | Ga0055524_1006279 | 3300003775 | Bacteria | 5174 |
| 12 | Ga0055524_1082106 | 3300003775 | Bacteria | 583 |
| 13 | Ga0055534_1042626 | 3300003784 | Bacteria | 664 |
| 14 | Ga0055530_10000037 | 3300003791 | Bacteria | 116741 |
| 15 | Ga0055530_10012424 | 3300003791 | Bacteria | 2971 |
| 16 | Ga0055530_10043783 | 3300003791 | Bacteria | 1078 |
| 17 | Ga0055540_1003124 | 3300003792 | Bacteria | 8208 |
| 18 | Ga0055531_10000557 | 3300003794 | Bacteria | 32742 |
| 19 | Ga0055531_10043071 | 3300003794 | Bacteria | 1282 |
| 20 | Ga0058858_1158617 | 3300004785 | Bacteria | 863 |
| 21 | Ga0058859_10842610 | 3300004798 | Unclassified | 794 |
| 22 | Ga0058863_10022113 | 3300004799 | Bacteria | 950 |
| 23 | Ga0058863_11830666 | 3300004799 | Bacteria | 4264 |
| 24 | Ga0058861_10021452 | 3300004800 | Bacteria | 901 |
| 25 | Ga0058861_11921876 | 3300004800 | Bacteria | 3764 |
| 26 | Ga0058860_11397319 | 3300004801 | Bacteria | 715 |
| 27 | Ga0058860_11538292 | 3300004801 | Bacteria | 1545 |
| 28 | Ga0058860_12134235 | 3300004801 | Bacteria | 785 |
| 29 | Ga0058862_10008156 | 3300004803 | Bacteria | 1568 |
| 30 | Ga0058862_12692344 | 3300004803 | Bacteria | 3473 |
| 31 | Ga0058862_12871773 | 3300004803 | Bacteria | 1217 |
| 32 | Ga0065165_1000615 | 3300005262 | Bacteria | 51725 |
| 33 | Ga0070658_10105728 | 3300005327 | Bacteria | 2328 |
| 34 | Ga0070683_100071547 | 3300005329 | Bacteria | 3236 |
| 35 | Ga0068869_100179405 | 3300005334 | Bacteria | 1660 |
| 36 | Ga0070666_10241251 | 3300005335 | Bacteria | 1278 |
| 37 | Ga0070680_100002662 | 3300005336 | Bacteria | 13236 |
| 38 | Ga0070680_100006366 | 3300005336 | Bacteria | 8968 |
| 39 | Ga0070680_100116848 | 3300005336 | Bacteria | 2224 |
| 40 | Ga0070680_100224391 | 3300005336 | Unclassified | 1586 |
| 41 | Ga0070680_100587637 | 3300005336 | Bacteria | 956 |
| 42 | Ga0070680_100807117 | 3300005336 | Unclassified | 809 |
| 43 | Ga0068868_101040511 | 3300005338 | Bacteria | 751 |
| 44 | Ga0070660_100498789 | 3300005339 | Unclassified | 1013 |
| 45 | Ga0070691_10287996 | 3300005341 | Unclassified | 893 |
| 46 | Ga0070687_100723982 | 3300005343 | Bacteria | 697 |
| 47 | Ga0070669_100133338 | 3300005353 | Bacteria | 1908 |
| 48 | Ga0070675_100450676 | 3300005354 | Bacteria | 1154 |
| 49 | Ga0070674_100231661 | 3300005356 | Unclassified | 1442 |
| 50 | Ga0070688_100048473 | 3300005365 | Bacteria | 2640 |
| 51 | Ga0070667_100197769 | 3300005367 | Bacteria | 1783 |
| 52 | Ga0070709_10198086 | 3300005434 | Bacteria | 1421 |
| 53 | Ga0070714_100546863 | 3300005435 | Bacteria | 1108 |
| 54 | Ga0070694_100012071 | 3300005444 | Bacteria | 5365 |
| 55 | Ga0070708_100044519 | 3300005445 | Bacteria | 3903 |
| 56 | Ga0070708_100143747 | 3300005445 | Bacteria | 2214 |
| 57 | Ga0070678_100031236 | 3300005456 | Bacteria | 3671 |
| 58 | Ga0070678_100091416 | 3300005456 | Bacteria | 2335 |
| 59 | Ga0070678_100165666 | 3300005456 | Bacteria | 1795 |
| 60 | Ga0070678_100256737 | 3300005456 | Unclassified | 1468 |
| 61 | Ga0070662_100264234 | 3300005457 | Bacteria | 1387 |
| 62 | Ga0070681_10001907 | 3300005458 | Bacteria | 18810 |
| 63 | Ga0070681_10193820 | 3300005458 | Bacteria | 1951 |
| 64 | Ga0068867_100110734 | 3300005459 | Unclassified | 2109 |
| 65 | Ga0070685_10311616 | 3300005466 | Unclassified | 1064 |
| 66 | Ga0070706_100059014 | 3300005467 | Bacteria | 3541 |
| 67 | Ga0070706_100560864 | 3300005467 | Bacteria | 1062 |
| 68 | Ga0070707_100362489 | 3300005468 | Bacteria | 1408 |
| 69 | Ga0070698_100333961 | 3300005471 | Bacteria | 1447 |
| 70 | Ga0070698_101096864 | 3300005471 | Bacteria | 744 |
| 71 | Ga0070679_100001193 | 3300005530 | Bacteria | 22833 |
| 72 | Ga0070679_100001971 | 3300005530 | Bacteria | 18411 |
| 73 | Ga0070679_100171998 | 3300005530 | Unclassified | 2139 |
| 74 | Ga0070679_100219890 | 3300005530 | Bacteria | 1861 |
| 75 | Ga0070684_100083380 | 3300005535 | Bacteria | 2832 |
| 76 | Ga0070697_100254164 | 3300005536 | Unclassified | 1503 |
| 77 | Ga0070697_101475259 | 3300005536 | Bacteria | 608 |
| 78 | Ga0070672_100331843 | 3300005543 | Bacteria | 1294 |
| 79 | Ga0070665_100027839 | 3300005548 | Bacteria | 5692 |
| 80 | Ga0068855_100135254 | 3300005563 | Bacteria | 2813 |
| 81 | Ga0068855_100324882 | 3300005563 | Bacteria | 1700 |
| 82 | Ga0068855_100748706 | 3300005563 | Unclassified | 1042 |
| 83 | Ga0068855_101143462 | 3300005563 | Bacteria | 812 |
| 84 | Ga0070664_100391096 | 3300005564 | Bacteria | 1270 |
| 85 | Ga0068854_100610014 | 3300005578 | Bacteria | 933 |
| 86 | Ga0068856_100451997 | 3300005614 | Bacteria | 1305 |
| 87 | Ga0068852_100052884 | 3300005616 | Bacteria | 3493 |
| 88 | Ga0068852_101225068 | 3300005616 | Unclassified | 772 |
| 89 | Ga0068859_100007356 | 3300005617 | Bacteria | 11171 |
| 90 | Ga0068859_100100382 | 3300005617 | Bacteria | 2950 |
| 91 | Ga0068864_100070433 | 3300005618 | Bacteria | 3043 |
| 92 | Ga0068864_100083232 | 3300005618 | Bacteria | 2809 |
| 93 | Ga0068866_10025543 | 3300005718 | Bacteria | 2778 |
| 94 | Ga0068851_10083545 | 3300005834 | Bacteria | 1671 |
| 95 | Ga0068863_100088411 | 3300005841 | Bacteria | 2936 |
| 96 | Ga0068863_100153974 | 3300005841 | Bacteria | 2200 |
| 97 | Ga0068863_100373581 | 3300005841 | Bacteria | 1391 |
| 98 | Ga0068863_100409645 | 3300005841 | Bacteria | 1327 |
| 99 | Ga0068863_100930611 | 3300005841 | Bacteria | 870 |
| 100 | Ga0068858_100181912 | 3300005842 | Bacteria | 1985 |
| 101 | Ga0068858_100896103 | 3300005842 | Bacteria | 867 |
| 102 | Ga0068860_100629064 | 3300005843 | Bacteria | 1080 |
| 103 | Ga0068862_100189320 | 3300005844 | Unclassified | 1851 |
| 104 | Ga0081538_10069435 | 3300005981 | Bacteria | 1952 |
| 105 | Ga0075364_10501552 | 3300006051 | Bacteria | 830 |
| 106 | Ga0070716_100549068 | 3300006173 | Bacteria | 861 |
| 107 | Ga0075366_10122003 | 3300006195 | Bacteria | 1571 |
| 108 | Ga0097621_100715318 | 3300006237 | Bacteria | 923 |
| 109 | Ga0075370_10033556 | 3300006353 | Bacteria | 2874 |
| 110 | Ga0075370_10838997 | 3300006353 | Bacteria | 561 |
| 111 | Ga0068871_100251431 | 3300006358 | Bacteria | 1540 |
| 112 | Ga0068871_100432399 | 3300006358 | Unclassified | 1177 |
| 113 | Ga0075428_100022695 | 3300006844 | Bacteria | 6946 |
| 114 | Ga0075430_100015375 | 3300006846 | Bacteria | 6515 |
| 115 | Ga0075431_100000941 | 3300006847 | Bacteria | 25660 |
| 116 | Ga0075433_11423449 | 3300006852 | Unclassified | 599 |
| 117 | Ga0075429_100024405 | 3300006880 | Bacteria | 5246 |
| 118 | Ga0075429_101330961 | 3300006880 | Unclassified | 626 |
| 119 | Ga0068865_100262622 | 3300006881 | Bacteria | 1367 |
| 120 | Ga0097620_100007356 | 3300006931 | Bacteria | 11171 |
| 121 | Ga0097620_100100384 | 3300006931 | Bacteria | 2950 |
| 122 | Ga0079104_1000333 | 3300006946 | Bacteria | 57718 |
| 123 | Ga0105251_10023081 | 3300009011 | Bacteria | 3217 |
| 124 | Ga0105251_10063868 | 3300009011 | Bacteria | 1727 |
| 125 | Ga0105244_10000079 | 3300009036 | Bacteria | 107070 |
| 126 | Ga0105240_10159674 | 3300009093 | Bacteria | 2679 |
| 127 | Ga0111539_10836118 | 3300009094 | Bacteria | 1071 |
| 128 | Ga0105247_10127208 | 3300009101 | Bacteria | 1657 |
| 129 | Ga0105247_11075912 | 3300009101 | Bacteria | 633 |
| 130 | Ga0114129_10131009 | 3300009147 | Bacteria | 3444 |
| 131 | Ga0105243_10772248 | 3300009148 | Unclassified | 944 |
| 132 | Ga0105243_11258507 | 3300009148 | Unclassified | 755 |
| 133 | Ga0105242_10789854 | 3300009176 | Bacteria | 939 |
| 134 | Ga0105248_10045882 | 3300009177 | Bacteria | 4899 |
| 135 | Ga0105248_10225457 | 3300009177 | Bacteria | 2109 |
| 136 | Ga0105248_10983521 | 3300009177 | Bacteria | 953 |
| 137 | Ga0105238_10680362 | 3300009551 | Bacteria | 1040 |
| 138 | Ga0157327_1023884 | 3300012512 | Bacteria | 713 |
| 139 | Ga0157370_10010706 | 3300013104 | Bacteria | 9650 |
| 140 | Ga0157369_10502363 | 3300013105 | Bacteria | 1254 |
| 141 | Ga0157369_10758997 | 3300013105 | Bacteria | 997 |
| 142 | Ga0157374_10258764 | 3300013296 | Bacteria | 1714 |
| 143 | Ga0157378_10205693 | 3300013297 | Bacteria | 1864 |
| 144 | Ga0163162_10001320 | 3300013306 | Bacteria | 23166 |
| 145 | Ga0163162_10022603 | 3300013306 | Bacteria | 6199 |
| 146 | Ga0163162_10088294 | 3300013306 | Bacteria | 3180 |
| 147 | Ga0163162_11681545 | 3300013306 | Bacteria | 725 |
| 148 | Ga0157372_10020425 | 3300013307 | Bacteria | 7145 |
| 149 | Ga0157372_10195755 | 3300013307 | Bacteria | 2341 |
| 150 | Ga0157372_10237871 | 3300013307 | Unclassified | 2113 |
| 151 | Ga0157372_10757280 | 3300013307 | Bacteria | 1129 |
| 152 | Ga0157375_10013360 | 3300013308 | Bacteria | 7302 |
| 153 | Ga0157375_10161954 | 3300013308 | Bacteria | 2380 |
| 154 | Ga0163163_10000226 | 3300014325 | Bacteria | 58312 |
| 155 | Ga0157380_10078260 | 3300014326 | Bacteria | 2697 |
| 156 | Ga0157380_10454051 | 3300014326 | Bacteria | 1232 |
| 157 | Ga0157376_10281662 | 3300014969 | Bacteria | 1566 |
| 158 | Ga0157376_11069920 | 3300014969 | Bacteria | 831 |
| 159 | Ga0163161_10103296 | 3300017792 | Bacteria | 2124 |
| 160 | Ga0163161_10588390 | 3300017792 | Unclassified | 916 |
| 161 | Ga0206356_11608922 | 3300020070 | Bacteria | 1095 |
| 162 | Ga0154015_1582689 | 3300020610 | Bacteria | 630 |
| 163 | Ga0213872_10159972 | 3300021361 | Unclassified | 980 |
| 164 | Ga0213876_10000155 | 3300021384 | Bacteria | 72486 |
| 165 | Ga0213875_10116180 | 3300021388 | Bacteria | 1250 |
| 166 | Ga0207425_1000452 | 3300025245 | Bacteria | 26650 |
| 167 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 168 | Ga0209565_1004369 | 3300025263 | Bacteria | 4312 |
| 169 | Ga0209565_1011078 | 3300025263 | Bacteria | 2211 |
| 170 | Ga0209673_1011233 | 3300025273 | Bacteria | 3706 |
| 171 | Ga0209673_1020665 | 3300025273 | Bacteria | 2326 |
| 172 | Ga0209675_1006973 | 3300025291 | Bacteria | 4424 |
| 173 | Ga0209675_1018926 | 3300025291 | Bacteria | 1912 |
| 174 | Ga0209675_1047707 | 3300025291 | Bacteria | 899 |
| 175 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 176 | Ga0209564_1000142 | 3300025295 | Bacteria | 178742 |
| 177 | Ga0209564_1000818 | 3300025295 | Bacteria | 42378 |
| 178 | Ga0209564_1005525 | 3300025295 | Bacteria | 7164 |
| 179 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 180 | Ga0209758_1000246 | 3300025297 | Bacteria | 111041 |
| 181 | Ga0209050_1000058 | 3300025298 | Bacteria | 325558 |
| 182 | Ga0209050_1001069 | 3300025298 | Bacteria | 33615 |
| 183 | Ga0209050_1014421 | 3300025298 | Bacteria | 3405 |
| 184 | Ga0209050_1018180 | 3300025298 | Bacteria | 2746 |
| 185 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 186 | Ga0209256_1001716 | 3300025299 | Bacteria | 21021 |
| 187 | Ga0209256_1014547 | 3300025299 | Bacteria | 2822 |
| 188 | Ga0209256_1028527 | 3300025299 | Bacteria | 1572 |
| 189 | Ga0209051_1000155 | 3300025303 | Bacteria | 129560 |
| 190 | Ga0209257_1000236 | 3300025304 | Bacteria | 129543 |
| 191 | Ga0209257_1000259 | 3300025304 | Bacteria | 122101 |
| 192 | Ga0207656_10103245 | 3300025321 | Bacteria | 1309 |
| 193 | Ga0207655_1000188 | 3300025728 | Bacteria | 109393 |
| 194 | Ga0207713_1035062 | 3300025735 | Bacteria | 2170 |
