F474228

General Info

Members Datasets Scaffolds Average Seq Length
672 251 642 495

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10066531|Ga0105241_100665313
Length 579
Sequence LLKIVFGTTLLRFANRFVRQQQRSEIIQCFAMFVNFFFSPSKRSEPFEGLSFATRDRIIPASHTARKSRYNGRFAALAETAVMTILLSTLNARYAHASLGLRYLLANMGPLQEQTSLMEFVIGAKTTEVVERLLAKKPRIVGFGIYIWNVEETTKVVAMLKRVAPEVTVVLGGPEVSHETGEQEIVRLADYVVTGWGDITFPKLCGDILHGPKPIMKVHAGVQPPMAEIALPYTLYSDEDIAHRTIYVEASRGCPFKCEFCLSSLDKTAWPFGIDTFLAEMETLYQRGARLFKFVDRTFNLNVKTSQRIMQFFLDKIAANPDDPVYAHFELVPDHLPEALKATIAQFPPGALQFEIGIQSFNPEVQTLVSRRQDNAKAADNIRWLMAHSHXXXXVDLIAGLPGEDVESFARGFDQLVALGPHEIQFGILKRLRGTPIIRHTEPYKMVYEPYPPYTVLATDRIDFATMQRLVRFARYWDLVANSGRFAHTVKVLLGDSPFANFMAFSDWMYTQLDATHRIALDRLAKLVQAWLQLRGMPAHDAAALVASDYAGSAHKPADKSTQAKPAAAPERQVRHLAA

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2818991436 Collimonas arenae 515 Isolate Unclassified
19 2821131069 Duganella sp. 1224 Isolate Unclassified
20 2842711865 Duganella sp. R-73148 Isolate Unclassified
21 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
22 2857553236 Duganella sp. R-74557 Isolate Unclassified
23 2857558681 Duganella sp. R-74565 Isolate Unclassified
24 2857564685 Duganella sp. R-74599 Isolate Unclassified
25 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
26 2904424332 Duganella sp. 1411 Isolate Rhizosphere
27 2919476304 Duganella sp. 3397 Isolate Unclassified
28 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
29 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
42 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
43 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
44 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
119 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
241 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
247 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
248 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
249 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0.15
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.1
Nodule 0.45
Rhizoplane 3.27
Rhizosphere 75.89
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000023 3300002737 Bacteria 236658
2 JGI25150J39212_1003512 3300002774 Bacteria 3657
3 JGI25159J45721_1002946 3300002987 Bacteria 6200
4 JGI25165J46597_1000030 3300003214 Bacteria 305254
5 JGI25153J46596_10018066 3300003215 Bacteria 2753
6 rootL2_10102555 3300003322 Bacteria 2715
7 JGI25161J50226_1001616 3300003374 Bacteria 6542
8 Ga0055538_1000017 3300003751 Bacteria 305254
9 Ga0055539_1000022 3300003752 Bacteria 305254
10 Ga0055533_1000030 3300003756 Bacteria 305254
11 Ga0055525_1000028 3300003759 Bacteria 331683
12 Ga0055525_1000034 3300003759 Bacteria 305254
13 Ga0055542_1007275 3300003762 Bacteria 2264
14 Ga0055529_1000583 3300003763 Bacteria 29289
15 Ga0055526_1000149 3300003771 Bacteria 61682
16 Ga0055526_1001052 3300003771 Bacteria 20145
17 Ga0055526_1001207 3300003771 Bacteria 18616
18 Ga0055526_1005381 3300003771 Bacteria 7372
19 Ga0055537_1000578 3300003773 Bacteria 20349
20 Ga0055537_1006621 3300003773 Bacteria 2909
21 Ga0055537_1011931 3300003773 Bacteria 1727
22 Ga0055524_1000124 3300003775 Bacteria 90282
23 Ga0055524_1013278 3300003775 Bacteria 3113
24 Ga0055534_1000489 3300003784 Bacteria 21927
25 Ga0055528_1000575 3300003790 Bacteria 27746
26 Ga0055530_10004148 3300003791 Bacteria 7662
27 Ga0055531_10006260 3300003794 Bacteria 6789
28 Ga0055531_10028577 3300003794 Bacteria 1919
29 Ga0055541_1000015 3300003841 Bacteria 305254
30 Ga0055543_1002129 3300004625 Bacteria 6850
31 Ga0065165_1000167 3300005262 Bacteria 115630
32 Ga0065165_1001081 3300005262 Bacteria 32488
33 Ga0065165_1005706 3300005262 Bacteria 6850
34 Ga0070670_100173927 3300005331 Bacteria 1868
35 Ga0070682_100004447 3300005337 Bacteria 7781
36 Ga0070660_100002856 3300005339 Bacteria 11893