| 195 | Ga0207710_10091215 | 3300025900 | Bacteria | 1426 |
| 196 | Ga0207680_10348640 | 3300025903 | Unclassified | 1040 |
| 197 | Ga0207699_10541724 | 3300025906 | Bacteria | 843 |
| 198 | Ga0207643_10378225 | 3300025908 | Bacteria | 892 |
| 199 | Ga0207705_10080606 | 3300025909 | Bacteria | 2372 |
| 200 | Ga0207705_10211804 | 3300025909 | Bacteria | 1470 |
| 201 | Ga0207684_11223657 | 3300025910 | Unclassified | 621 |
| 202 | Ga0207707_10000732 | 3300025912 | Bacteria | 32480 |
| 203 | Ga0207707_10067747 | 3300025912 | Bacteria | 3109 |
| 204 | Ga0207695_10367320 | 3300025913 | Bacteria | 1325 |
| 205 | Ga0207663_10574231 | 3300025916 | Bacteria | 884 |
| 206 | Ga0207660_10014120 | 3300025917 | Bacteria | 5245 |
| 207 | Ga0207660_10032840 | 3300025917 | Bacteria | 3585 |
| 208 | Ga0207660_10113048 | 3300025917 | Bacteria | 2046 |
| 209 | Ga0207660_10647779 | 3300025917 | Bacteria | 861 |
| 210 | Ga0207657_10399050 | 3300025919 | Bacteria | 1082 |
| 211 | Ga0207649_10355808 | 3300025920 | Bacteria | 1085 |
| 212 | Ga0207652_10022573 | 3300025921 | Bacteria | 5207 |
| 213 | Ga0207652_10051639 | 3300025921 | Bacteria | 3525 |
| 214 | Ga0207652_11408186 | 3300025921 | Unclassified | 600 |
| 215 | Ga0207646_10218024 | 3300025922 | Bacteria | 1724 |
| 216 | Ga0207681_10209874 | 3300025923 | Unclassified | 1500 |
| 217 | Ga0207694_11156925 | 3300025924 | Bacteria | 655 |
| 218 | Ga0207659_10418885 | 3300025926 | Unclassified | 1123 |
| 219 | Ga0207659_10446840 | 3300025926 | Bacteria | 1088 |
| 220 | Ga0207664_10466076 | 3300025929 | Bacteria | 1129 |
| 221 | Ga0207690_10581868 | 3300025932 | Bacteria | 912 |
| 222 | Ga0207706_10313860 | 3300025933 | Bacteria | 1365 |
| 223 | Ga0207709_10075225 | 3300025935 | Unclassified | 2158 |
| 224 | Ga0207704_10153059 | 3300025938 | Bacteria | 1630 |
| 225 | Ga0207704_10473609 | 3300025938 | Bacteria | 1004 |
| 226 | Ga0207704_10532023 | 3300025938 | Unclassified | 952 |
| 227 | Ga0207704_10798840 | 3300025938 | Bacteria | 788 |
| 228 | Ga0207665_10036171 | 3300025939 | Bacteria | 3282 |
| 229 | Ga0207665_10099209 | 3300025939 | Bacteria | 2031 |
| 230 | Ga0207691_10003268 | 3300025940 | Bacteria | 15788 |
| 231 | Ga0207691_10357168 | 3300025940 | Bacteria | 1250 |
| 232 | Ga0207711_10021013 | 3300025941 | Bacteria | 5451 |
| 233 | Ga0207711_10877436 | 3300025941 | Bacteria | 834 |
| 234 | Ga0207711_11414388 | 3300025941 | Bacteria | 638 |
| 235 | Ga0207661_10019114 | 3300025944 | Bacteria | 5101 |
| 236 | Ga0207667_10107881 | 3300025949 | Bacteria | 2873 |
| 237 | Ga0207667_10599363 | 3300025949 | Bacteria | 1111 |
| 238 | Ga0207651_10360502 | 3300025960 | Bacteria | 1227 |
| 239 | Ga0207668_10110183 | 3300025972 | Bacteria | 2064 |
| 240 | Ga0207640_10307673 | 3300025981 | Bacteria | 1256 |
| 241 | Ga0207703_10652173 | 3300026035 | Bacteria | 999 |
| 242 | Ga0207639_10216025 | 3300026041 | Bacteria | 1653 |
| 243 | Ga0207702_10069213 | 3300026078 | Bacteria | 3034 |
| 244 | Ga0207641_10024381 | 3300026088 | Bacteria | 4986 |
| 245 | Ga0207641_10314902 | 3300026088 | Bacteria | 1482 |
| 246 | Ga0207641_10364067 | 3300026088 | Bacteria | 1381 |
| 247 | Ga0207641_10666483 | 3300026088 | Bacteria | 1023 |
| 248 | Ga0207648_10046412 | 3300026089 | Unclassified | 3809 |
| 249 | Ga0207648_10558719 | 3300026089 | Unclassified | 1052 |
| 250 | Ga0207676_10110448 | 3300026095 | Bacteria | 2300 |
| 251 | Ga0207676_10155485 | 3300026095 | Bacteria | 1975 |
| 252 | Ga0207676_11867293 | 3300026095 | Unclassified | 599 |
| 253 | Ga0207674_10233765 | 3300026116 | Bacteria | 1786 |
| 254 | Ga0207674_11363754 | 3300026116 | Bacteria | 678 |
| 255 | Ga0207675_100085272 | 3300026118 | Bacteria | 2964 |
| 256 | Ga0207683_10036996 | 3300026121 | Bacteria | 4250 |
| 257 | Ga0207683_10520972 | 3300026121 | Bacteria | 1099 |
| 258 | Ga0207698_10180921 | 3300026142 | Bacteria | 1867 |
| 259 | Ga0207698_11795013 | 3300026142 | Unclassified | 628 |
| 260 | Ga0209281_1000322 | 3300027111 | Bacteria | 84374 |
| 261 | Ga0268265_10639436 | 3300028380 | Bacteria | 1021 |
| 262 | Ga0268264_10019844 | 3300028381 | Bacteria | 5491 |
| 263 | Ga0268264_10891426 | 3300028381 | Unclassified | 892 |
| 264 | Ga0265318_10318036 | 3300028577 | Bacteria | 568 |
| 265 | Ga0265340_10010391 | 3300031247 | Bacteria | 4980 |
| 266 | Ga0307513_10007974 | 3300031456 | Bacteria | 13615 |
| 267 | Ga0307513_10075226 | 3300031456 | Bacteria | 3508 |
| 268 | Ga0307513_10082794 | 3300031456 | Bacteria | 3302 |
| 269 | Ga0307513_10720466 | 3300031456 | Bacteria | 703 |
| 270 | Ga0307509_10004925 | 3300031507 | Bacteria | 18905 |
| 271 | Ga0307408_100035841 | 3300031548 | Bacteria | 3483 |
| 272 | Ga0316575_10002218 | 3300031665 | Bacteria | 6482 |
| 273 | Ga0265342_10497903 | 3300031712 | Bacteria | 622 |
| 274 | Ga0316576_10007196 | 3300031727 | Bacteria | 6983 |
| 275 | Ga0316576_10024025 | 3300031727 | Bacteria | 4253 |
| 276 | Ga0316576_11164423 | 3300031727 | Unclassified | 545 |
| 277 | Ga0316578_10003454 | 3300031728 | Bacteria | 7227 |
| 278 | Ga0316578_10033641 | 3300031728 | Bacteria | 2938 |
| 279 | Ga0316578_10100083 | 3300031728 | Bacteria | 1737 |
| 280 | Ga0316578_10200339 | 3300031728 | Unclassified | 1202 |
| 281 | Ga0316577_10015853 | 3300031733 | Bacteria | 4148 |
| 282 | Ga0307410_10150694 | 3300031852 | Bacteria | 1731 |
| 283 | Ga0307416_100483379 | 3300032002 | Bacteria | 1299 |
| 284 | Ga0307411_10890372 | 3300032005 | Unclassified | 790 |
| 285 | Ga0316585_10000135 | 3300032137 | Bacteria | 14374 |
| 286 | Ga0316585_10015525 | 3300032137 | Bacteria | 2286 |
| 287 | Ga0316580_10003872 | 3300032139 | Bacteria | 4295 |
| 288 | Ga0316593_10000488 | 3300032168 | Bacteria | 7342 |
| 289 | Ga0316593_10012916 | 3300032168 | Bacteria | 2461 |
| 290 | Ga0316592_1008726 | 3300033524 | Bacteria | 2013 |
| 291 | Ga0316592_1045478 | 3300033524 | Bacteria | 977 |
| 292 | Ga0316592_1045972 | 3300033524 | Bacteria | 972 |
| 293 | Ga0316586_1013613 | 3300033527 | Bacteria | 1274 |
| 294 | Ga0316586_1070231 | 3300033527 | Unclassified | 644 |
| 295 | Ga0316586_1110879 | 3300033527 | Unclassified | 530 |
| 296 | Ga0316588_1028846 | 3300033528 | Bacteria | 1296 |
| 297 | Ga0316588_1074923 | 3300033528 | Unclassified | 834 |
| 298 | Ga0316587_1009144 | 3300033529 | Bacteria | 1568 |
| 299 | Ga0316587_1073882 | 3300033529 | Unclassified | 640 |
| 300 | Ga0316596_1001923 | 3300033541 | Bacteria | 4353 |
| 301 | Ga0316596_1006082 | 3300033541 | Bacteria | 2791 |
| 302 | Ga0316596_1039698 | 3300033541 | Bacteria | 1235 |
| 303 | Ga0316596_1191131 | 3300033541 | Unclassified | 568 |
| 304 | Ga0373957_0109252 | 3300035120 | Bacteria | 1113 |
| 305 | Ga0373955_0301483 | 3300035172 | Bacteria | 966 |
| 306 | Ga0316574_0004903 | 3300035398 | Bacteria | 7088 |
| 307 | Ga0316574_0007153 | 3300035398 | Bacteria | 6101 |
| 308 | Ga0316574_0015422 | 3300035398 | Bacteria | 4433 |
| 309 | Ga0316574_0121960 | 3300035398 | Bacteria | 1674 |
| 310 | Ga0373931_0644463 | 3300035691 | Bacteria | 696 |
| 311 | Ga0373937_0032536 | 3300036401 | Bacteria | 4730 |
| 312 | Ga0373937_0066233 | 3300036401 | Bacteria | 3326 |
| 313 | Ga0373937_0542939 | 3300036401 | Bacteria | 1104 |
| 314 | Ga0310109_049593 | 3300036534 | Unclassified | 541 |
| 315 | Ga0316582_0004722 | 3300036647 | Bacteria | 6934 |
| 316 | Ga0316582_0106664 | 3300036647 | Bacteria | 1861 |
| 317 | Ga0316582_0227241 | 3300036647 | Unclassified | 1277 |
| 318 | Ga0316582_0382842 | 3300036647 | Unclassified | 969 |
| 319 | Ga0316584_0055392 | 3300036712 | Bacteria | 2969 |
| 320 | Ga0316584_0236936 | 3300036712 | Unclassified | 1337 |
| 321 | Ga0395899_0121509 | 3300037312 | Bacteria | 1870 |
| 322 | Ga0395900_0061088 | 3300037418 | Bacteria | 3875 |
| 323 | Ga0395900_0286488 | 3300037418 | Bacteria | 1637 |
| 324 | Ga0395900_0329012 | 3300037418 | Bacteria | 1506 |
| 325 | Ga0395900_0912106 | 3300037418 | Bacteria | 801 |
| 326 | Ga0395898_0140228 | 3300037466 | Bacteria | 2314 |
| 327 | Ga0395898_0245260 | 3300037466 | Bacteria | 1708 |
| 328 | Ga0395905_0120906 | 3300037471 | Bacteria | 2461 |
| 329 | Ga0395905_0131211 | 3300037471 | Bacteria | 2356 |
| 330 | Ga0395905_0347648 | 3300037471 | Bacteria | 1374 |
| 331 | Ga0395905_0573681 | 3300037471 | Bacteria | 1029 |
| 332 | Ga0436364_0657416 | 3300037853 | Bacteria | 2095 |
| 333 | Ga0395901_0675161 | 3300038443 | Bacteria | 1033 |
| 334 | Ga0400491_20990 | 3300038727 | Bacteria | 6987 |
| 335 | Ga0436365_0124459 | 3300039437 | Bacteria | 1901 |
| 336 | Ga0436365_1190722 | 3300039437 | Bacteria | 68726 |
| 337 | Ga0436365_1930978 | 3300039437 | Bacteria | 2880 |
| 338 | Ga0436360_0198049 | 3300039438 | Bacteria | 2298 |
| 339 | Ga0436361_0028601 | 3300039447 | Unclassified | 4066 |
| 340 | Ga0436361_1127599 | 3300039447 | Unclassified | 3363 |
| 341 | Ga0439437_024272 | 3300042000 | Bacteria | 744 |
| 342 | Ga0439448_0083741 | 3300042005 | Bacteria | 1073 |
| 343 | Ga0439455_0020843 | 3300042012 | Bacteria | 1557 |
| 344 | Ga0450890_034873 | 3300042127 | Bacteria | 728 |
| 345 | Ga0439435_0027498 | 3300042436 | Bacteria | 1522 |
| 346 | Ga0439459_0002620 | 3300042438 | Bacteria | 2789 |
| 347 | Ga0451577_0001743 | 3300042876 | Bacteria | 28044 |
| 348 | Ga0439440_0086160 | 3300042993 | Bacteria | 837 |
| 349 | Ga0466969_0189687 | 3300044656 | Bacteria | 939 |
| 350 | Ga0466972_0108906 | 3300044658 | Bacteria | 1309 |
| 351 | Ga0466965_0059795 | 3300044683 | Bacteria | 1902 |
| 352 | Ga0466961_0269813 | 3300044693 | Bacteria | 1042 |
| 353 | Ga0466961_0420101 | 3300044693 | Bacteria | 810 |
| 354 | Ga0466964_0112789 | 3300044706 | Bacteria | 1215 |
| 355 | Ga0466968_0452414 | 3300044735 | Bacteria | 635 |
| 356 | Ga0466970_0187859 | 3300044765 | Bacteria | 1147 |
| 357 | Ga0466957_0019001 | 3300044842 | Bacteria | 4040 |
| 358 | Ga0466959_0106308 | 3300045049 | Bacteria | 2006 |
| 359 | Ga0466959_0164492 | 3300045049 | Bacteria | 1558 |
| 360 | Ga0451576_0038173 | 3300045051 | Bacteria | 5083 |
| 361 | Ga0466958_0183561 | 3300045836 | Bacteria | 1328 |
| 362 | Ga0466967_0174395 | 3300045976 | Bacteria | 2025 |
| 363 | Ga0466967_1034409 | 3300045976 | Bacteria | 818 |
| 364 | Ga0495592_0003568 | 3300046454 | Bacteria | 11180 |
| 365 | Ga0495603_0021112 | 3300046455 | Bacteria | 3942 |
| 366 | Ga0495603_0040025 | 3300046455 | Bacteria | 2807 |
| 367 | Ga0495590_0123163 | 3300046457 | Bacteria | 929 |
| 368 | Ga0495591_000806 | 3300046458 | Bacteria | 22207 |
| 369 | Ga0495591_137425 | 3300046458 | Bacteria | 590 |
| 370 | Ga0495629_0000436 | 3300046459 | Bacteria | 34789 |
| 371 | Ga0495629_0008971 | 3300046459 | Bacteria | 7343 |
| 372 | Ga0495629_0110817 | 3300046459 | Bacteria | 1913 |
| 373 | Ga0495638_0001574 | 3300046460 | Bacteria | 20441 |
| 374 | Ga0495638_0004077 | 3300046460 | Bacteria | 11193 |
| 375 | Ga0495638_0004290 | 3300046460 | Bacteria | 10819 |
| 376 | Ga0495638_0011608 | 3300046460 | Bacteria | 6066 |
| 377 | Ga0495638_0506840 | 3300046460 | Bacteria | 607 |
| 378 | Ga0495641_0021538 | 3300046461 | Bacteria | 3242 |
| 379 | Ga0495641_0076252 | 3300046461 | Bacteria | 1503 |
| 380 | Ga0495651_0016516 | 3300046462 | Bacteria | 5718 |
| 381 | Ga0495651_0066336 | 3300046462 | Bacteria | 2755 |
| 382 | Ga0495653_0001432 | 3300046463 | Bacteria | 18609 |
| 383 | Ga0495653_0009893 | 3300046463 | Bacteria | 7797 |
| 384 | Ga0495653_0024886 | 3300046463 | Bacteria | 4817 |
| 385 | Ga0495650_0006227 | 3300046471 | Bacteria | 7479 |
| 386 | Ga0495580_0000454 | 3300046472 | Bacteria | 33966 |
| 387 | Ga0495580_0007150 | 3300046472 | Bacteria | 8988 |
| 388 | Ga0495580_0105818 | 3300046472 | Bacteria | 1954 |
| 389 | Ga0495582_0008680 | 3300046473 | Bacteria | 5603 |
| 390 | Ga0495582_0784309 | 3300046473 | Bacteria | 551 |
| 391 | Ga0495605_0003916 | 3300046474 | Bacteria | 8809 |
| 392 | Ga0495605_0009041 | 3300046474 | Bacteria | 5608 |
| 393 | Ga0495605_0159260 | 3300046474 | Bacteria | 1003 |
| 394 | Ga0495662_0013480 | 3300046476 | Bacteria | 3979 |
| 395 | Ga0495662_0017902 | 3300046476 | Bacteria | 3429 |
| 396 | Ga0495662_0091525 | 3300046476 | Bacteria | 1483 |
| 397 | Ga0495664_0007110 | 3300046477 | Bacteria | 6202 |
| 398 | Ga0495664_0016662 | 3300046477 | Bacteria | 4190 |
| 399 | Ga0495664_0129883 | 3300046477 | Bacteria | 1525 |
| 400 | Ga0495594_0038887 | 3300046499 | Bacteria | 2599 |
| 401 | Ga0495594_0223823 | 3300046499 | Bacteria | 1073 |
| 402 | Ga0495594_0293698 | 3300046499 | Unclassified | 926 |
| 403 | Ga0495596_0038128 | 3300046500 | Bacteria | 1900 |
| 404 | Ga0495596_0044388 | 3300046500 | Bacteria | 1749 |
| 405 | Ga0495607_0037403 | 3300046501 | Bacteria | 2916 |
| 406 | Ga0495583_0022721 | 3300046506 | Bacteria | 3190 |
| 407 | Ga0495606_0041956 | 3300046507 | Bacteria | 3064 |
| 408 | Ga0495606_0074761 | 3300046507 | Bacteria | 2122 |
| 409 | Ga0495606_0092735 | 3300046507 | Bacteria | 1854 |
| 410 | Ga0495606_0265903 | 3300046507 | Bacteria | 944 |
| 411 | Ga0495608_0141134 | 3300046511 | Bacteria | 1537 |
| 412 | Ga0495610_0083855 | 3300046512 | Bacteria | 1457 |
| 413 | Ga0495610_0092869 | 3300046512 | Bacteria | 1365 |
| 414 | Ga0495616_0000031 | 3300046513 | Bacteria | 130957 |
| 415 | Ga0495616_0193990 | 3300046513 | Bacteria | 896 |
| 416 | Ga0495618_0006609 | 3300046514 | Bacteria | 7031 |
| 417 | Ga0495618_0040991 | 3300046514 | Bacteria | 2915 |
| 418 | Ga0495618_0072283 | 3300046514 | Bacteria | 2195 |
| 419 | Ga0495620_0017356 | 3300046515 | Bacteria | 3590 |
| 420 | Ga0495628_0011906 | 3300046516 | Bacteria | 7334 |
| 421 | Ga0495628_0025554 | 3300046516 | Bacteria | 4824 |
| 422 | Ga0495628_0110360 | 3300046516 | Bacteria | 2116 |
| 423 | Ga0495628_0119613 | 3300046516 | Bacteria | 2021 |
| 424 | Ga0495630_0008810 | 3300046517 | Bacteria | 7243 |
| 425 | Ga0495630_0028380 | 3300046517 | Bacteria | 4158 |
| 426 | Ga0495631_0230616 | 3300046518 | Bacteria | 790 |
| 427 | Ga0495632_0011423 | 3300046519 | Bacteria | 5181 |
| 428 | Ga0495632_0069336 | 3300046519 | Bacteria | 1698 |
| 429 | Ga0495643_0361069 | 3300046522 | Bacteria | 648 |
| 430 | Ga0495643_0365649 | 3300046522 | Bacteria | 643 |
| 431 | Ga0495644_0082696 | 3300046523 | Bacteria | 1210 |
| 432 | Ga0495648_0019060 | 3300046524 | Bacteria | 4838 |
| 433 | Ga0495648_0023871 | 3300046524 | Bacteria | 4177 |
| 434 | Ga0495648_0089242 | 3300046524 | Bacteria | 1730 |
| 435 | Ga0495666_0001761 | 3300046526 | Bacteria | 10678 |
| 436 | Ga0495666_0186969 | 3300046526 | Bacteria | 955 |
| 437 | Ga0495642_0131993 | 3300046528 | Bacteria | 1075 |
| 438 | Ga0495642_0161316 | 3300046528 | Bacteria | 972 |
| 439 | Ga0495642_0468128 | 3300046528 | Bacteria | 557 |
| 440 | Ga0495652_0096851 | 3300046529 | Bacteria | 2401 |
| 441 | Ga0495654_0060996 | 3300046530 | Bacteria | 1812 |
| 442 | Ga0495665_0000684 | 3300046531 | Bacteria | 17401 |
| 443 | Ga0495665_0082262 | 3300046531 | Bacteria | 1692 |
| 444 | Ga0495665_0324830 | 3300046531 | Bacteria | 785 |
| 445 | Ga0495640_0120825 | 3300046533 | Bacteria | 1703 |
| 446 | Ga0495586_0006614 | 3300046535 | Bacteria | 6190 |
| 447 | Ga0495586_0243830 | 3300046535 | Bacteria | 1024 |
| 448 | Ga0495587_0000623 | 3300046536 | Bacteria | 23941 |
| 449 | Ga0495587_0004114 | 3300046536 | Bacteria | 9621 |
| 450 | Ga0495609_0051556 | 3300046538 | Bacteria | 1832 |
| 451 | Ga0495597_0027595 | 3300046542 | Bacteria | 2603 |
| 452 | Ga0495597_0039268 | 3300046542 | Bacteria | 2120 |
| 453 | Ga0495645_0002458 | 3300046543 | Bacteria | 12581 |
| 454 | Ga0495645_0051268 | 3300046543 | Bacteria | 3003 |
| 455 | Ga0495622_0000018 | 3300046557 | Bacteria | 173985 |
| 456 | Ga0495667_0036463 | 3300046559 | Bacteria | 3283 |
| 457 | Ga0495667_0216758 | 3300046559 | Bacteria | 1222 |
| 458 | Ga0495668_0000028 | 3300046616 | Bacteria | 286629 |
| 459 | Ga0495668_0008200 | 3300046616 | Bacteria | 6558 |
| 460 | Ga0495668_0043959 | 3300046616 | Bacteria | 2483 |
| 461 | Ga0495668_0102187 | 3300046616 | Bacteria | 1568 |
| 462 | Ga0495668_0473743 | 3300046616 | Bacteria | 689 |
| 463 | Ga0495634_0004462 | 3300046642 | Bacteria | 10980 |
| 464 | Ga0495634_0261936 | 3300046642 | Bacteria | 1054 |
| 465 | Ga0495634_0365306 | 3300046642 | Bacteria | 862 |
| 466 | Ga0495611_0052761 | 3300046648 | Bacteria | 1835 |
| 467 | Ga0495611_0218241 | 3300046648 | Bacteria | 887 |
| 468 | Ga0495625_0060515 | 3300046660 | Bacteria | 2683 |
| 469 | Ga0495625_0068594 | 3300046660 | Bacteria | 2492 |
| 470 | Ga0495625_0213719 | 3300046660 | Bacteria | 1267 |
| 471 | Ga0495635_0003028 | 3300046663 | Bacteria | 11548 |
| 472 | Ga0495635_0015141 | 3300046663 | Bacteria | 5394 |
| 473 | Ga0495661_0003061 | 3300046665 | Bacteria | 12582 |
| 474 | Ga0495661_0003818 | 3300046665 | Bacteria | 11024 |
| 475 | Ga0495661_0043052 | 3300046665 | Bacteria | 2778 |
| 476 | Ga0495661_0074687 | 3300046665 | Bacteria | 1972 |
| 477 | Ga0495588_0268636 | 3300046674 | Bacteria | 899 |
| 478 | Ga0495657_0079428 | 3300046675 | Bacteria | 2125 |
| 479 | Ga0495599_0076400 | 3300046678 | Bacteria | 2091 |
| 480 | Ga0495599_0107804 | 3300046678 | Bacteria | 1735 |
| 481 | Ga0495623_0002881 | 3300046679 | Bacteria | 11335 |
| 482 | Ga0495623_0019699 | 3300046679 | Bacteria | 4361 |
| 483 | Ga0495646_0030921 | 3300046680 | Bacteria | 3340 |
| 484 | Ga0495646_0033452 | 3300046680 | Bacteria | 3195 |
| 485 | Ga0495646_0055206 | 3300046680 | Bacteria | 2386 |
| 486 | Ga0495669_0030615 | 3300046684 | Bacteria | 2362 |
| 487 | Ga0495669_0113642 | 3300046684 | Bacteria | 1266 |
| 488 | Ga0495669_0121767 | 3300046684 | Unclassified | 1223 |
| 489 | Ga0495613_0011548 | 3300046689 | Bacteria | 6565 |
| 490 | Ga0495613_0108647 | 3300046689 | Bacteria | 2000 |
| 491 | Ga0495613_0164360 | 3300046689 | Bacteria | 1577 |
| 492 | Ga0495624_0006943 | 3300046690 | Bacteria | 7985 |
| 493 | Ga0495624_0022029 | 3300046690 | Bacteria | 4218 |
| 494 | Ga0495624_0027504 | 3300046690 | Bacteria | 3723 |
| 495 | Ga0495624_0054486 | 3300046690 | Bacteria | 2521 |
| 496 | Ga0495670_0004408 | 3300046691 | Bacteria | 6906 |
| 497 | Ga0495670_0280063 | 3300046691 | Bacteria | 892 |
| 498 | Ga0495671_0012743 | 3300046692 | Bacteria | 4581 |
| 499 | Ga0495589_0002595 | 3300046794 | Bacteria | 10041 |
| 500 | Ga0495589_0016853 | 3300046794 | Bacteria | 3751 |
| 501 | Ga0495589_0049937 | 3300046794 | Bacteria | 2070 |
| 502 | Ga0495600_0001426 | 3300046809 | Bacteria | 13213 |
| 503 | Ga0495600_0039484 | 3300046809 | Bacteria | 3074 |
| 504 | Ga0495600_0054224 | 3300046809 | Bacteria | 2619 |
| 505 | Ga0495600_0676955 | 3300046809 | Bacteria | 622 |
| 506 | Ga0495660_0002945 | 3300046810 | Bacteria | 10660 |
| 507 | Ga0495660_0037357 | 3300046810 | Bacteria | 2705 |
| 508 | Ga0495660_0201221 | 3300046810 | Bacteria | 951 |
| 509 | Ga0495581_0000308 | 3300047315 | Bacteria | 23951 |
| 510 | Ga0495581_0010566 | 3300047315 | Bacteria | 5337 |
| 511 | Ga0495604_0002498 | 3300047317 | Bacteria | 14692 |
| 512 | Ga0495604_0022448 | 3300047317 | Bacteria | 5038 |
| 513 | Ga0495674_0095829 | 3300047319 | Bacteria | 2529 |
| 514 | Ga0495672_0002721 | 3300047320 | Bacteria | 15870 |
| 515 | Ga0495672_0016868 | 3300047320 | Bacteria | 4902 |
| 516 | Ga0495676_0010249 | 3300047321 | Bacteria | 8506 |
| 517 | Ga0495676_0031983 | 3300047321 | Bacteria | 4445 |
| 518 | Ga0495676_0240225 | 3300047321 | Bacteria | 1240 |
| 519 | Ga0495680_0022450 | 3300047322 | Bacteria | 5257 |
| 520 | Ga0495680_0043303 | 3300047322 | Bacteria | 3566 |
| 521 | Ga0495680_0335970 | 3300047322 | Bacteria | 1054 |
| 522 | Ga0495683_0016611 | 3300047323 | Bacteria | 3821 |
| 523 | Ga0495683_0056996 | 3300047323 | Bacteria | 1942 |
| 524 | Ga0495687_061217 | 3300047443 | Bacteria | 1549 |
| 525 | Ga0495675_0009494 | 3300047444 | Bacteria | 6057 |
| 526 | Ga0495675_0036533 | 3300047444 | Bacteria | 3132 |
| 527 | Ga0495675_0138038 | 3300047444 | Bacteria | 1512 |
| 528 | Ga0495679_000008 | 3300047446 | Bacteria | 367186 |
| 529 | Ga0495679_000300 | 3300047446 | Bacteria | 39860 |
| 530 | Ga0495679_000528 | 3300047446 | Bacteria | 27024 |
| 531 | Ga0495673_0008048 | 3300047469 | Bacteria | 5974 |
| 532 | Ga0495673_0159263 | 3300047469 | Bacteria | 867 |
| 533 | Ga0495673_0213161 | 3300047469 | Bacteria | 718 |
| 534 | Ga0495681_0027734 | 3300047470 | Bacteria | 2925 |
| 535 | Ga0495681_0028017 | 3300047470 | Bacteria | 2905 |
| 536 | Ga0495681_0055594 | 3300047470 | Bacteria | 1845 |
| 537 | Ga0495684_0042294 | 3300047471 | Bacteria | 3490 |
| 538 | Ga0495686_0000080 | 3300047472 | Bacteria | 201665 |
| 539 | Ga0495593_0003365 | 3300047673 | Bacteria | 9580 |
| 540 | Ga0495593_0010047 | 3300047673 | Bacteria | 5481 |
| 541 | Ga0495602_0011757 | 3300048088 | Bacteria | 9040 |
| 542 | Ga0495602_0033683 | 3300048088 | Bacteria | 4801 |
| 543 | Ga0495602_0048159 | 3300048088 | Bacteria | 3834 |
| 544 | Ga0495602_0720530 | 3300048088 | Bacteria | 675 |
| 545 | Ga0495614_0001749 | 3300048089 | Bacteria | 9485 |
| 546 | Ga0495614_0015119 | 3300048089 | Bacteria | 3368 |
| 547 | Ga0495626_0005137 | 3300048091 | Bacteria | 7774 |
| 548 | Ga0495626_0026687 | 3300048091 | Bacteria | 2812 |
| 549 | Ga0495626_0041344 | 3300048091 | Bacteria | 2172 |
| 550 | Ga0495626_0090685 | 3300048091 | Bacteria | 1344 |
| 551 | Ga0496100_0834814 | 3300048903 | Bacteria | 722 |
| 552 | Ga0496101_0183918 | 3300048904 | Bacteria | 1610 |
| 553 | Ga0496101_0224775 | 3300048904 | Bacteria | 1458 |
| 554 | Ga0496102_0207473 | 3300048905 | Bacteria | 1847 |
| 555 | Ga0496102_0354021 | 3300048905 | Bacteria | 1382 |
| 556 | Ga0496104_0513625 | 3300048907 | Bacteria | 1109 |
| 557 | Ga0496104_0909528 | 3300048907 | Unclassified | 785 |
| 558 | Ga0496105_0101656 | 3300048908 | Bacteria | 2374 |
| 559 | Ga0496107_0025214 | 3300048910 | Bacteria | 4208 |
| 560 | Ga0496108_0091387 | 3300048911 | Bacteria | 2588 |
| 561 | Ga0496109_0144539 | 3300048912 | Bacteria | 2225 |
| 562 | Ga0496109_0185128 | 3300048912 | Bacteria | 1957 |
| 563 | Ga0496110_0185911 | 3300048913 | Bacteria | 1887 |
| 564 | Ga0496112_0202447 | 3300048915 | Bacteria | 1944 |
| 565 | Ga0496114_0012808 | 3300048917 | Bacteria | 6715 |
| 566 | Ga0496114_0104534 | 3300048917 | Unclassified | 2421 |
| 567 | Ga0496114_0275663 | 3300048917 | Unclassified | 1482 |