37 Ga0070660_100069403 3300005339 Bacteria 2748
38 Ga0070660_100139181 3300005339 Bacteria 1946
39 Ga0070661_100007701 3300005344 Bacteria 7440
40 Ga0070661_100147763 3300005344 Bacteria 1775
41 Ga0070659_100004956 3300005366 Bacteria 9526
42 Ga0068855_100176608 3300005563 Bacteria 2416
43 Ga0070664_100063092 3300005564 Bacteria 3159
44 Ga0099826_10002381 3300006948 Bacteria 12104
45 Ga0105244_10013076 3300009036 Bacteria 4869
46 Ga0105243_10019283 3300009148 Bacteria 5170
47 Ga0105241_10066531 3300009174 Bacteria 2787
48 Ga0105237_10127719 3300009545 Bacteria 2536
49 Ga0105239_10283770 3300010375 Bacteria 1864
50 Ga0182008_10002513 3300014497 Bacteria 11447
51 Ga0182006_1000095 3300015261 Bacteria 105469
52 Ga0182006_1000216 3300015261 Bacteria 56213
53 Ga0182007_10001265 3300015262 Bacteria 13727
54 Ga0182007_10001951 3300015262 Bacteria 10665
55 Ga0182005_1000057 3300015265 Bacteria 104753
56 Ga0182005_1000119 3300015265 Bacteria 57192
57 Ga0182005_1000134 3300015265 Bacteria 53164
58 Ga0163161_10010197 3300017792 Bacteria 6505
59 Ga0213872_10000481 3300021361 Bacteria 32134
60 Ga0213872_10034755 3300021361 Bacteria 2306
61 Ga0209436_101730 3300025208 Bacteria 7176
62 Ga0209784_100034 3300025224 Bacteria 305504
63 Ga0209566_100038 3300025225 Bacteria 305504
64 Ga0209674_100056 3300025226 Bacteria 305504
65 Ga0209563_100011 3300025230 Bacteria 1187808
66 Ga0209563_100057 3300025230 Bacteria 305604
67 Ga0207427_100498 3300025231 Bacteria 20958
68 Ga0209437_100071 3300025233 Bacteria 305604
69 Ga0207425_1000493 3300025245 Bacteria 24717
70 Ga0207425_1000761 3300025245 Bacteria 16694
71 Ga0207425_1001383 3300025245 Bacteria 10259
72 Ga0209646_1000384 3300025246 Bacteria 28428
73 Ga0209677_100035 3300025253 Bacteria 305504
74 Ga0209677_107612 3300025253 Bacteria 2263
75 Ga0209148_1000381 3300025254 Bacteria 53384
76 Ga0209129_1000600 3300025258 Bacteria 24491
77 Ga0209129_1004176 3300025258 Bacteria 5819
78 Ga0209233_1000094 3300025261 Bacteria 305604
79 Ga0209565_1000112 3300025263 Bacteria 117209
80 Ga0209565_1002964 3300025263 Bacteria 5760
81 Ga0209565_1014178 3300025263 Bacteria 1840
82 Ga0209565_1014389 3300025263 Bacteria 1819
83 Ga0209455_1000484 3300025272 Bacteria 29439
84 Ga0209673_1000210 3300025273 Bacteria 117276
85 Ga0209130_1000016 3300025284 Bacteria 395540
86 Ga0209130_1002714 3300025284 Bacteria 8411
87 Ga0209130_1003164 3300025284 Bacteria 7277
88 Ga0209130_1004431 3300025284 Bacteria 5331
89 Ga0209675_1000761 3300025291 Bacteria 21640
90 Ga0209675_1003306 3300025291 Bacteria 7743
91 Ga0209675_1013045 3300025291 Bacteria 2631
92 Ga0209675_1017794 3300025291 Bacteria 2015
93 Ga0209025_1014809 3300025294 Bacteria 4761
94 Ga0209564_1000010 3300025295 Bacteria 885399
95 Ga0209564_1000245 3300025295 Bacteria 117378
96 Ga0209564_1001321 3300025295 Bacteria 26542
97 Ga0209564_1002064 3300025295 Bacteria 17279
98 Ga0209564_1020018 3300025295 Bacteria 2472
99 Ga0209758_1000957 3300025297 Bacteria 38982
100 Ga0209758_1001720 3300025297 Bacteria 24474
101 Ga0209050_1000086 3300025298 Bacteria 262009
102 Ga0209050_1002207 3300025298 Bacteria 17496
103 Ga0209256_1000268 3300025299 Bacteria 91897
104 Ga0209256_1001618 3300025299 Bacteria 21976
105 Ga0209256_1002073 3300025299 Bacteria 17627
106 Ga0209256_1002630 3300025299 Bacteria 14174
107 Ga0209256_1007095 3300025299 Bacteria 5658
108 Ga0209051_1006544 3300025303 Bacteria 6544
109 Ga0209257_1006299 3300025304 Bacteria 7744
110 Ga0209257_1007877 3300025304 Bacteria 6271
111 Ga0207655_1009754 3300025728 Bacteria 5918
112 Ga0207671_10112100 3300025914 Bacteria 2076
113 Ga0207657_10018511 3300025919 Bacteria 6644
114 Ga0207657_10095874 3300025919 Bacteria 2468
115 Ga0207657_10146190 3300025919 Bacteria 1928
116 Ga0207649_10025866 3300025920 Bacteria 3428
117 Ga0207690_10013185 3300025932 Bacteria 4961