| 568 | Ga0496115_0277947 | 3300048918 | Bacteria | 1375 |
| 569 | Ga0496117_0066625 | 3300048920 | Bacteria | 2441 |
| 570 | Ga0496118_0022027 | 3300048921 | Bacteria | 5587 |
| 571 | Ga0496118_0202237 | 3300048921 | Bacteria | 1175 |
| 572 | Ga0496121_0008159 | 3300048924 | Bacteria | 12438 |
| 573 | Ga0496121_0419662 | 3300048924 | Bacteria | 871 |
| 574 | Ga0496125_0010896 | 3300048928 | Bacteria | 9143 |
| 575 | Ga0496126_0000980 | 3300048929 | Bacteria | 48954 |
| 576 | Ga0496126_0187235 | 3300048929 | Bacteria | 1755 |
| 577 | Ga0501308_015218 | 3300049128 | Bacteria | 909 |
| 578 | Ga0495678_007106 | 3300049459 | Bacteria | 5853 |
| 579 | Ga0495678_019188 | 3300049459 | Bacteria | 3056 |
| 580 | Ga0495682_0025626 | 3300049460 | Bacteria | 2194 |
| 581 | Ga0495682_0190387 | 3300049460 | Bacteria | 728 |
| 582 | Ga0501031_0015019 | 3300049568 | Bacteria | 5030 |
| 583 | Ga0501031_0148125 | 3300049568 | Bacteria | 1533 |
| 584 | Ga0501032_0002974 | 3300049569 | Bacteria | 13154 |
| 585 | Ga0501032_0009021 | 3300049569 | Bacteria | 7248 |
| 586 | Ga0501033_0001594 | 3300049570 | Bacteria | 19939 |
| 587 | Ga0501033_0167046 | 3300049570 | Bacteria | 1581 |
| 588 | Ga0501034_0040006 | 3300049571 | Bacteria | 4748 |
| 589 | Ga0501034_0040330 | 3300049571 | Bacteria | 4725 |
| 590 | Ga0501036_0004807 | 3300049572 | Bacteria | 10918 |
| 591 | Ga0501036_0088629 | 3300049572 | Bacteria | 2614 |
| 592 | Ga0501037_0002776 | 3300049573 | Bacteria | 12676 |
| 593 | Ga0501038_0002215 | 3300049574 | Bacteria | 18081 |
| 594 | Ga0501038_0008444 | 3300049574 | Bacteria | 9473 |
| 595 | Ga0501038_0022440 | 3300049574 | Bacteria | 5655 |
| 596 | Ga0501039_0005521 | 3300049575 | Bacteria | 9568 |
| 597 | Ga0501039_0017532 | 3300049575 | Bacteria | 5492 |
| 598 | Ga0501040_0007076 | 3300049576 | Bacteria | 7272 |
| 599 | Ga0501041_0349276 | 3300049577 | Bacteria | 935 |
| 600 | Ga0501042_0001122 | 3300049578 | Bacteria | 15421 |
| 601 | Ga0501043_0005777 | 3300049579 | Bacteria | 9960 |
| 602 | Ga0501043_0044298 | 3300049579 | Bacteria | 3498 |
| 603 | Ga0501043_0149271 | 3300049579 | Bacteria | 1829 |
| 604 | Ga0501046_0001218 | 3300049580 | Bacteria | 24929 |
| 605 | Ga0501046_0013156 | 3300049580 | Bacteria | 7020 |
| 606 | Ga0501047_0022202 | 3300049581 | Bacteria | 6097 |
| 607 | Ga0501048_0055918 | 3300049582 | Bacteria | 2800 |
| 608 | Ga0501067_0619606 | 3300049583 | Bacteria | 607 |
| 609 | Ga0501068_0010069 | 3300049584 | Bacteria | 5305 |
| 610 | Ga0501073_0729258 | 3300049589 | Bacteria | 684 |
| 611 | Ga0501074_0249880 | 3300049590 | Bacteria | 1261 |
| 612 | Ga0501249_014616 | 3300049679 | Bacteria | 1674 |
| 613 | Ga0501080_0054212 | 3300049742 | Bacteria | 3734 |
| 614 | Ga0501080_0733510 | 3300049742 | Bacteria | 870 |
| 615 | Ga0501241_025048 | 3300049758 | Bacteria | 1110 |
| 616 | Ga0501035_0001588 | 3300049822 | Bacteria | 23027 |
| 617 | Ga0501035_0290622 | 3300049822 | Bacteria | 1379 |
| 618 | Ga0501035_0645934 | 3300049822 | Bacteria | 858 |
| 619 | Ga0501044_0009871 | 3300049823 | Bacteria | 10376 |
| 620 | Ga0501044_0015564 | 3300049823 | Bacteria | 8194 |
| 621 | Ga0501045_0005631 | 3300049824 | Bacteria | 8671 |
| 622 | nmdc:mga0yw44_42787_c1 | 3300050492 | Bacteria | 2702 |
| 623 | nmdc:mga0k408_88087_c1 | 3300050493 | Bacteria | 1823 |
| 624 | nmdc:mga07m45_12402_c1 | 3300050496 | Bacteria | 4504 |
| 625 | nmdc:mga05p37_80858_c1 | 3300050507 | Bacteria | 4002 |
| 626 | nmdc:mga09592_40483_c1 | 3300050508 | Bacteria | 3915 |
| 627 | nmdc:mga0qj67_19318_c1 | 3300050509 | Bacteria | 5204 |
| 628 | nmdc:mga06r32_82249_c1 | 3300050510 | Bacteria | 3137 |
| 629 | nmdc:mga08y16_1010141_c1 | 3300050511 | Bacteria | 811 |
| 630 | nmdc:mga0a205_324751_c1 | 3300050515 | Bacteria | 1409 |
| 631 | nmdc:mga0sz30_133863_c1 | 3300050516 | Bacteria | 1093 |
| 632 | Ga0500578_0249850 | 3300053086 | Bacteria | 1069 |
| 633 | Ga0500644_0400895 | 3300053088 | Bacteria | 598 |
| 634 | Ga0500646_0209133 | 3300053090 | Bacteria | 672 |
| 635 | Ga0500641_0003850 | 3300053096 | Bacteria | 5304 |
| 636 | Ga0500660_176652 | 3300053100 | Bacteria | 779 |
| 637 | Ga0500562_000577 | 3300053108 | Bacteria | 8802 |
| 638 | Ga0500593_111046 | 3300053117 | Bacteria | 1127 |
| 639 | Ga0500642_0087133 | 3300053130 | Bacteria | 1440 |
| 640 | Ga0500559_0193570 | 3300053136 | Bacteria | 958 |
| 641 | Ga0500616_0032201 | 3300053153 | Bacteria | 2867 |
| 642 | Ga0500622_0020392 | 3300053156 | Bacteria | 3520 |
| 643 | Ga0500609_001115 | 3300053731 | Bacteria | 4005 |
| 644 | Ga0501084_1468346 | 3300054114 | Unclassified | 571 |
| 645 | Ga0587085_035384 | 3300059506 | Bacteria | 844 |
| 646 | Ga0587062_047956 | 3300059639 | Bacteria | 715 |
| 647 | Ga0501082_0313310 | 3300060353 | Unclassified | 1367 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044706 | Ga0466964_0112789 | Ga0466964_0112789_417_902 | 116 |
| 2 | 3300046499 | Ga0495594_0293698 | Ga0495594_0293698_30_452 | 117 |
| 3 | 3300037418 | Ga0395900_0329012 | Ga0395900_0329012_369_854 | 118 |
| 4 | 3300037466 | Ga0395898_0245260 | Ga0395898_0245260_811_1296 | 118 |
| 5 | 3300037471 | Ga0395905_0347648 | Ga0395905_0347648_485_970 | 118 |
| 6 | 3300046660 | Ga0495625_0060515 | Ga0495625_0060515_220_594 | 118 |
| 7 | 3300046665 | Ga0495661_0074687 | Ga0495661_0074687_44_418 | 118 |
| 8 | 3300048088 | Ga0495602_0720530 | Ga0495602_0720530_22_396 | 118 |
| 9 | 3300049460 | Ga0495682_0190387 | Ga0495682_0190387_49_423 | 118 |
| 10 | 3300044658 | Ga0466972_0108906 | Ga0466972_0108906_369_866 | 120 |
| 11 | 3300044693 | Ga0466961_0269813 | Ga0466961_0269813_347_844 | 120 |
| 12 | 3300044735 | Ga0466968_0452414 | Ga0466968_0452414_126_623 | 120 |
| 13 | 3300044765 | Ga0466970_0187859 | Ga0466970_0187859_264_761 | 120 |
| 14 | 3300044842 | Ga0466957_0019001 | Ga0466957_0019001_1172_1666 | 120 |
| 15 | 3300045049 | Ga0466959_0164492 | Ga0466959_0164492_425_922 | 120 |
| 16 | 3300045836 | Ga0466958_0183561 | Ga0466958_0183561_504_1001 | 120 |
| 17 | 3300045976 | Ga0466967_0174395 | Ga0466967_0174395_1092_1589 | 120 |
| 18 | 3300046665 | Ga0495661_0043052 | Ga0495661_0043052_503_1000 | 120 |
| 19 | 3300005536 | Ga0070697_100254164 | Ga0070697_1002541642 | 122 |
| 20 | 3300046507 | Ga0495606_0265903 | Ga0495606_0265903_345_842 | 122 |
| 21 | 3300025909 | Ga0207705_10211804 | Ga0207705_102118042 | 124 |
| 22 | 3300006880 | Ga0075429_101330961 | Ga0075429_1013309612 | 126 |
| 23 | 3300014969 | Ga0157376_11069920 | Ga0157376_110699202 | 126 |
| 24 | 3300005334 | Ga0068869_100179405 | Ga0068869_1001794052 | 128 |
| 25 | 3300005335 | Ga0070666_10241251 | Ga0070666_102412512 | 128 |
| 26 | 3300005338 | Ga0068868_101040511 | Ga0068868_1010405111 | 128 |
| 27 | 3300005365 | Ga0070688_100048473 | Ga0070688_1000484732 | 128 |
| 28 | 3300005456 | Ga0070678_100031236 | Ga0070678_1000312362 | 128 |
| 29 | 3300005459 | Ga0068867_100110734 | Ga0068867_1001107342 | 128 |
| 30 | 3300005617 | Ga0068859_100100382 | Ga0068859_1001003822 | 128 |
| 31 | 3300005718 | Ga0068866_10025543 | Ga0068866_100255432 | 128 |
| 32 | 3300005844 | Ga0068862_100189320 | Ga0068862_1001893201 | 128 |
| 33 | 3300006237 | Ga0097621_100715318 | Ga0097621_1007153181 | 128 |
| 34 | 3300006881 | Ga0068865_100262622 | Ga0068865_1002626222 | 128 |
| 35 | 3300006931 | Ga0097620_100100384 | Ga0097620_1001003842 | 128 |
| 36 | 3300017792 | Ga0163161_10588390 | Ga0163161_105883902 | 128 |
| 37 | 3300025903 | Ga0207680_10348640 | Ga0207680_103486402 | 128 |
| 38 | 3300025926 | Ga0207659_10418885 | Ga0207659_104188851 | 128 |
| 39 | 3300025935 | Ga0207709_10075225 | Ga0207709_100752251 | 128 |
| 40 | 3300025938 | Ga0207704_10798840 | Ga0207704_107988401 | 128 |
| 41 | 3300026089 | Ga0207648_10046412 | Ga0207648_100464123 | 128 |
| 42 | 3300026121 | Ga0207683_10520972 | Ga0207683_105209722 | 128 |
| 43 | 3300028381 | Ga0268264_10019844 | Ga0268264_100198443 | 128 |
| 44 | 3300046528 | Ga0495642_0468128 | Ga0495642_0468128_97_546 | 128 |
| 45 | 3300005618 | Ga0068864_100083232 | Ga0068864_1000832323 | 129 |
| 46 | 3300005841 | Ga0068863_100153974 | Ga0068863_1001539743 | 129 |
| 47 | 3300026095 | Ga0207676_10155485 | Ga0207676_101554852 | 129 |
| 48 | 3300026118 | Ga0207675_100085272 | Ga0207675_1000852722 | 129 |
| 49 | 3300005842 | Ga0068858_100181912 | Ga0068858_1001819122 | 130 |
| 50 | 3300037312 | Ga0395899_0121509 | Ga0395899_0121509_1236_1772 | 130 |
| 51 | 3300037418 | Ga0395900_0286488 | Ga0395900_0286488_113_649 | 130 |
| 52 | 3300037471 | Ga0395905_0573681 | Ga0395905_0573681_131_667 | 130 |
| 53 | 3300038443 | Ga0395901_0675161 | Ga0395901_0675161_378_914 | 130 |
| 54 | 3300049589 | Ga0501073_0729258 | Ga0501073_0729258_26_508 | 130 |
| 55 | 3300049590 | Ga0501074_0249880 | Ga0501074_0249880_60_542 | 130 |
| 56 | 3300049742 | Ga0501080_0054212 | Ga0501080_0054212_2637_3119 | 130 |
| 57 | 3300060353 | Ga0501082_0313310 | Ga0501082_0313310_730_1194 | 130 |
| 58 | 3300005339 | Ga0070660_100498789 | Ga0070660_1004987891 | 131 |
| 59 | 3300005563 | Ga0068855_100748706 | Ga0068855_1007487061 | 131 |
| 60 | 3300005564 | Ga0070664_100391096 | Ga0070664_1003910961 | 131 |
| 61 | 3300005616 | Ga0068852_101225068 | Ga0068852_1012250682 | 131 |
| 62 | 3300013104 | Ga0157370_10010706 | Ga0157370_1001070610 | 131 |
| 63 | 3300013105 | Ga0157369_10758997 | Ga0157369_107589972 | 131 |
| 64 | 3300013307 | Ga0157372_10237871 | Ga0157372_102378712 | 131 |
| 65 | 3300025919 | Ga0207657_10399050 | Ga0207657_103990502 | 131 |
| 66 | 3300025921 | Ga0207652_11408186 | Ga0207652_114081861 | 131 |
| 67 | 3300026142 | Ga0207698_11795013 | Ga0207698_117950131 | 131 |
| 68 | 3300046809 | Ga0495600_0039484 | Ga0495600_0039484_1693_2160 | 131 |
| 69 | 3300048091 | Ga0495626_0041344 | Ga0495626_0041344_651_1121 | 131 |
| 70 | 3300048929 | Ga0496126_0187235 | Ga0496126_0187235_804_1274 | 131 |
| 71 | 3300054114 | Ga0501084_1468346 | Ga0501084_1468346_19_498 | 132 |
| 72 | 3300005445 | Ga0070708_100044519 | Ga0070708_1000445192 | 133 |
| 73 | 3300005445 | Ga0070708_100143747 | Ga0070708_1001437474 | 133 |
| 74 | 3300005467 | Ga0070706_100059014 | Ga0070706_1000590143 | 133 |
| 75 | 3300005467 | Ga0070706_100560864 | Ga0070706_1005608641 | 133 |
| 76 | 3300005468 | Ga0070707_100362489 | Ga0070707_1003624892 | 133 |
| 77 | 3300005471 | Ga0070698_100333961 | Ga0070698_1003339612 | 133 |
| 78 | 3300025910 | Ga0207684_11223657 | Ga0207684_112236571 | 133 |
| 79 | 3300025922 | Ga0207646_10218024 | Ga0207646_102180242 | 133 |
| 80 | 3300005336 | Ga0070680_100116848 | Ga0070680_1001168483 | 134 |
| 81 | 3300005341 | Ga0070691_10287996 | Ga0070691_102879962 | 134 |
| 82 | 3300005444 | Ga0070694_100012071 | Ga0070694_1000120716 | 134 |
| 83 | 3300005471 | Ga0070698_101096864 | Ga0070698_1010968641 | 134 |
| 84 | 3300005843 | Ga0068860_100629064 | Ga0068860_1006290641 | 134 |
| 85 | 3300025917 | Ga0207660_10113048 | Ga0207660_101130482 | 134 |
| 86 | 3300031456 | Ga0307513_10007974 | Ga0307513_100079747 | 134 |
| 87 | 3300031507 | Ga0307509_10004925 | Ga0307509_100049255 | 134 |
| 88 | 3300037418 | Ga0395900_0061088 | Ga0395900_0061088_3179_3670 | 134 |
| 89 | 3300037418 | Ga0395900_0912106 | Ga0395900_0912106_132_623 | 134 |
| 90 | 3300037466 | Ga0395898_0140228 | Ga0395898_0140228_1455_1946 | 134 |
| 91 | 3300037471 | Ga0395905_0120906 | Ga0395905_0120906_777_1268 | 134 |
| 92 | 3300037471 | Ga0395905_0131211 | Ga0395905_0131211_461_952 | 134 |
| 93 | 3300042005 | Ga0439448_0083741 | Ga0439448_0083741_210_701 | 134 |
| 94 | 3300042012 | Ga0439455_0020843 | Ga0439455_0020843_605_1096 | 134 |
| 95 | 3300044656 | Ga0466969_0189687 | Ga0466969_0189687_161_652 | 134 |
| 96 | 3300044683 | Ga0466965_0059795 | Ga0466965_0059795_376_867 | 134 |
| 97 | 3300044693 | Ga0466961_0420101 | Ga0466961_0420101_207_698 | 134 |
| 98 | 3300045049 | Ga0466959_0106308 | Ga0466959_0106308_1082_1573 | 134 |
| 99 | 3300046518 | Ga0495631_0230616 | Ga0495631_0230616_206_676 | 134 |
| 100 | 3300046616 | Ga0495668_0102187 | Ga0495668_0102187_584_1063 | 134 |
| 101 | 3300046616 | Ga0495668_0473743 | Ga0495668_0473743_208_678 | 134 |
| 102 | 3300047469 | Ga0495673_0213161 | Ga0495673_0213161_130_609 | 134 |
| 103 | 3300048091 | Ga0495626_0090685 | Ga0495626_0090685_376_855 | 134 |
| 104 | 3300049571 | Ga0501034_0040006 | Ga0501034_0040006_1101_1580 | 134 |
| 105 | 3300053096 | Ga0500641_0003850 | Ga0500641_0003850_4354_4833 | 134 |
| 106 | iso_pu_bacteria | 2582581280 | 2585153789 | 134 |
| 107 | iso_pu_bacteria | 2582581293 | 2585198002 | 134 |
| 108 | iso_pu_bacteria | 2585428106 | 2587918688 | 134 |
| 109 | iso_pu_bacteria | 2643221552 | 2643778334 | 134 |
| 110 | iso_pu_bacteria | 2643221583 | 2643925471 | 134 |
| 111 | iso_pu_bacteria | 2643221584 | 2643927406 | 134 |
| 112 | iso_pu_bacteria | 2643221640 | 2644225334 | 134 |
| 113 | iso_pu_bacteria | 2643221642 | 2644232642 | 134 |
| 114 | iso_pu_bacteria | 2818991435 | 2819535819 | 134 |
| 115 | iso_pu_bacteria | 2818991454 | 2819646051 | 134 |
| 116 | iso_pu_bacteria | 2857504554 | 2857507790 | 134 |
| 117 | iso_pu_bacteria | 2928531327 | 2928535624 | 134 |
| 118 | 3300020610 | Ga0154015_1582689 | Ga0154015_15826891 | 135 |
| 119 | 3300021361 | Ga0213872_10159972 | Ga0213872_101599722 | 135 |
| 120 | 3300025941 | Ga0207711_11414388 | Ga0207711_114143881 | 135 |
| 121 | 3300048911 | Ga0496108_0091387 | Ga0496108_0091387_1024_1494 | 135 |
| 122 | 3300048917 | Ga0496114_0012808 | Ga0496114_0012808_5741_6214 | 135 |
| 123 | 3300049742 | Ga0501080_0733510 | Ga0501080_0733510_123_593 | 135 |
| 124 | 3300049758 | Ga0501241_025048 | Ga0501241_025048_389_862 | 135 |
| 125 | iso_pu_bacteria | 2515154189 | 2516023484 | 135 |
| 126 | iso_pu_bacteria | 2588253510 | 2588290921 | 135 |
| 127 | iso_pu_bacteria | 2643221556 | 2643801247 | 135 |
| 128 | iso_pu_bacteria | 2643221592 | 2643972138 | 135 |
| 129 | iso_pu_bacteria | 2643221625 | 2644142337 | 135 |
| 130 | iso_pu_bacteria | 2643221648 | 2644276031 | 135 |
| 131 | iso_pu_bacteria | 2643221684 | 2644471665 | 135 |
| 132 | iso_pu_bacteria | 2883087390 | 2883093429 | 135 |
| 133 | iso_pu_bacteria | 2904424332 | 2904425137 | 135 |
| 134 | iso_pu_bacteria | 2912963787 | 2912968802 | 135 |
| 135 | iso_pu_bacteria | 2939651529 | 2939654137 | 135 |
| 136 | iso_pu_bacteria | 639633007 | 639789064 | 135 |
| 137 | iso_pu_bacteria | 643348564 | 643600731 | 135 |
| 138 | 3300006358 | Ga0068871_100251431 | Ga0068871_1002514312 | 136 |
| 139 | 3300031456 | Ga0307513_10082794 | Ga0307513_100827942 | 136 |
| 140 | 3300031456 | Ga0307513_10720466 | Ga0307513_107204661 | 136 |
| 141 | 3300046460 | Ga0495638_0004077 | Ga0495638_0004077_5638_6114 | 136 |
| 142 | 3300046660 | Ga0495625_0213719 | Ga0495625_0213719_16_492 | 136 |
| 143 | 3300047320 | Ga0495672_0016868 | Ga0495672_0016868_2980_3456 | 136 |
| 144 | 3300050516 | nmdc:mga0sz30_133863_c1 | nmdc:mga0sz30_133863_c1_472_948 | 136 |
| 145 | 3300053088 | Ga0500644_0400895 | Ga0500644_0400895_42_518 | 136 |
| 146 | 3300053090 | Ga0500646_0209133 | Ga0500646_0209133_103_579 | 136 |
| 147 | 3300053130 | Ga0500642_0087133 | Ga0500642_0087133_729_1205 | 136 |
| 148 | 3300004801 | Ga0058860_11538292 | Ga0058860_115382922 | 137 |
| 149 | 3300005343 | Ga0070687_100723982 | Ga0070687_1007239821 | 137 |
| 150 | 3300005548 | Ga0070665_100027839 | Ga0070665_1000278392 | 137 |
| 151 | 3300005617 | Ga0068859_100007356 | Ga0068859_1000073565 | 137 |
| 152 | 3300005618 | Ga0068864_100070433 | Ga0068864_1000704331 | 137 |
| 153 | 3300005841 | Ga0068863_100409645 | Ga0068863_1004096452 | 137 |
| 154 | 3300005841 | Ga0068863_100930611 | Ga0068863_1009306111 | 137 |
| 155 | 3300005842 | Ga0068858_100896103 | Ga0068858_1008961031 | 137 |
| 156 | 3300006931 | Ga0097620_100007356 | Ga0097620_1000073565 | 137 |
| 157 | 3300009101 | Ga0105247_10127208 | Ga0105247_101272082 | 137 |
| 158 | 3300009176 | Ga0105242_10789854 | Ga0105242_107898541 | 137 |
| 159 | 3300009177 | Ga0105248_10983521 | Ga0105248_109835212 | 137 |
| 160 | 3300014325 | Ga0163163_10000226 | Ga0163163_100002268 | 137 |
| 161 | 3300025900 | Ga0207710_10091215 | Ga0207710_100912152 | 137 |
| 162 | 3300025941 | Ga0207711_10877436 | Ga0207711_108774362 | 137 |
| 163 | 3300026035 | Ga0207703_10652173 | Ga0207703_106521731 | 137 |
| 164 | 3300026088 | Ga0207641_10364067 | Ga0207641_103640672 | 137 |
| 165 | 3300026116 | Ga0207674_11363754 | Ga0207674_113637541 | 137 |
| 166 | 3300028381 | Ga0268264_10891426 | Ga0268264_108914262 | 137 |
| 167 | 3300031247 | Ga0265340_10010391 | Ga0265340_100103912 | 137 |
| 168 | 3300031728 | Ga0316578_10100083 | Ga0316578_101000832 | 137 |
| 169 | 3300031728 | Ga0316578_10200339 | Ga0316578_102003392 | 137 |
| 170 | 3300032139 | Ga0316580_10003872 | Ga0316580_100038723 | 137 |
| 171 | 3300032168 | Ga0316593_10000488 | Ga0316593_100004884 | 137 |
| 172 | 3300035398 | Ga0316574_0007153 | Ga0316574_0007153_5173_5655 | 137 |
| 173 | 3300035398 | Ga0316574_0015422 | Ga0316574_0015422_2751_3266 | 137 |
| 174 | 3300036647 | Ga0316582_0382842 | Ga0316582_0382842_13_528 | 137 |
| 175 | 3300036712 | Ga0316584_0055392 | Ga0316584_0055392_826_1308 | 137 |
| 176 | 3300046454 | Ga0495592_0003568 | Ga0495592_0003568_753_1244 | 137 |
| 177 | 3300046455 | Ga0495603_0040025 | Ga0495603_0040025_903_1394 | 137 |
| 178 | 3300046458 | Ga0495591_000806 | Ga0495591_000806_17995_18486 | 137 |
| 179 | 3300046459 | Ga0495629_0008971 | Ga0495629_0008971_6362_6853 | 137 |
| 180 | 3300046460 | Ga0495638_0506840 | Ga0495638_0506840_18_509 | 137 |
| 181 | 3300046461 | Ga0495641_0076252 | Ga0495641_0076252_537_1028 | 137 |
| 182 | 3300046462 | Ga0495651_0016516 | Ga0495651_0016516_3955_4446 | 137 |
| 183 | 3300046463 | Ga0495653_0024886 | Ga0495653_0024886_3584_4075 | 137 |
| 184 | 3300046474 | Ga0495605_0159260 | Ga0495605_0159260_481_972 | 137 |
| 185 | 3300046476 | Ga0495662_0017902 | Ga0495662_0017902_1476_1967 | 137 |
| 186 | 3300046477 | Ga0495664_0016662 | Ga0495664_0016662_2995_3486 | 137 |
| 187 | 3300046499 | Ga0495594_0223823 | Ga0495594_0223823_130_621 | 137 |
| 188 | 3300046500 | Ga0495596_0044388 | Ga0495596_0044388_817_1308 | 137 |
| 189 | 3300046511 | Ga0495608_0141134 | Ga0495608_0141134_584_1075 | 137 |
| 190 | 3300046514 | Ga0495618_0006609 | Ga0495618_0006609_1649_2140 | 137 |
| 191 | 3300046516 | Ga0495628_0119613 | Ga0495628_0119613_258_749 | 137 |
| 192 | 3300046517 | Ga0495630_0008810 | Ga0495630_0008810_463_954 | 137 |
| 193 | 3300046524 | Ga0495648_0089242 | Ga0495648_0089242_615_1106 | 137 |
| 194 | 3300046531 | Ga0495665_0000684 | Ga0495665_0000684_11314_11805 | 137 |
| 195 | 3300046536 | Ga0495587_0000623 | Ga0495587_0000623_7938_8429 | 137 |
| 196 | 3300046543 | Ga0495645_0051268 | Ga0495645_0051268_1234_1725 | 137 |
| 197 | 3300046559 | Ga0495667_0036463 | Ga0495667_0036463_1333_1824 | 137 |
| 198 | 3300046642 | Ga0495634_0261936 | Ga0495634_0261936_457_948 | 137 |
| 199 | 3300046648 | Ga0495611_0052761 | Ga0495611_0052761_357_848 | 137 |
| 200 | 3300046663 | Ga0495635_0015141 | Ga0495635_0015141_1580_2071 | 137 |
| 201 | 3300046665 | Ga0495661_0003818 | Ga0495661_0003818_9242_9733 | 137 |
| 202 | 3300046674 | Ga0495588_0268636 | Ga0495588_0268636_257_748 | 137 |
| 203 | 3300046679 | Ga0495623_0019699 | Ga0495623_0019699_677_1168 | 137 |
| 204 | 3300046680 | Ga0495646_0055206 | Ga0495646_0055206_258_749 | 137 |
| 205 | 3300046689 | Ga0495613_0011548 | Ga0495613_0011548_3194_3685 | 137 |
| 206 | 3300046690 | Ga0495624_0022029 | Ga0495624_0022029_1466_1957 | 137 |
| 207 | 3300046809 | Ga0495600_0001426 | Ga0495600_0001426_4500_4991 | 137 |
| 208 | 3300047315 | Ga0495581_0010566 | Ga0495581_0010566_4258_4749 | 137 |
| 209 | 3300047321 | Ga0495676_0010249 | Ga0495676_0010249_1580_2071 | 137 |
| 210 | 3300047322 | Ga0495680_0335970 | Ga0495680_0335970_107_598 | 137 |
| 211 | 3300047323 | Ga0495683_0016611 | Ga0495683_0016611_235_726 | 137 |
| 212 | 3300047444 | Ga0495675_0009494 | Ga0495675_0009494_1832_2323 | 137 |
| 213 | 3300047446 | Ga0495679_000528 | Ga0495679_000528_107_598 | 137 |
| 214 | 3300047469 | Ga0495673_0008048 | Ga0495673_0008048_2540_3031 | 137 |
| 215 | 3300047673 | Ga0495593_0010047 | Ga0495593_0010047_1461_1952 | 137 |
| 216 | 3300048088 | Ga0495602_0033683 | Ga0495602_0033683_1117_1608 | 137 |
| 217 | 3300048089 | Ga0495614_0001749 | Ga0495614_0001749_1530_2021 | 137 |
| 218 | 3300048905 | Ga0496102_0207473 | Ga0496102_0207473_594_1085 | 137 |
| 219 | 3300048912 | Ga0496109_0144539 | Ga0496109_0144539_1164_1637 | 137 |
| 220 | 3300048913 | Ga0496110_0185911 | Ga0496110_0185911_15_488 | 137 |
| 221 | 3300049128 | Ga0501308_015218 | Ga0501308_015218_241_732 | 137 |
| 222 | 3300049460 | Ga0495682_0025626 | Ga0495682_0025626_1637_2128 | 137 |
| 223 | 3300003322 | rootL2_10093421 | rootL2_100934215 | 138 |
| 224 | 3300003322 | rootL2_10128998 | rootL2_101289982 | 138 |
| 225 | 3300003794 | Ga0055531_10000557 | Ga0055531_1000055721 | 138 |
| 226 | 3300005262 | Ga0065165_1000615 | Ga0065165_100061544 | 138 |
| 227 | 3300005336 | Ga0070680_100587637 | Ga0070680_1005876372 | 138 |
| 228 | 3300005336 | Ga0070680_100807117 | Ga0070680_1008071171 | 138 |
| 229 | 3300005354 | Ga0070675_100450676 | Ga0070675_1004506762 | 138 |
| 230 | 3300005435 | Ga0070714_100546863 | Ga0070714_1005468632 | 138 |
| 231 | 3300005456 | Ga0070678_100091416 | Ga0070678_1000914163 | 138 |
| 232 | 3300005456 | Ga0070678_100165666 | Ga0070678_1001656662 | 138 |
| 233 | 3300005530 | Ga0070679_100171998 | Ga0070679_1001719982 | 138 |
| 234 | 3300005530 | Ga0070679_100219890 | Ga0070679_1002198902 | 138 |
| 235 | 3300005543 | Ga0070672_100331843 | Ga0070672_1003318432 | 138 |
| 236 | 3300005563 | Ga0068855_100135254 | Ga0068855_1001352542 | 138 |
| 237 | 3300005563 | Ga0068855_101143462 | Ga0068855_1011434622 | 138 |
| 238 | 3300005578 | Ga0068854_100610014 | Ga0068854_1006100142 | 138 |
| 239 | 3300005614 | Ga0068856_100451997 | Ga0068856_1004519972 | 138 |
| 240 | 3300005616 | Ga0068852_100052884 | Ga0068852_1000528843 | 138 |
| 241 | 3300005834 | Ga0068851_10083545 | Ga0068851_100835453 | 138 |
| 242 | 3300006051 | Ga0075364_10501552 | Ga0075364_105015522 | 138 |
| 243 | 3300006195 | Ga0075366_10122003 | Ga0075366_101220031 | 138 |