118 Ga0207706_10086551 3300025933 Bacteria 2755
119 Ga0207709_10032012 3300025935 Bacteria 3077
120 Ga0207679_10144187 3300025945 Bacteria 1929
121 Ga0209281_1011138 3300027111 Bacteria 2026
122 Ga0209282_1000066 3300027666 Bacteria 87072
123 Ga0307515_10099073 3300028794 Bacteria 3542
124 Ga0316182_1122702 3300030745 Bacteria 3826
125 Ga0307408_100001878 3300031548 Bacteria 15299
126 Ga0307408_100006441 3300031548 Bacteria 7781
127 Ga0307408_100013856 3300031548 Bacteria 5353
128 Ga0307408_100048403 3300031548 Bacteria 3049
129 Ga0265314_10048457 3300031711 Bacteria 2982
130 Ga0395899_0000575 3300037312 Bacteria 39137
131 Ga0395899_0000762 3300037312 Bacteria 31826
132 Ga0395899_0001822 3300037312 Bacteria 17649
133 Ga0395899_0014827 3300037312 Bacteria 5948
134 Ga0395899_0061046 3300037312 Bacteria 2776
135 Ga0395900_0004198 3300037418 Bacteria 15292
136 Ga0395900_0020705 3300037418 Bacteria 6721
137 Ga0395900_0026862 3300037418 Bacteria 5891
138 Ga0395900_0049797 3300037418 Bacteria 4316
139 Ga0395900_0065519 3300037418 Bacteria 3732
140 Ga0395900_0170962 3300037418 Bacteria 2212
141 Ga0395898_0089301 3300037466 Bacteria 2965
142 Ga0395898_0118987 3300037466 Bacteria 2530
143 Ga0395905_0001070 3300037471 Bacteria 34507
144 Ga0395905_0009521 3300037471 Bacteria 9490
145 Ga0395905_0055021 3300037471 Bacteria 3724
146 Ga0395901_0001364 3300038443 Bacteria 25549
147 Ga0395901_0006884 3300038443 Bacteria 11482
148 Ga0395901_0050535 3300038443 Bacteria 4319
149 Ga0436361_0108001 3300039447 Bacteria 112244
150 Ga0436361_0217337 3300039447 Bacteria 18930
151 Ga0436361_1031912 3300039447 Bacteria 21537
152 Ga0439448_0008515 3300042005 Bacteria 3005
153 Ga0450897_000149 3300042128 Bacteria 3289
154 Ga0450904_000062 3300042139 Bacteria 24255
155 Ga0439458_0002215 3300042157 Bacteria 4797
156 Ga0466972_0000373 3300044658 Bacteria 24131
157 Ga0466972_0026689 3300044658 Bacteria 2861
158 Ga0466965_0028388 3300044683 Bacteria 2719
159 Ga0466965_0030967 3300044683 Bacteria 2607
160 Ga0466966_0087480 3300044684 Bacteria 1936
161 Ga0466966_0089391 3300044684 Bacteria 1913
162 Ga0466963_0070914 3300044694 Bacteria 2344
163 Ga0466964_0000883 3300044706 Bacteria 9829
164 Ga0466964_0002132 3300044706 Bacteria 6976
165 Ga0466964_0011013 3300044706 Bacteria 3416
166 Ga0466964_0038294 3300044706 Bacteria 1927
167 Ga0453684_0029009 3300044712 Bacteria 7872
168 Ga0466968_0000881 3300044735 Bacteria 10552
169 Ga0466968_0006523 3300044735 Bacteria 4403
170 Ga0466968_0047929 3300044735 Bacteria 1818
171 Ga0466970_0018709 3300044765 Bacteria 3589
172 Ga0466957_0000182 3300044842 Bacteria 28463
173 Ga0466957_0026183 3300044842 Bacteria 3459
174 Ga0466957_0079753 3300044842 Bacteria 2037
175 Ga0466959_0002186 3300045049 Bacteria 12439
176 Ga0466959_0044565 3300045049 Bacteria 3268
177 Ga0466967_0090863 3300045976 Bacteria 2774
178 Ga0495617_000010 3300046452 Bacteria 310258
179 Ga0495617_000471 3300046452 Bacteria 21547
180 Ga0495617_013939 3300046452 Bacteria 2732
181 Ga0495627_000378 3300046453 Bacteria 40927
182 Ga0495627_000690 3300046453 Bacteria 25783
183 Ga0495592_0011996 3300046454 Bacteria 6568
184 Ga0495603_0033142 3300046455 Bacteria 3108
185 Ga0495590_0000009 3300046457 Bacteria 320425
186 Ga0495590_0000201 3300046457 Bacteria 33657
187 Ga0495590_0008255 3300046457 Bacteria 3981
188 Ga0495590_0024851 3300046457 Bacteria 2109
189 Ga0495591_000867 3300046458 Bacteria 21241
190 Ga0495629_0034848 3300046459 Bacteria 3558
191 Ga0495638_0004523 3300046460 Bacteria 10535
192 Ga0495638_0018956 3300046460 Bacteria 4559
193 Ga0495638_0021457 3300046460 Bacteria 4256
194 Ga0495638_0091992 3300046460 Bacteria 1826
195 Ga0495651_0025844 3300046462 Bacteria 4571
196 Ga0495653_0000959 3300046463 Bacteria 22101
197 Ga0495653_0007503 3300046463 Bacteria 8919