| 244 | 3300006353 | Ga0075370_10033556 | Ga0075370_100335563 | 138 |
| 245 | 3300006353 | Ga0075370_10838997 | Ga0075370_108389971 | 138 |
| 246 | 3300006358 | Ga0068871_100432399 | Ga0068871_1004323992 | 138 |
| 247 | 3300009011 | Ga0105251_10023081 | Ga0105251_100230813 | 138 |
| 248 | 3300009011 | Ga0105251_10063868 | Ga0105251_100638683 | 138 |
| 249 | 3300009093 | Ga0105240_10159674 | Ga0105240_101596743 | 138 |
| 250 | 3300009101 | Ga0105247_11075912 | Ga0105247_110759121 | 138 |
| 251 | 3300009148 | Ga0105243_10772248 | Ga0105243_107722482 | 138 |
| 252 | 3300009177 | Ga0105248_10045882 | Ga0105248_100458823 | 138 |
| 253 | 3300012512 | Ga0157327_1023884 | Ga0157327_10238841 | 138 |
| 254 | 3300013105 | Ga0157369_10502363 | Ga0157369_105023632 | 138 |
| 255 | 3300013296 | Ga0157374_10258764 | Ga0157374_102587642 | 138 |
| 256 | 3300013297 | Ga0157378_10205693 | Ga0157378_102056932 | 138 |
| 257 | 3300013306 | Ga0163162_10001320 | Ga0163162_1000132017 | 138 |
| 258 | 3300013306 | Ga0163162_10022603 | Ga0163162_100226037 | 138 |
| 259 | 3300013307 | Ga0157372_10195755 | Ga0157372_101957552 | 138 |
| 260 | 3300013308 | Ga0157375_10013360 | Ga0157375_100133602 | 138 |
| 261 | 3300013308 | Ga0157375_10161954 | Ga0157375_101619542 | 138 |
| 262 | 3300014326 | Ga0157380_10078260 | Ga0157380_100782602 | 138 |
| 263 | 3300014326 | Ga0157380_10454051 | Ga0157380_104540512 | 138 |
| 264 | 3300014969 | Ga0157376_10281662 | Ga0157376_102816621 | 138 |
| 265 | 3300017792 | Ga0163161_10103296 | Ga0163161_101032962 | 138 |
| 266 | 3300025291 | Ga0209675_1047707 | Ga0209675_10477072 | 138 |
| 267 | 3300025295 | Ga0209564_1000818 | Ga0209564_100081810 | 138 |
| 268 | 3300025295 | Ga0209564_1005525 | Ga0209564_10055251 | 138 |
| 269 | 3300025297 | Ga0209758_1000246 | Ga0209758_10002467 | 138 |
| 270 | 3300025298 | Ga0209050_1018180 | Ga0209050_10181802 | 138 |
| 271 | 3300025299 | Ga0209256_1014547 | Ga0209256_10145473 | 138 |
| 272 | 3300025304 | Ga0209257_1000259 | Ga0209257_100025916 | 138 |
| 273 | 3300025321 | Ga0207656_10103245 | Ga0207656_101032452 | 138 |
| 274 | 3300025735 | Ga0207713_1035062 | Ga0207713_10350622 | 138 |
| 275 | 3300025913 | Ga0207695_10367320 | Ga0207695_103673203 | 138 |
| 276 | 3300025917 | Ga0207660_10647779 | Ga0207660_106477792 | 138 |
| 277 | 3300025920 | Ga0207649_10355808 | Ga0207649_103558082 | 138 |
| 278 | 3300025929 | Ga0207664_10466076 | Ga0207664_104660762 | 138 |
| 279 | 3300025932 | Ga0207690_10581868 | Ga0207690_105818682 | 138 |
| 280 | 3300025938 | Ga0207704_10153059 | Ga0207704_101530592 | 138 |
| 281 | 3300025939 | Ga0207665_10099209 | Ga0207665_100992091 | 138 |
| 282 | 3300025940 | Ga0207691_10357168 | Ga0207691_103571682 | 138 |
| 283 | 3300025949 | Ga0207667_10107881 | Ga0207667_101078812 | 138 |
| 284 | 3300025949 | Ga0207667_10599363 | Ga0207667_105993631 | 138 |
| 285 | 3300025972 | Ga0207668_10110183 | Ga0207668_101101832 | 138 |
| 286 | 3300025981 | Ga0207640_10307673 | Ga0207640_103076732 | 138 |
| 287 | 3300026078 | Ga0207702_10069213 | Ga0207702_100692134 | 138 |
| 288 | 3300026088 | Ga0207641_10666483 | Ga0207641_106664832 | 138 |
| 289 | 3300026095 | Ga0207676_10110448 | Ga0207676_101104482 | 138 |
| 290 | 3300026095 | Ga0207676_11867293 | Ga0207676_118672931 | 138 |
| 291 | 3300026121 | Ga0207683_10036996 | Ga0207683_100369964 | 138 |
| 292 | 3300026142 | Ga0207698_10180921 | Ga0207698_101809212 | 138 |
| 293 | 3300035691 | Ga0373931_0644463 | Ga0373931_0644463_127_606 | 138 |
| 294 | 3300036534 | Ga0310109_049593 | Ga0310109_049593_40_522 | 138 |
| 295 | 3300042000 | Ga0439437_024272 | Ga0439437_024272_251_733 | 138 |
| 296 | 3300042127 | Ga0450890_034873 | Ga0450890_034873_50_532 | 138 |
| 297 | 3300042436 | Ga0439435_0027498 | Ga0439435_0027498_171_653 | 138 |
| 298 | 3300042438 | Ga0439459_0002620 | Ga0439459_0002620_1760_2242 | 138 |
| 299 | 3300046458 | Ga0495591_137425 | Ga0495591_137425_34_522 | 138 |
| 300 | 3300046460 | Ga0495638_0001574 | Ga0495638_0001574_19920_20402 | 138 |
| 301 | 3300046460 | Ga0495638_0011608 | Ga0495638_0011608_5451_5939 | 138 |
| 302 | 3300046474 | Ga0495605_0003916 | Ga0495605_0003916_7954_8442 | 138 |
| 303 | 3300046501 | Ga0495607_0037403 | Ga0495607_0037403_127_609 | 138 |
| 304 | 3300046507 | Ga0495606_0074761 | Ga0495606_0074761_1250_1738 | 138 |
| 305 | 3300046512 | Ga0495610_0092869 | Ga0495610_0092869_299_781 | 138 |
| 306 | 3300046513 | Ga0495616_0000031 | Ga0495616_0000031_58778_59260 | 138 |
| 307 | 3300046513 | Ga0495616_0193990 | Ga0495616_0193990_136_624 | 138 |
| 308 | 3300046516 | Ga0495628_0110360 | Ga0495628_0110360_1471_1962 | 138 |
| 309 | 3300046519 | Ga0495632_0011423 | Ga0495632_0011423_1518_2000 | 138 |
| 310 | 3300046522 | Ga0495643_0365649 | Ga0495643_0365649_115_597 | 138 |
| 311 | 3300046523 | Ga0495644_0082696 | Ga0495644_0082696_426_914 | 138 |
| 312 | 3300046528 | Ga0495642_0131993 | Ga0495642_0131993_374_862 | 138 |
| 313 | 3300046530 | Ga0495654_0060996 | Ga0495654_0060996_666_1148 | 138 |
| 314 | 3300046542 | Ga0495597_0039268 | Ga0495597_0039268_1281_1769 | 138 |
| 315 | 3300046559 | Ga0495667_0216758 | Ga0495667_0216758_256_747 | 138 |
| 316 | 3300046616 | Ga0495668_0008200 | Ga0495668_0008200_2640_3122 | 138 |
| 317 | 3300046616 | Ga0495668_0043959 | Ga0495668_0043959_895_1377 | 138 |
| 318 | 3300046660 | Ga0495625_0068594 | Ga0495625_0068594_1360_1842 | 138 |
| 319 | 3300046684 | Ga0495669_0030615 | Ga0495669_0030615_1611_2099 | 138 |
| 320 | 3300046684 | Ga0495669_0121767 | Ga0495669_0121767_265_747 | 138 |
| 321 | 3300046691 | Ga0495670_0004408 | Ga0495670_0004408_1134_1622 | 138 |
| 322 | 3300046691 | Ga0495670_0280063 | Ga0495670_0280063_31_513 | 138 |
| 323 | 3300046794 | Ga0495589_0002595 | Ga0495589_0002595_9168_9656 | 138 |
| 324 | 3300046794 | Ga0495589_0049937 | Ga0495589_0049937_177_668 | 138 |
| 325 | 3300046809 | Ga0495600_0676955 | Ga0495600_0676955_85_576 | 138 |
| 326 | 3300046810 | Ga0495660_0002945 | Ga0495660_0002945_9288_9770 | 138 |
| 327 | 3300046810 | Ga0495660_0037357 | Ga0495660_0037357_2076_2564 | 138 |
| 328 | 3300047470 | Ga0495681_0027734 | Ga0495681_0027734_461_949 | 138 |
| 329 | 3300047470 | Ga0495681_0028017 | Ga0495681_0028017_17_499 | 138 |
| 330 | 3300047472 | Ga0495686_0000080 | Ga0495686_0000080_42970_43461 | 138 |
| 331 | 3300048091 | Ga0495626_0026687 | Ga0495626_0026687_565_1053 | 138 |
| 332 | 3300048903 | Ga0496100_0834814 | Ga0496100_0834814_210_698 | 138 |
| 333 | 3300048904 | Ga0496101_0183918 | Ga0496101_0183918_664_1152 | 138 |
| 334 | 3300048904 | Ga0496101_0224775 | Ga0496101_0224775_441_923 | 138 |
| 335 | 3300048905 | Ga0496102_0354021 | Ga0496102_0354021_512_1000 | 138 |
| 336 | 3300048907 | Ga0496104_0513625 | Ga0496104_0513625_156_644 | 138 |
| 337 | 3300048908 | Ga0496105_0101656 | Ga0496105_0101656_1366_1854 | 138 |
| 338 | 3300048910 | Ga0496107_0025214 | Ga0496107_0025214_3316_3804 | 138 |
| 339 | 3300048912 | Ga0496109_0185128 | Ga0496109_0185128_647_1129 | 138 |
| 340 | 3300048915 | Ga0496112_0202447 | Ga0496112_0202447_135_617 | 138 |
| 341 | 3300048917 | Ga0496114_0275663 | Ga0496114_0275663_13_495 | 138 |
| 342 | 3300048918 | Ga0496115_0277947 | Ga0496115_0277947_526_1014 | 138 |
| 343 | 3300048921 | Ga0496118_0202237 | Ga0496118_0202237_395_883 | 138 |
| 344 | 3300048924 | Ga0496121_0419662 | Ga0496121_0419662_147_635 | 138 |
| 345 | 3300048928 | Ga0496125_0010896 | Ga0496125_0010896_2597_3079 | 138 |
| 346 | 3300048929 | Ga0496126_0000980 | Ga0496126_0000980_13405_13887 | 138 |
| 347 | 3300050492 | nmdc:mga0yw44_42787_c1 | nmdc:mga0yw44_42787_c1_2206_2688 | 138 |
| 348 | 3300050493 | nmdc:mga0k408_88087_c1 | nmdc:mga0k408_88087_c1_156_638 | 138 |
| 349 | 3300050496 | nmdc:mga07m45_12402_c1 | nmdc:mga07m45_12402_c1_221_703 | 138 |
| 350 | 3300053086 | Ga0500578_0249850 | Ga0500578_0249850_209_691 | 138 |
| 351 | 3300053100 | Ga0500660_176652 | Ga0500660_176652_170_652 | 138 |
| 352 | 3300053136 | Ga0500559_0193570 | Ga0500559_0193570_149_631 | 138 |
| 353 | 3300053156 | Ga0500622_0020392 | Ga0500622_0020392_104_586 | 138 |
| 354 | 3300053731 | Ga0500609_001115 | Ga0500609_001115_860_1342 | 138 |
| 355 | 3300002773 | JGI25152J39213_1002469 | JGI25152J39213_10024695 | 139 |
| 356 | 3300002774 | JGI25150J39212_1002495 | JGI25150J39212_10024953 | 139 |
| 357 | 3300003215 | JGI25153J46596_10005824 | JGI25153J46596_100058243 | 139 |
| 358 | 3300003323 | rootH1_10132987 | rootH1_101329872 | 139 |
| 359 | 3300003771 | Ga0055526_1005023 | Ga0055526_10050237 | 139 |
| 360 | 3300003771 | Ga0055526_1005529 | Ga0055526_10055294 | 139 |
| 361 | 3300003773 | Ga0055537_1007066 | Ga0055537_10070663 | 139 |
| 362 | 3300003775 | Ga0055524_1000182 | Ga0055524_100018211 | 139 |
| 363 | 3300003775 | Ga0055524_1006279 | Ga0055524_10062793 | 139 |
| 364 | 3300003775 | Ga0055524_1082106 | Ga0055524_10821061 | 139 |
| 365 | 3300003784 | Ga0055534_1042626 | Ga0055534_10426261 | 139 |
| 366 | 3300003791 | Ga0055530_10000037 | Ga0055530_1000003738 | 139 |
| 367 | 3300003791 | Ga0055530_10012424 | Ga0055530_100124243 | 139 |
| 368 | 3300003791 | Ga0055530_10043783 | Ga0055530_100437831 | 139 |
| 369 | 3300003792 | Ga0055540_1003124 | Ga0055540_10031242 | 139 |
| 370 | 3300003794 | Ga0055531_10043071 | Ga0055531_100430711 | 139 |
| 371 | 3300004785 | Ga0058858_1158617 | Ga0058858_11586172 | 139 |
| 372 | 3300004798 | Ga0058859_10842610 | Ga0058859_108426101 | 139 |
| 373 | 3300004799 | Ga0058863_10022113 | Ga0058863_100221131 | 139 |
| 374 | 3300004799 | Ga0058863_11830666 | Ga0058863_118306663 | 139 |
| 375 | 3300004800 | Ga0058861_10021452 | Ga0058861_100214521 | 139 |
| 376 | 3300004800 | Ga0058861_11921876 | Ga0058861_119218763 | 139 |
| 377 | 3300004801 | Ga0058860_11397319 | Ga0058860_113973191 | 139 |
| 378 | 3300004801 | Ga0058860_12134235 | Ga0058860_121342351 | 139 |
| 379 | 3300004803 | Ga0058862_10008156 | Ga0058862_100081561 | 139 |
| 380 | 3300004803 | Ga0058862_12692344 | Ga0058862_126923443 | 139 |
| 381 | 3300004803 | Ga0058862_12871773 | Ga0058862_128717732 | 139 |
| 382 | 3300005327 | Ga0070658_10105728 | Ga0070658_101057283 | 139 |
| 383 | 3300005329 | Ga0070683_100071547 | Ga0070683_1000715473 | 139 |
| 384 | 3300005336 | Ga0070680_100002662 | Ga0070680_1000026627 | 139 |
| 385 | 3300005336 | Ga0070680_100006366 | Ga0070680_1000063666 | 139 |
| 386 | 3300005336 | Ga0070680_100224391 | Ga0070680_1002243913 | 139 |
| 387 | 3300005353 | Ga0070669_100133338 | Ga0070669_1001333381 | 139 |
| 388 | 3300005356 | Ga0070674_100231661 | Ga0070674_1002316612 | 139 |
| 389 | 3300005367 | Ga0070667_100197769 | Ga0070667_1001977691 | 139 |
| 390 | 3300005434 | Ga0070709_10198086 | Ga0070709_101980862 | 139 |
| 391 | 3300005456 | Ga0070678_100256737 | Ga0070678_1002567372 | 139 |
| 392 | 3300005457 | Ga0070662_100264234 | Ga0070662_1002642342 | 139 |
| 393 | 3300005458 | Ga0070681_10001907 | Ga0070681_1000190712 | 139 |
| 394 | 3300005458 | Ga0070681_10193820 | Ga0070681_101938202 | 139 |
| 395 | 3300005466 | Ga0070685_10311616 | Ga0070685_103116161 | 139 |
| 396 | 3300005530 | Ga0070679_100001193 | Ga0070679_10000119315 | 139 |
| 397 | 3300005530 | Ga0070679_100001971 | Ga0070679_1000019719 | 139 |
| 398 | 3300005535 | Ga0070684_100083380 | Ga0070684_1000833802 | 139 |
| 399 | 3300005536 | Ga0070697_101475259 | Ga0070697_1014752591 | 139 |
| 400 | 3300005563 | Ga0068855_100324882 | Ga0068855_1003248822 | 139 |
| 401 | 3300005841 | Ga0068863_100088411 | Ga0068863_1000884112 | 139 |
| 402 | 3300005841 | Ga0068863_100373581 | Ga0068863_1003735811 | 139 |
| 403 | 3300005981 | Ga0081538_10069435 | Ga0081538_100694351 | 139 |
| 404 | 3300006173 | Ga0070716_100549068 | Ga0070716_1005490682 | 139 |
| 405 | 3300006844 | Ga0075428_100022695 | Ga0075428_1000226953 | 139 |
| 406 | 3300006846 | Ga0075430_100015375 | Ga0075430_1000153753 | 139 |
| 407 | 3300006847 | Ga0075431_100000941 | Ga0075431_10000094119 | 139 |
| 408 | 3300006852 | Ga0075433_11423449 | Ga0075433_114234491 | 139 |
| 409 | 3300006880 | Ga0075429_100024405 | Ga0075429_1000244053 | 139 |
| 410 | 3300006946 | Ga0079104_1000333 | Ga0079104_100033353 | 139 |
| 411 | 3300009036 | Ga0105244_10000079 | Ga0105244_1000007962 | 139 |
| 412 | 3300009094 | Ga0111539_10836118 | Ga0111539_108361181 | 139 |
| 413 | 3300009147 | Ga0114129_10131009 | Ga0114129_101310092 | 139 |
| 414 | 3300009148 | Ga0105243_11258507 | Ga0105243_112585071 | 139 |
| 415 | 3300009177 | Ga0105248_10225457 | Ga0105248_102254572 | 139 |
| 416 | 3300009551 | Ga0105238_10680362 | Ga0105238_106803622 | 139 |
| 417 | 3300013306 | Ga0163162_10088294 | Ga0163162_100882943 | 139 |
| 418 | 3300013306 | Ga0163162_11681545 | Ga0163162_116815451 | 139 |
| 419 | 3300013307 | Ga0157372_10020425 | Ga0157372_100204254 | 139 |
| 420 | 3300013307 | Ga0157372_10757280 | Ga0157372_107572802 | 139 |
| 421 | 3300020070 | Ga0206356_11608922 | Ga0206356_116089222 | 139 |
| 422 | 3300021384 | Ga0213876_10000155 | Ga0213876_1000015533 | 139 |
| 423 | 3300021388 | Ga0213875_10116180 | Ga0213875_101161801 | 139 |
| 424 | 3300025245 | Ga0207425_1000452 | Ga0207425_100045217 | 139 |
| 425 | 3300025258 | Ga0209129_1000027 | Ga0209129_10000275 | 139 |
| 426 | 3300025263 | Ga0209565_1004369 | Ga0209565_10043692 | 139 |
| 427 | 3300025263 | Ga0209565_1011078 | Ga0209565_10110782 | 139 |
| 428 | 3300025273 | Ga0209673_1011233 | Ga0209673_10112335 | 139 |
| 429 | 3300025273 | Ga0209673_1020665 | Ga0209673_10206653 | 139 |
| 430 | 3300025291 | Ga0209675_1006973 | Ga0209675_10069735 | 139 |
| 431 | 3300025291 | Ga0209675_1018926 | Ga0209675_10189261 | 139 |
| 432 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046348 | 139 |
| 433 | 3300025295 | Ga0209564_1000142 | Ga0209564_100014270 | 139 |
| 434 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052115 | 139 |
| 435 | 3300025298 | Ga0209050_1000058 | Ga0209050_1000058259 | 139 |
| 436 | 3300025298 | Ga0209050_1001069 | Ga0209050_100106918 | 139 |
| 437 | 3300025298 | Ga0209050_1014421 | Ga0209050_10144214 | 139 |
| 438 | 3300025299 | Ga0209256_1000024 | Ga0209256_1000024392 | 139 |
| 439 | 3300025299 | Ga0209256_1001716 | Ga0209256_10017165 | 139 |
| 440 | 3300025299 | Ga0209256_1028527 | Ga0209256_10285272 | 139 |
| 441 | 3300025303 | Ga0209051_1000155 | Ga0209051_100015554 | 139 |
| 442 | 3300025304 | Ga0209257_1000236 | Ga0209257_100023654 | 139 |
| 443 | 3300025728 | Ga0207655_1000188 | Ga0207655_100018889 | 139 |
| 444 | 3300025906 | Ga0207699_10541724 | Ga0207699_105417242 | 139 |
| 445 | 3300025908 | Ga0207643_10378225 | Ga0207643_103782252 | 139 |
| 446 | 3300025909 | Ga0207705_10080606 | Ga0207705_100806062 | 139 |
| 447 | 3300025912 | Ga0207707_10000732 | Ga0207707_1000073223 | 139 |
| 448 | 3300025912 | Ga0207707_10067747 | Ga0207707_100677473 | 139 |
| 449 | 3300025916 | Ga0207663_10574231 | Ga0207663_105742311 | 139 |
| 450 | 3300025917 | Ga0207660_10014120 | Ga0207660_100141205 | 139 |
| 451 | 3300025917 | Ga0207660_10032840 | Ga0207660_100328404 | 139 |
| 452 | 3300025921 | Ga0207652_10022573 | Ga0207652_100225735 | 139 |
| 453 | 3300025921 | Ga0207652_10051639 | Ga0207652_100516392 | 139 |
| 454 | 3300025923 | Ga0207681_10209874 | Ga0207681_102098742 | 139 |
| 455 | 3300025924 | Ga0207694_11156925 | Ga0207694_111569251 | 139 |
| 456 | 3300025926 | Ga0207659_10446840 | Ga0207659_104468402 | 139 |
| 457 | 3300025933 | Ga0207706_10313860 | Ga0207706_103138602 | 139 |
| 458 | 3300025938 | Ga0207704_10473609 | Ga0207704_104736092 | 139 |
| 459 | 3300025938 | Ga0207704_10532023 | Ga0207704_105320231 | 139 |
| 460 | 3300025939 | Ga0207665_10036171 | Ga0207665_100361711 | 139 |
| 461 | 3300025940 | Ga0207691_10003268 | Ga0207691_100032686 | 139 |
| 462 | 3300025941 | Ga0207711_10021013 | Ga0207711_100210135 | 139 |
| 463 | 3300025944 | Ga0207661_10019114 | Ga0207661_100191144 | 139 |
| 464 | 3300025960 | Ga0207651_10360502 | Ga0207651_103605022 | 139 |
| 465 | 3300026041 | Ga0207639_10216025 | Ga0207639_102160252 | 139 |
| 466 | 3300026088 | Ga0207641_10024381 | Ga0207641_100243812 | 139 |
| 467 | 3300026088 | Ga0207641_10314902 | Ga0207641_103149021 | 139 |
| 468 | 3300026089 | Ga0207648_10558719 | Ga0207648_105587192 | 139 |
| 469 | 3300026116 | Ga0207674_10233765 | Ga0207674_102337654 | 139 |
| 470 | 3300027111 | Ga0209281_1000322 | Ga0209281_100032252 | 139 |
| 471 | 3300028380 | Ga0268265_10639436 | Ga0268265_106394361 | 139 |
| 472 | 3300028577 | Ga0265318_10318036 | Ga0265318_103180361 | 139 |
| 473 | 3300031456 | Ga0307513_10075226 | Ga0307513_100752263 | 139 |
| 474 | 3300031548 | Ga0307408_100035841 | Ga0307408_1000358415 | 139 |
| 475 | 3300031665 | Ga0316575_10002218 | Ga0316575_100022185 | 139 |
| 476 | 3300031712 | Ga0265342_10497903 | Ga0265342_104979031 | 139 |
| 477 | 3300031727 | Ga0316576_10007196 | Ga0316576_100071966 | 139 |
| 478 | 3300031727 | Ga0316576_10024025 | Ga0316576_100240255 | 139 |
| 479 | 3300031727 | Ga0316576_11164423 | Ga0316576_111644231 | 139 |
| 480 | 3300031728 | Ga0316578_10003454 | Ga0316578_100034546 | 139 |
| 481 | 3300031728 | Ga0316578_10033641 | Ga0316578_100336414 | 139 |
| 482 | 3300031733 | Ga0316577_10015853 | Ga0316577_100158534 | 139 |
| 483 | 3300031852 | Ga0307410_10150694 | Ga0307410_101506942 | 139 |
| 484 | 3300032002 | Ga0307416_100483379 | Ga0307416_1004833792 | 139 |
| 485 | 3300032005 | Ga0307411_10890372 | Ga0307411_108903721 | 139 |
| 486 | 3300032137 | Ga0316585_10000135 | Ga0316585_1000013512 | 139 |
| 487 | 3300032137 | Ga0316585_10015525 | Ga0316585_100155252 | 139 |
| 488 | 3300032168 | Ga0316593_10012916 | Ga0316593_100129161 | 139 |
| 489 | 3300033524 | Ga0316592_1008726 | Ga0316592_10087262 | 139 |
| 490 | 3300033524 | Ga0316592_1045478 | Ga0316592_10454781 | 139 |
| 491 | 3300033524 | Ga0316592_1045972 | Ga0316592_10459722 | 139 |
| 492 | 3300033527 | Ga0316586_1013613 | Ga0316586_10136132 | 139 |
| 493 | 3300033527 | Ga0316586_1070231 | Ga0316586_10702311 | 139 |
| 494 | 3300033527 | Ga0316586_1110879 | Ga0316586_11108791 | 139 |
| 495 | 3300033528 | Ga0316588_1028846 | Ga0316588_10288462 | 139 |
| 496 | 3300033528 | Ga0316588_1074923 | Ga0316588_10749232 | 139 |
| 497 | 3300033529 | Ga0316587_1009144 | Ga0316587_10091442 | 139 |
| 498 | 3300033529 | Ga0316587_1073882 | Ga0316587_10738821 | 139 |
| 499 | 3300033541 | Ga0316596_1001923 | Ga0316596_10019233 | 139 |
| 500 | 3300033541 | Ga0316596_1006082 | Ga0316596_10060823 | 139 |
| 501 | 3300033541 | Ga0316596_1039698 | Ga0316596_10396982 | 139 |
| 502 | 3300033541 | Ga0316596_1191131 | Ga0316596_11911311 | 139 |
| 503 | 3300035120 | Ga0373957_0109252 | Ga0373957_0109252_437_922 | 139 |
| 504 | 3300035172 | Ga0373955_0301483 | Ga0373955_0301483_406_894 | 139 |
| 505 | 3300035398 | Ga0316574_0004903 | Ga0316574_0004903_5687_6175 | 139 |
| 506 | 3300035398 | Ga0316574_0121960 | Ga0316574_0121960_1020_1502 | 139 |
| 507 | 3300036401 | Ga0373937_0032536 | Ga0373937_0032536_4138_4626 | 139 |
| 508 | 3300036401 | Ga0373937_0066233 | Ga0373937_0066233_2110_2595 | 139 |
| 509 | 3300036401 | Ga0373937_0542939 | Ga0373937_0542939_576_1058 | 139 |
| 510 | 3300036647 | Ga0316582_0004722 | Ga0316582_0004722_1213_1701 | 139 |
| 511 | 3300036647 | Ga0316582_0106664 | Ga0316582_0106664_477_959 | 139 |
| 512 | 3300036647 | Ga0316582_0227241 | Ga0316582_0227241_402_890 | 139 |
| 513 | 3300036712 | Ga0316584_0236936 | Ga0316584_0236936_797_1285 | 139 |
| 514 | 3300037853 | Ga0436364_0657416 | Ga0436364_0657416_94_582 | 139 |
| 515 | 3300038727 | Ga0400491_20990 | Ga0400491_20990_5143_5640 | 139 |
| 516 | 3300039437 | Ga0436365_0124459 | Ga0436365_0124459_526_1014 | 139 |
| 517 | 3300039437 | Ga0436365_1190722 | Ga0436365_1190722_37706_38236 | 139 |
| 518 | 3300039437 | Ga0436365_1930978 | Ga0436365_1930978_1488_1979 | 139 |
| 519 | 3300039438 | Ga0436360_0198049 | Ga0436360_0198049_447_935 | 139 |
| 520 | 3300039447 | Ga0436361_0028601 | Ga0436361_0028601_2408_2893 | 139 |
| 521 | 3300039447 | Ga0436361_0028601 | Ga0436361_0028601_3101_3589 | 139 |
| 522 | 3300039447 | Ga0436361_1127599 | Ga0436361_1127599_2206_2691 | 139 |
| 523 | 3300042876 | Ga0451577_0001743 | Ga0451577_0001743_14695_15177 | 139 |
| 524 | 3300042993 | Ga0439440_0086160 | Ga0439440_0086160_127_612 | 139 |
| 525 | 3300045051 | Ga0451576_0038173 | Ga0451576_0038173_3638_4123 | 139 |
| 526 | 3300045976 | Ga0466967_1034409 | Ga0466967_1034409_269_751 | 139 |
| 527 | 3300046455 | Ga0495603_0021112 | Ga0495603_0021112_2163_2654 | 139 |
| 528 | 3300046457 | Ga0495590_0123163 | Ga0495590_0123163_109_600 | 139 |
| 529 | 3300046459 | Ga0495629_0000436 | Ga0495629_0000436_21451_21942 | 139 |
| 530 | 3300046459 | Ga0495629_0110817 | Ga0495629_0110817_662_1153 | 139 |
| 531 | 3300046460 | Ga0495638_0004290 | Ga0495638_0004290_4849_5340 | 139 |
| 532 | 3300046461 | Ga0495641_0021538 | Ga0495641_0021538_2404_2895 | 139 |
| 533 | 3300046462 | Ga0495651_0066336 | Ga0495651_0066336_723_1214 | 139 |
| 534 | 3300046463 | Ga0495653_0001432 | Ga0495653_0001432_12798_13289 | 139 |
| 535 | 3300046463 | Ga0495653_0009893 | Ga0495653_0009893_4172_4663 | 139 |
| 536 | 3300046471 | Ga0495650_0006227 | Ga0495650_0006227_397_888 | 139 |
| 537 | 3300046472 | Ga0495580_0000454 | Ga0495580_0000454_21066_21557 | 139 |
| 538 | 3300046472 | Ga0495580_0007150 | Ga0495580_0007150_7810_8301 | 139 |
| 539 | 3300046472 | Ga0495580_0105818 | Ga0495580_0105818_1184_1675 | 139 |
| 540 | 3300046473 | Ga0495582_0008680 | Ga0495582_0008680_734_1225 | 139 |
| 541 | 3300046473 | Ga0495582_0784309 | Ga0495582_0784309_14_505 | 139 |
| 542 | 3300046474 | Ga0495605_0009041 | Ga0495605_0009041_332_823 | 139 |
| 543 | 3300046476 | Ga0495662_0013480 | Ga0495662_0013480_3341_3832 | 139 |
| 544 | 3300046476 | Ga0495662_0091525 | Ga0495662_0091525_864_1355 | 139 |
| 545 | 3300046477 | Ga0495664_0007110 | Ga0495664_0007110_5375_5866 | 139 |
| 546 | 3300046477 | Ga0495664_0129883 | Ga0495664_0129883_195_686 | 139 |
| 547 | 3300046499 | Ga0495594_0038887 | Ga0495594_0038887_300_791 | 139 |
| 548 | 3300046500 | Ga0495596_0038128 | Ga0495596_0038128_1265_1756 | 139 |
| 549 | 3300046506 | Ga0495583_0022721 | Ga0495583_0022721_2460_2951 | 139 |
| 550 | 3300046507 | Ga0495606_0041956 | Ga0495606_0041956_159_650 | 139 |