198 Ga0495653_0021789 3300046463 Bacteria 5187
199 Ga0495653_0048941 3300046463 Bacteria 3259
200 Ga0495650_0000062 3300046471 Bacteria 277977
201 Ga0495650_0001085 3300046471 Bacteria 29863
202 Ga0495650_0001544 3300046471 Bacteria 21838
203 Ga0495650_0001553 3300046471 Bacteria 21682
204 Ga0495650_0003055 3300046471 Bacteria 12597
205 Ga0495650_0003201 3300046471 Bacteria 12180
206 Ga0495650_0027270 3300046471 Bacteria 2642
207 Ga0495580_0082024 3300046472 Bacteria 2247
208 Ga0495582_0001880 3300046473 Bacteria 11839
209 Ga0495605_0000635 3300046474 Bacteria 26971
210 Ga0495605_0000941 3300046474 Bacteria 19886
211 Ga0495605_0001966 3300046474 Bacteria 13026
212 Ga0495605_0004232 3300046474 Bacteria 8451
213 Ga0495605_0005989 3300046474 Bacteria 7027
214 Ga0495605_0024319 3300046474 Bacteria 3171
215 Ga0495605_0060256 3300046474 Bacteria 1819
216 Ga0495584_0000092 3300046491 Bacteria 62079
217 Ga0495584_0001978 3300046491 Bacteria 11796
218 Ga0495584_0003316 3300046491 Bacteria 8912
219 Ga0495584_0004486 3300046491 Bacteria 7503
220 Ga0495584_0004909 3300046491 Bacteria 7136
221 Ga0495584_0007603 3300046491 Bacteria 5647
222 Ga0495584_0014663 3300046491 Bacteria 3992
223 Ga0495584_0026964 3300046491 Bacteria 2911
224 Ga0495584_0044137 3300046491 Bacteria 2250
225 Ga0495584_0070975 3300046491 Bacteria 1750
226 Ga0495585_0000984 3300046492 Bacteria 23867
227 Ga0495585_0001005 3300046492 Bacteria 23544
228 Ga0495585_0001417 3300046492 Bacteria 18856
229 Ga0495585_0001517 3300046492 Bacteria 18039
230 Ga0495585_0004278 3300046492 Bacteria 9295
231 Ga0495585_0011361 3300046492 Bacteria 5269
232 Ga0495585_0022517 3300046492 Bacteria 3616
233 Ga0495585_0031792 3300046492 Bacteria 2994
234 Ga0495585_0043376 3300046492 Bacteria 2516
235 Ga0495585_0046854 3300046492 Bacteria 2409
236 Ga0495594_0022587 3300046499 Bacteria 3365
237 Ga0495594_0034582 3300046499 Bacteria 2749
238 Ga0495594_0045489 3300046499 Bacteria 2409
239 Ga0495594_0052771 3300046499 Bacteria 2238
240 Ga0495594_0060757 3300046499 Bacteria 2090
241 Ga0495596_0000350 3300046500 Bacteria 29880
242 Ga0495596_0003154 3300046500 Bacteria 8494
243 Ga0495596_0005660 3300046500 Bacteria 5867
244 Ga0495596_0017984 3300046500 Bacteria 2918
245 Ga0495596_0029258 3300046500 Bacteria 2209
246 Ga0495607_0001154 3300046501 Bacteria 23921
247 Ga0495607_0002568 3300046501 Bacteria 14670
248 Ga0495607_0005276 3300046501 Bacteria 9295
249 Ga0495607_0005305 3300046501 Bacteria 9266
250 Ga0495607_0005622 3300046501 Bacteria 8944
251 Ga0495607_0016913 3300046501 Bacteria 4695
252 Ga0495607_0016975 3300046501 Bacteria 4686
253 Ga0495607_0051073 3300046501 Bacteria 2403
254 Ga0495607_0055384 3300046501 Bacteria 2281
255 Ga0495583_0000329 3300046506 Bacteria 75158
256 Ga0495583_0000952 3300046506 Bacteria 33646
257 Ga0495583_0001471 3300046506 Bacteria 23592
258 Ga0495583_0001555 3300046506 Bacteria 22720
259 Ga0495583_0005015 3300046506 Bacteria 9169
260 Ga0495583_0005584 3300046506 Bacteria 8483
261 Ga0495583_0015248 3300046506 Bacteria 4188
262 Ga0495583_0023988 3300046506 Bacteria 3074
263 Ga0495583_0024089 3300046506 Bacteria 3065
264 Ga0495583_0024817 3300046506 Bacteria 3005
265 Ga0495583_0028401 3300046506 Bacteria 2750
266 Ga0495583_0031168 3300046506 Bacteria 2588
267 Ga0495606_0000428 3300046507 Bacteria 70021
268 Ga0495606_0001517 3300046507 Bacteria 30788
269 Ga0495606_0001842 3300046507 Bacteria 26721
270 Ga0495606_0001977 3300046507 Bacteria 25276
271 Ga0495606_0002381 3300046507 Bacteria 22050
272 Ga0495606_0004131 3300046507 Bacteria 14744
273 Ga0495606_0007799 3300046507 Bacteria 9473
274 Ga0495606_0009754 3300046507 Bacteria 8076
275 Ga0495606_0012328 3300046507 Bacteria 6871
276 Ga0495606_0031689 3300046507 Bacteria 3671
277 Ga0495606_0095805 3300046507 Bacteria 1816
278 Ga0495608_0013893 3300046511 Bacteria 5589
279 Ga0495610_0000014 3300046512 Bacteria 444708
280 Ga0495610_0003364 3300046512 Bacteria 12537
281 Ga0495610_0007708 3300046512 Bacteria 7103
282 Ga0495616_0000547 3300046513 Bacteria 28354
283 Ga0495616_0001040 3300046513 Bacteria 19861
284 Ga0495616_0001268 3300046513 Bacteria 17756
285 Ga0495616_0006198 3300046513 Bacteria 7275
286 Ga0495616_0039681 3300046513 Bacteria 2409
287 Ga0495616_0045400 3300046513 Bacteria 2224
288 Ga0495616_0046318 3300046513 Bacteria 2195
289 Ga0495616_0059304 3300046513 Bacteria 1882
290 Ga0495616_0060690 3300046513 Bacteria 1856
291 Ga0495618_0011394 3300046514 Bacteria 5391
292 Ga0495620_0035174 3300046515 Bacteria 2255
293 Ga0495628_0000076 3300046516 Bacteria 78344
294 Ga0495628_0003214 3300046516 Bacteria 14649
295 Ga0495631_0000869 3300046518 Bacteria 19019
296 Ga0495631_0016477 3300046518 Bacteria 3521
297 Ga0495631_0031969 3300046518 Bacteria 2374
298 Ga0495631_0032702 3300046518 Bacteria 2343
299 Ga0495632_0001345 3300046519 Bacteria 20659
300 Ga0495632_0005648 3300046519 Bacteria 8226
301 Ga0495632_0007159 3300046519 Bacteria 7055
302 Ga0495632_0016710 3300046519 Bacteria 4071
303 Ga0495632_0041955 3300046519 Bacteria 2295
304 Ga0495637_0000003 3300046520 Bacteria 623293
305 Ga0495637_0007025 3300046520 Bacteria 5605
306 Ga0495637_0008969 3300046520 Bacteria 4893
307 Ga0495637_0029493 3300046520 Bacteria 2442
308 Ga0495643_0000891 3300046522 Bacteria 31774
309 Ga0495643_0001105 3300046522 Bacteria 26855
310 Ga0495643_0001198 3300046522 Bacteria 25224
311 Ga0495643_0004987 3300046522 Bacteria 9103
312 Ga0495643_0006489 3300046522 Bacteria 7698
313 Ga0495643_0013877 3300046522 Bacteria 4806
314 Ga0495643_0018368 3300046522 Bacteria 4065
315 Ga0495643_0029050 3300046522 Bacteria 3095
316 Ga0495643_0033135 3300046522 Bacteria 2861
317 Ga0495643_0059405 3300046522 Bacteria 2032
318 Ga0495643_0060639 3300046522 Bacteria 2007
319 Ga0495643_0064493 3300046522 Bacteria 1935
320 Ga0495643_0071994 3300046522 Bacteria 1813
321 Ga0495644_0008384 3300046523 Bacteria 3979
322 Ga0495644_0008814 3300046523 Bacteria 3879
323 Ga0495644_0028801 3300046523 Bacteria 2100
324 Ga0495644_0040765 3300046523 Bacteria 1750
325 Ga0495648_0000751 3300046524 Bacteria 34631
326 Ga0495648_0003454 3300046524 Bacteria 13901
327 Ga0495648_0003783 3300046524 Bacteria 13155
328 Ga0495648_0003840 3300046524 Bacteria 13034
329 Ga0495648_0013959 3300046524 Bacteria 5909
330 Ga0495648_0013960 3300046524 Bacteria 5909
331 Ga0495648_0030685 3300046524 Bacteria 3550
332 Ga0495648_0048992 3300046524 Bacteria 2594
333 Ga0495648_0063249 3300046524 Bacteria 2186
334 Ga0495648_0077271 3300046524 Bacteria 1909
335 Ga0495666_0005811 3300046526 Bacteria 6220
336 Ga0495666_0016084 3300046526 Bacteria 3724
337 Ga0495666_0061554 3300046526 Bacteria 1793
338 Ga0495642_0001015 3300046528 Bacteria 13038
339 Ga0495642_0001627 3300046528 Bacteria 9782
340 Ga0495642_0002398 3300046528 Bacteria 7635
341 Ga0495642_0008834 3300046528 Bacteria 3853
342 Ga0495642_0012745 3300046528 Bacteria 3245
343 Ga0495642_0012999 3300046528 Bacteria 3214
344 Ga0495642_0019212 3300046528 Bacteria 2678
345 Ga0495642_0021647 3300046528 Bacteria 2529
346 Ga0495642_0030631 3300046528 Bacteria 2152
347 Ga0495642_0030640 3300046528 Bacteria 2152
348 Ga0495642_0045011 3300046528 Bacteria 1803
349 Ga0495652_0003764 3300046529 Bacteria 14834
350 Ga0495652_0009821 3300046529 Bacteria 8677
351 Ga0495652_0036452 3300046529 Bacteria 4276
352 Ga0495654_0000245 3300046530 Bacteria 50772
353 Ga0495654_0012652 3300046530 Bacteria 4529
354 Ga0495654_0024540 3300046530 Bacteria 3113
355 Ga0495654_0032088 3300046530 Bacteria 2663
356 Ga0495654_0034903 3300046530 Bacteria 2535
357 Ga0495654_0037648 3300046530 Bacteria 2423
358 Ga0495654_0050256 3300046530 Bacteria 2039
359 Ga0495665_0006918 3300046531 Bacteria 6119
360 Ga0495665_0036121 3300046531 Bacteria 2637
361 Ga0495586_0018444 3300046535 Bacteria 3715
362 Ga0495586_0054080 3300046535 Bacteria 2175
363 Ga0495587_0107167 3300046536 Bacteria 1607
364 Ga0495609_0000038 3300046538 Bacteria 182264
365 Ga0495609_0000736 3300046538 Bacteria 24883
366 Ga0495609_0000927 3300046538 Bacteria 21234
367 Ga0495609_0001172 3300046538 Bacteria 18081
368 Ga0495609_0008725 3300046538 Bacteria 4942
369 Ga0495609_0012599 3300046538 Bacteria 4009
370 Ga0495609_0017938 3300046538 Bacteria 3284
371 Ga0495609_0018151 3300046538 Bacteria 3262
372 Ga0495609_0019486 3300046538 Bacteria 3139
373 Ga0495609_0029589 3300046538 Bacteria 2493
374 Ga0495597_0000288 3300046542 Bacteria 45373
375 Ga0495597_0000754 3300046542 Bacteria 25593
376 Ga0495597_0001046 3300046542 Bacteria 21145
377 Ga0495597_0001377 3300046542 Bacteria 17571
378 Ga0495597_0003076 3300046542 Bacteria 10039
379 Ga0495597_0010764 3300046542 Bacteria 4456
380 Ga0495597_0011276 3300046542 Bacteria 4337
381 Ga0495597_0032083 3300046542 Bacteria 2386
382 Ga0495622_0000440 3300046557 Bacteria 26975
383 Ga0495622_0001964 3300046557 Bacteria 10077
384 Ga0495622_0019116 3300046557 Bacteria 3190
385 Ga0495633_0000663 3300046558 Bacteria 31797
386 Ga0495633_0001228 3300046558 Bacteria 20576
387 Ga0495633_0001987 3300046558 Bacteria 14800
388 Ga0495633_0003355 3300046558 Bacteria 10742
389 Ga0495633_0009283 3300046558 Bacteria 5449
390 Ga0495633_0015925 3300046558 Bacteria 3891
391 Ga0495633_0016702 3300046558 Bacteria 3776
392 Ga0495633_0035248 3300046558 Bacteria 2403
393 Ga0495633_0037159 3300046558 Bacteria 2330
394 Ga0495633_0056263 3300046558 Bacteria 1848
395 Ga0495668_0000188 3300046616 Bacteria 92177
396 Ga0495668_0000944 3300046616 Bacteria 32399
397 Ga0495668_0001593 3300046616 Bacteria 21330
398 Ga0495668_0003040 3300046616 Bacteria 13057
399 Ga0495668_0005723 3300046616 Bacteria 8308
400 Ga0495668_0005969 3300046616 Bacteria 8092
401 Ga0495668_0006127 3300046616 Bacteria 7963
402 Ga0495668_0007409 3300046616 Bacteria 7015
403 Ga0495668_0017479 3300046616 Bacteria 4157
404 Ga0495668_0017741 3300046616 Bacteria 4124
405 Ga0495668_0021260 3300046616 Bacteria 3722
406 Ga0495668_0022165 3300046616 Bacteria 3632
407 Ga0495668_0024931 3300046616 Bacteria 3399
408 Ga0495668_0036185 3300046616 Bacteria 2766
409 Ga0495634_0011154 3300046642 Bacteria 6554
410 Ga0495611_0003521 3300046648 Bacteria 6893
411 Ga0495611_0008645 3300046648 Bacteria 4307
412 Ga0495611_0031927 3300046648 Bacteria 2320
413 Ga0495611_0036620 3300046648 Bacteria 2178
414 Ga0495611_0037483 3300046648 Bacteria 2154
415 Ga0495611_0047414 3300046648 Bacteria 1928
416 Ga0495611_0049865 3300046648 Bacteria 1885
417 Ga0495625_0001377 3300046660 Bacteria 29891
418 Ga0495625_0002229 3300046660 Bacteria 21422
419 Ga0495625_0007279 3300046660 Bacteria 9678
420 Ga0495625_0018246 3300046660 Bacteria 5483
421 Ga0495625_0052488 3300046660 Bacteria 2919
422 Ga0495625_0053260 3300046660 Bacteria 2895
423 Ga0495635_0039741 3300046663 Bacteria 3253
424 Ga0495659_0000345 3300046664 Bacteria 18182
425 Ga0495659_0003587 3300046664 Bacteria 4938
426 Ga0495659_0018298 3300046664 Bacteria 2333
427 Ga0495661_0000701 3300046665 Bacteria 33249
428 Ga0495661_0001914 3300046665 Bacteria 16567
429 Ga0495661_0003740 3300046665 Bacteria 11142
430 Ga0495661_0007084 3300046665 Bacteria 7831
431 Ga0495661_0008346 3300046665 Bacteria 7170
432 Ga0495661_0012015 3300046665 Bacteria 5859
433 Ga0495661_0027563 3300046665 Bacteria 3645
434 Ga0495661_0030271 3300046665 Bacteria 3448
435 Ga0495661_0050080 3300046665 Bacteria 2530
436 Ga0495661_0054827 3300046665 Bacteria 2392
437 Ga0495661_0057819 3300046665 Bacteria 2313
438 Ga0495588_0000172 3300046674 Bacteria 81934
439 Ga0495588_0017386 3300046674 Bacteria 3491
440 Ga0495588_0023142 3300046674 Bacteria 3073
441 Ga0495588_0025786 3300046674 Bacteria 2931
442 Ga0495588_0046363 3300046674 Bacteria 2229
443 Ga0495588_0067717 3300046674 Bacteria 1853
444 Ga0495657_0046654 3300046675 Bacteria 2932
445 Ga0495599_0000548 3300046678 Bacteria 21463
446 Ga0495623_0042242 3300046679 Bacteria 2905
447 Ga0495623_0066424 3300046679 Bacteria 2253
448 Ga0495646_0004359 3300046680 Bacteria 8918
449 Ga0495646_0011253 3300046680 Bacteria 5682
450 Ga0495669_0000345 3300046684 Bacteria 24290
451 Ga0495669_0003212 3300046684 Bacteria 6728
452 Ga0495669_0010943 3300046684 Bacteria 3840
453 Ga0495669_0016952 3300046684 Bacteria 3124
454 Ga0495669_0025187 3300046684 Bacteria 2593
455 Ga0495624_0026346 3300046690 Bacteria 3811
456 Ga0495670_0008565 3300046691 Bacteria 5036
457 Ga0495670_0010105 3300046691 Bacteria 4641
458 Ga0495670_0011273 3300046691 Bacteria 4394
459 Ga0495670_0024277 3300046691 Bacteria 2996
460 Ga0495670_0028735 3300046691 Bacteria 2756
461 Ga0495670_0065275 3300046691 Bacteria 1834
462 Ga0495671_0001130 3300046692 Bacteria 18376
463 Ga0495671_0003794 3300046692 Bacteria 9189
464 Ga0495671_0006115 3300046692 Bacteria 6987
465 Ga0495671_0013465 3300046692 Bacteria 4428
466 Ga0495671_0014611 3300046692 Bacteria 4220
467 Ga0495671_0026142 3300046692 Bacteria 3028
468 Ga0495649_0006101 3300046694 Bacteria 7530
469 Ga0495649_0012477 3300046694 Bacteria 4939
470 Ga0495649_0023222 3300046694 Bacteria 3465
471 Ga0495649_0039096 3300046694 Bacteria 2601
472 Ga0495589_0000733 3300046794 Bacteria 21165
473 Ga0495589_0000986 3300046794 Bacteria 17334
474 Ga0495589_0001840 3300046794 Bacteria 12048
475 Ga0495589_0025222 3300046794 Bacteria 3018
476 Ga0495589_0026866 3300046794 Bacteria 2914
477 Ga0495589_0045265 3300046794 Bacteria 2186
478 Ga0495589_0047046 3300046794 Bacteria 2138
479 Ga0495600_0000693 3300046809 Bacteria 17639
480 Ga0495600_0023815 3300046809 Bacteria 3940
481 Ga0495660_0001060 3300046810 Bacteria 19886
482 Ga0495660_0010144 3300046810 Bacteria 5475
483 Ga0495660_0014658 3300046810 Bacteria 4533
484 Ga0495660_0018713 3300046810 Bacteria 3978
485 Ga0495660_0030299 3300046810 Bacteria 3048
486 Ga0495660_0042283 3300046810 Bacteria 2519
487 Ga0495660_0076761 3300046810 Bacteria 1759
488 Ga0495581_0023785 3300047315 Bacteria 3550
489 Ga0495581_0026084 3300047315 Bacteria 3389
490 Ga0495604_0019774 3300047317 Bacteria 5387
491 Ga0495604_0031201 3300047317 Bacteria 4228
492 Ga0495636_0001239 3300047318 Bacteria 9652
493 Ga0495636_0008533 3300047318 Bacteria 4043
494 Ga0495636_0009579 3300047318 Bacteria 3815
495 Ga0495674_0009946 3300047319 Bacteria 9019
496 Ga0495672_0000019 3300047320 Bacteria 448153
497 Ga0495672_0000859 3300047320 Bacteria 32082
498 Ga0495672_0001040 3300047320 Bacteria 28407
499 Ga0495672_0001173 3300047320 Bacteria 26565
500 Ga0495672_0001685 3300047320 Bacteria 21405
501 Ga0495672_0006826 3300047320 Bacteria 8722
502 Ga0495672_0029389 3300047320 Bacteria 3461
503 Ga0495672_0068974 3300047320 Bacteria 2008
504 Ga0495676_0000972 3300047321 Bacteria 24006
505 Ga0495676_0035194 3300047321 Bacteria 4191
506 Ga0495676_0035928 3300047321 Bacteria 4142
507 Ga0495676_0038611 3300047321 Bacteria 3964
508 Ga0495676_0052653 3300047321 Bacteria 3247
509 Ga0495680_0007712 3300047322 Bacteria 9828
510 Ga0495683_0000692 3300047323 Bacteria 24644
511 Ga0495683_0003705 3300047323 Bacteria 8849
512 Ga0495683_0003886 3300047323 Bacteria 8592
513 Ga0495683_0012603 3300047323 Bacteria 4439
514 Ga0495683_0026942 3300047323 Bacteria 2940
515 Ga0495683_0064256 3300047323 Bacteria 1812
516 Ga0495687_000405 3300047443 Bacteria 53349
517 Ga0495687_000801 3300047443 Bacteria 33906
518 Ga0495687_001993 3300047443 Bacteria 17334
519 Ga0495687_005076 3300047443 Bacteria 8543
520 Ga0495687_005120 3300047443 Bacteria 8487
521 Ga0495687_005264 3300047443 Bacteria 8312
522 Ga0495687_005317 3300047443 Bacteria 8255
523 Ga0495687_008736 3300047443 Bacteria 5753
524 Ga0495687_017089 3300047443 Bacteria 3631
525 Ga0495675_0019271 3300047444 Bacteria 4334
526 Ga0495677_0000527 3300047445 Bacteria 15974
527 Ga0495677_0003170 3300047445 Bacteria 6414
528 Ga0495677_0009195 3300047445 Bacteria 3651
529 Ga0495679_018845 3300047446 Bacteria 2439
530 Ga0495679_021744 3300047446 Bacteria 2207
531 Ga0495679_023405 3300047446 Bacteria 2095
532 Ga0495685_000157 3300047447 Bacteria 23115
533 Ga0495685_006353 3300047447 Bacteria 3864
534 Ga0495685_008725 3300047447 Bacteria 3375
535 Ga0495685_013537 3300047447 Bacteria 2769
536 Ga0495673_0000012 3300047469 Bacteria 656908
537 Ga0495673_0000604 3300047469 Bacteria 35726
538 Ga0495673_0000925 3300047469 Bacteria 26621
539 Ga0495681_0008029 3300047470 Bacteria 6657
540 Ga0495681_0010291 3300047470 Bacteria 5667
541 Ga0495681_0012752 3300047470 Bacteria 4920
542 Ga0495681_0025206 3300047470 Bacteria 3115
543 Ga0495681_0025984 3300047470 Bacteria 3057
544 Ga0495681_0029571 3300047470 Bacteria 2802
545 Ga0495681_0040177 3300047470 Bacteria 2279
546 Ga0495686_0005894 3300047472 Bacteria 9551
547 Ga0495686_0006159 3300047472 Bacteria 9273
548 Ga0495686_0006674 3300047472 Bacteria 8787
549 Ga0495686_0038904 3300047472 Bacteria 3040
550 Ga0495593_0008563 3300047673 Bacteria 5949
551 Ga0495593_0047816 3300047673 Bacteria 2274
552 Ga0495602_0032543 3300048088 Bacteria 4907
553 Ga0495602_0040161 3300048088 Bacteria 4296
554 Ga0495602_0057841 3300048088 Bacteria 3398
555 Ga0495602_0182991 3300048088 Bacteria 1614
556 Ga0495614_0001278 3300048089 Bacteria 10823
557 Ga0495626_0000005 3300048091 Bacteria 337534
558 Ga0495626_0001243 3300048091 Bacteria 20917
559 Ga0495626_0001440 3300048091 Bacteria 18927
560 Ga0495626_0001722 3300048091 Bacteria 16733
561 Ga0495626_0008571 3300048091 Bacteria 5591
562 Ga0495626_0009225 3300048091 Bacteria 5338
563 Ga0495626_0009230 3300048091 Bacteria 5336
564 Ga0495626_0018816 3300048091 Bacteria 3460
565 Ga0495626_0028198 3300048091 Bacteria 2724
566 Ga0495626_0031674 3300048091 Bacteria 2543
567 Ga0495626_0040257 3300048091 Bacteria 2208
568 Ga0495626_0041634 3300048091 Bacteria 2161
569 Ga0495626_0042191 3300048091 Bacteria 2144
570 Ga0495626_0050730 3300048091 Bacteria 1916
571 Ga0495626_0055591 3300048091 Bacteria 1813
572 Ga0496101_0031771 3300048904 Bacteria 3713
573 Ga0496101_0044087 3300048904 Bacteria 3191
574 Ga0496102_0000082 3300048905 Bacteria 139079
575 Ga0496102_0001712 3300048905 Bacteria 19183
576 Ga0496102_0015984 3300048905 Bacteria 6550
577 Ga0496102_0060081 3300048905 Bacteria 3477
578 Ga0496103_0062805 3300048906 Bacteria 2313
579 Ga0496103_0095651 3300048906 Bacteria 1877
580 Ga0496104_0158749 3300048907 Bacteria 2170
581 Ga0496105_0082523 3300048908 Bacteria 2655
582 Ga0496106_0170774 3300048909 Bacteria 1723
583 Ga0496107_0091869 3300048910 Bacteria 2219
584 Ga0496107_0097410 3300048910 Bacteria 2153
585 Ga0496107_0118093 3300048910 Bacteria 1953
586 Ga0496110_0000659 3300048913 Bacteria 23577
587 Ga0496110_0043460 3300048913 Bacteria 3923
588 Ga0496111_0002899 3300048914 Bacteria 10473
589 Ga0496112_0136023 3300048915 Bacteria 2428
590 Ga0496113_0033743 3300048916 Bacteria 3729
591 Ga0496115_0025298 3300048918 Bacteria 4621
592 Ga0496115_0080112 3300048918 Bacteria 2659
593 Ga0496116_0051207 3300048919 Bacteria 2745
594 Ga0496116_0071036 3300048919 Bacteria 2206
595 Ga0496117_0000075 3300048920 Bacteria 232451
596 Ga0496118_0000055 3300048921 Bacteria 232451
597 Ga0496121_0003786 3300048924 Bacteria 21109
598 Ga0496121_0008034 3300048924 Bacteria 12578
599 Ga0496121_0123103 3300048924 Bacteria 1955
600 Ga0496122_0003341 3300048925 Bacteria 21160
601 Ga0496122_0