| 551 | 3300046507 | Ga0495606_0092735 | Ga0495606_0092735_827_1318 | 139 |
| 552 | 3300046512 | Ga0495610_0083855 | Ga0495610_0083855_666_1172 | 139 |
| 553 | 3300046514 | Ga0495618_0040991 | Ga0495618_0040991_2168_2659 | 139 |
| 554 | 3300046514 | Ga0495618_0072283 | Ga0495618_0072283_1232_1723 | 139 |
| 555 | 3300046515 | Ga0495620_0017356 | Ga0495620_0017356_1344_1835 | 139 |
| 556 | 3300046516 | Ga0495628_0011906 | Ga0495628_0011906_3228_3719 | 139 |
| 557 | 3300046516 | Ga0495628_0025554 | Ga0495628_0025554_2948_3439 | 139 |
| 558 | 3300046517 | Ga0495630_0028380 | Ga0495630_0028380_761_1252 | 139 |
| 559 | 3300046519 | Ga0495632_0069336 | Ga0495632_0069336_406_897 | 139 |
| 560 | 3300046522 | Ga0495643_0361069 | Ga0495643_0361069_128_619 | 139 |
| 561 | 3300046524 | Ga0495648_0019060 | Ga0495648_0019060_3982_4473 | 139 |
| 562 | 3300046524 | Ga0495648_0023871 | Ga0495648_0023871_416_907 | 139 |
| 563 | 3300046526 | Ga0495666_0001761 | Ga0495666_0001761_3082_3573 | 139 |
| 564 | 3300046526 | Ga0495666_0186969 | Ga0495666_0186969_219_710 | 139 |
| 565 | 3300046528 | Ga0495642_0161316 | Ga0495642_0161316_205_696 | 139 |
| 566 | 3300046529 | Ga0495652_0096851 | Ga0495652_0096851_622_1113 | 139 |
| 567 | 3300046531 | Ga0495665_0082262 | Ga0495665_0082262_750_1241 | 139 |
| 568 | 3300046531 | Ga0495665_0324830 | Ga0495665_0324830_226_717 | 139 |
| 569 | 3300046533 | Ga0495640_0120825 | Ga0495640_0120825_364_855 | 139 |
| 570 | 3300046535 | Ga0495586_0006614 | Ga0495586_0006614_2623_3114 | 139 |
| 571 | 3300046535 | Ga0495586_0243830 | Ga0495586_0243830_196_687 | 139 |
| 572 | 3300046536 | Ga0495587_0004114 | Ga0495587_0004114_1125_1616 | 139 |
| 573 | 3300046538 | Ga0495609_0051556 | Ga0495609_0051556_347_838 | 139 |
| 574 | 3300046542 | Ga0495597_0027595 | Ga0495597_0027595_1521_2012 | 139 |
| 575 | 3300046543 | Ga0495645_0002458 | Ga0495645_0002458_7615_8106 | 139 |
| 576 | 3300046557 | Ga0495622_0000018 | Ga0495622_0000018_77849_78340 | 139 |
| 577 | 3300046616 | Ga0495668_0000028 | Ga0495668_0000028_166272_166754 | 139 |
| 578 | 3300046642 | Ga0495634_0004462 | Ga0495634_0004462_649_1140 | 139 |
| 579 | 3300046642 | Ga0495634_0365306 | Ga0495634_0365306_281_772 | 139 |
| 580 | 3300046648 | Ga0495611_0218241 | Ga0495611_0218241_336_827 | 139 |
| 581 | 3300046663 | Ga0495635_0003028 | Ga0495635_0003028_7371_7862 | 139 |
| 582 | 3300046665 | Ga0495661_0003061 | Ga0495661_0003061_7895_8386 | 139 |
| 583 | 3300046675 | Ga0495657_0079428 | Ga0495657_0079428_1361_1852 | 139 |
| 584 | 3300046678 | Ga0495599_0076400 | Ga0495599_0076400_749_1240 | 139 |
| 585 | 3300046678 | Ga0495599_0107804 | Ga0495599_0107804_167_658 | 139 |
| 586 | 3300046679 | Ga0495623_0002881 | Ga0495623_0002881_8848_9339 | 139 |
| 587 | 3300046680 | Ga0495646_0030921 | Ga0495646_0030921_1680_2171 | 139 |
| 588 | 3300046680 | Ga0495646_0033452 | Ga0495646_0033452_2240_2731 | 139 |
| 589 | 3300046684 | Ga0495669_0113642 | Ga0495669_0113642_408_899 | 139 |
| 590 | 3300046689 | Ga0495613_0108647 | Ga0495613_0108647_514_1005 | 139 |
| 591 | 3300046689 | Ga0495613_0164360 | Ga0495613_0164360_337_828 | 139 |
| 592 | 3300046690 | Ga0495624_0006943 | Ga0495624_0006943_6835_7326 | 139 |
| 593 | 3300046690 | Ga0495624_0027504 | Ga0495624_0027504_1289_1780 | 139 |
| 594 | 3300046690 | Ga0495624_0054486 | Ga0495624_0054486_185_676 | 139 |
| 595 | 3300046692 | Ga0495671_0012743 | Ga0495671_0012743_63_554 | 139 |
| 596 | 3300046794 | Ga0495589_0016853 | Ga0495589_0016853_2677_3168 | 139 |
| 597 | 3300046809 | Ga0495600_0054224 | Ga0495600_0054224_1595_2083 | 139 |
| 598 | 3300046810 | Ga0495660_0201221 | Ga0495660_0201221_357_839 | 139 |
| 599 | 3300047315 | Ga0495581_0000308 | Ga0495581_0000308_8938_9429 | 139 |
| 600 | 3300047317 | Ga0495604_0002498 | Ga0495604_0002498_5770_6261 | 139 |
| 601 | 3300047317 | Ga0495604_0022448 | Ga0495604_0022448_2030_2521 | 139 |
| 602 | 3300047319 | Ga0495674_0095829 | Ga0495674_0095829_750_1241 | 139 |
| 603 | 3300047320 | Ga0495672_0002721 | Ga0495672_0002721_11875_12366 | 139 |
| 604 | 3300047321 | Ga0495676_0031983 | Ga0495676_0031983_3312_3803 | 139 |
| 605 | 3300047321 | Ga0495676_0240225 | Ga0495676_0240225_380_871 | 139 |
| 606 | 3300047322 | Ga0495680_0022450 | Ga0495680_0022450_2405_2896 | 139 |
| 607 | 3300047322 | Ga0495680_0043303 | Ga0495680_0043303_899_1390 | 139 |
| 608 | 3300047323 | Ga0495683_0056996 | Ga0495683_0056996_277_768 | 139 |
| 609 | 3300047443 | Ga0495687_061217 | Ga0495687_061217_492_983 | 139 |
| 610 | 3300047444 | Ga0495675_0036533 | Ga0495675_0036533_1606_2097 | 139 |
| 611 | 3300047444 | Ga0495675_0138038 | Ga0495675_0138038_54_545 | 139 |
| 612 | 3300047446 | Ga0495679_000008 | Ga0495679_000008_144720_145211 | 139 |
| 613 | 3300047446 | Ga0495679_000300 | Ga0495679_000300_25889_26380 | 139 |
| 614 | 3300047469 | Ga0495673_0159263 | Ga0495673_0159263_275_766 | 139 |
| 615 | 3300047470 | Ga0495681_0055594 | Ga0495681_0055594_612_1103 | 139 |
| 616 | 3300047471 | Ga0495684_0042294 | Ga0495684_0042294_2112_2603 | 139 |
| 617 | 3300047673 | Ga0495593_0003365 | Ga0495593_0003365_5631_6122 | 139 |
| 618 | 3300048088 | Ga0495602_0011757 | Ga0495602_0011757_1130_1621 | 139 |
| 619 | 3300048088 | Ga0495602_0048159 | Ga0495602_0048159_2421_2912 | 139 |
| 620 | 3300048089 | Ga0495614_0015119 | Ga0495614_0015119_1148_1639 | 139 |
| 621 | 3300048091 | Ga0495626_0005137 | Ga0495626_0005137_3580_4071 | 139 |
| 622 | 3300048907 | Ga0496104_0909528 | Ga0496104_0909528_153_656 | 139 |
| 623 | 3300048917 | Ga0496114_0104534 | Ga0496114_0104534_589_1092 | 139 |
| 624 | 3300048920 | Ga0496117_0066625 | Ga0496117_0066625_1521_2012 | 139 |
| 625 | 3300048921 | Ga0496118_0022027 | Ga0496118_0022027_2460_2951 | 139 |
| 626 | 3300048924 | Ga0496121_0008159 | Ga0496121_0008159_356_847 | 139 |
| 627 | 3300049459 | Ga0495678_007106 | Ga0495678_007106_1521_2012 | 139 |
| 628 | 3300049459 | Ga0495678_019188 | Ga0495678_019188_1971_2453 | 139 |
| 629 | 3300049568 | Ga0501031_0015019 | Ga0501031_0015019_4329_4811 | 139 |
| 630 | 3300049568 | Ga0501031_0148125 | Ga0501031_0148125_494_976 | 139 |
| 631 | 3300049569 | Ga0501032_0002974 | Ga0501032_0002974_6200_6682 | 139 |
| 632 | 3300049569 | Ga0501032_0009021 | Ga0501032_0009021_6663_7145 | 139 |
| 633 | 3300049570 | Ga0501033_0001594 | Ga0501033_0001594_13050_13532 | 139 |
| 634 | 3300049570 | Ga0501033_0167046 | Ga0501033_0167046_203_685 | 139 |
| 635 | 3300049571 | Ga0501034_0040330 | Ga0501034_0040330_539_1021 | 139 |
| 636 | 3300049572 | Ga0501036_0004807 | Ga0501036_0004807_5094_5576 | 139 |
| 637 | 3300049572 | Ga0501036_0088629 | Ga0501036_0088629_494_976 | 139 |
| 638 | 3300049573 | Ga0501037_0002776 | Ga0501037_0002776_8087_8569 | 139 |
| 639 | 3300049574 | Ga0501038_0002215 | Ga0501038_0002215_4148_4630 | 139 |
| 640 | 3300049574 | Ga0501038_0008444 | Ga0501038_0008444_7675_8157 | 139 |
| 641 | 3300049574 | Ga0501038_0022440 | Ga0501038_0022440_1249_1731 | 139 |
| 642 | 3300049575 | Ga0501039_0005521 | Ga0501039_0005521_2730_3212 | 139 |
| 643 | 3300049575 | Ga0501039_0017532 | Ga0501039_0017532_686_1168 | 139 |
| 644 | 3300049576 | Ga0501040_0007076 | Ga0501040_0007076_248_730 | 139 |
| 645 | 3300049577 | Ga0501041_0349276 | Ga0501041_0349276_61_543 | 139 |
| 646 | 3300049578 | Ga0501042_0001122 | Ga0501042_0001122_3672_4154 | 139 |
| 647 | 3300049579 | Ga0501043_0005777 | Ga0501043_0005777_5775_6257 | 139 |
| 648 | 3300049579 | Ga0501043_0044298 | Ga0501043_0044298_1253_1735 | 139 |
| 649 | 3300049579 | Ga0501043_0149271 | Ga0501043_0149271_1328_1810 | 139 |
| 650 | 3300049580 | Ga0501046_0001218 | Ga0501046_0001218_14934_15416 | 139 |
| 651 | 3300049580 | Ga0501046_0013156 | Ga0501046_0013156_2650_3132 | 139 |
| 652 | 3300049581 | Ga0501047_0022202 | Ga0501047_0022202_5256_5738 | 139 |
| 653 | 3300049582 | Ga0501048_0055918 | Ga0501048_0055918_904_1386 | 139 |
| 654 | 3300049583 | Ga0501067_0619606 | Ga0501067_0619606_110_592 | 139 |
| 655 | 3300049584 | Ga0501068_0010069 | Ga0501068_0010069_4759_5241 | 139 |
| 656 | 3300049679 | Ga0501249_014616 | Ga0501249_014616_605_1111 | 139 |
| 657 | 3300049822 | Ga0501035_0001588 | Ga0501035_0001588_20347_20829 | 139 |
| 658 | 3300049822 | Ga0501035_0290622 | Ga0501035_0290622_212_694 | 139 |
| 659 | 3300049822 | Ga0501035_0645934 | Ga0501035_0645934_84_566 | 139 |
| 660 | 3300049823 | Ga0501044_0009871 | Ga0501044_0009871_2058_2540 | 139 |
| 661 | 3300049823 | Ga0501044_0015564 | Ga0501044_0015564_6474_6956 | 139 |
| 662 | 3300049824 | Ga0501045_0005631 | Ga0501045_0005631_1639_2121 | 139 |
| 663 | 3300050507 | nmdc:mga05p37_80858_c1 | nmdc:mga05p37_80858_c1_539_1024 | 139 |
| 664 | 3300050508 | nmdc:mga09592_40483_c1 | nmdc:mga09592_40483_c1_308_793 | 139 |
| 665 | 3300050509 | nmdc:mga0qj67_19318_c1 | nmdc:mga0qj67_19318_c1_2014_2499 | 139 |
| 666 | 3300050510 | nmdc:mga06r32_82249_c1 | nmdc:mga06r32_82249_c1_1661_2146 | 139 |
| 667 | 3300050511 | nmdc:mga08y16_1010141_c1 | nmdc:mga08y16_1010141_c1_149_628 | 139 |
| 668 | 3300050515 | nmdc:mga0a205_324751_c1 | nmdc:mga0a205_324751_c1_338_823 | 139 |
| 669 | 3300053108 | Ga0500562_000577 | Ga0500562_000577_4700_5191 | 139 |
| 670 | 3300053117 | Ga0500593_111046 | Ga0500593_111046_245_736 | 139 |
| 671 | 3300053153 | Ga0500616_0032201 | Ga0500616_0032201_412_894 | 139 |
| 672 | 3300059506 | Ga0587085_035384 | Ga0587085_035384_92_577 | 139 |
| 673 | 3300059639 | Ga0587062_047956 | Ga0587062_047956_119_604 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y12-assembly1.cif.gz_A | structure of a hemolysin-coregulated protein from pseudomonas aeruginosa | 0.9271 | 2 | 139 |
| 1y12-assembly2.cif.gz_B | structure of a hemolysin-coregulated protein from pseudomonas aeruginosa | 0.9249 | 2 | 139 |
| 1y12-assembly1.cif.gz_C | structure of a hemolysin-coregulated protein from pseudomonas aeruginosa | 0.9229 | 2 | 139 |
| 4tv4-assembly1.cif.gz_A-2 | crystal structure of a putative uncharacterized protein from burkholderia pseudomallei | 0.9205 | 2 | 139 |
| 4tv4-assembly1.cif.gz_C-2 | crystal structure of a putative uncharacterized protein from burkholderia pseudomallei | 0.9201 | 2 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3eaaB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9201 | 2 | 139 | 2.30.110.20 |
| 3eaaB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9075 | 2 | 139 | 2.30.110.20 |
| 1y12B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.9033 | 2 | 139 | 2.30.110.20 |
| 1y12B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8908 | 2 | 139 | 2.30.110.20 |
| 5xeuF00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Hcp1-like | 0.8692 | 4 | 137 | 2.30.110.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8A3X2-F1-model_v4 | Uncharacterized protein ImpD | 0.9585 | 38 | 139 |
|
| AF-A0A3D5AS39-F1-model_v4 | Type VI secretion system tube protein Hcp | 0.9565 | 3 | 139 |
|
| AF-A0A535EEU2-F1-model_v4 | Type VI secretion system tube protein Hcp | 0.9536 | 1 | 139 |
|
| AF-A0A5C7M321-F1-model_v4 | deleted | 0.952 | 1 | 139 |
|
| AF-A0A379CWI1-F1-model_v4 | deleted | 0.9513 | 34 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar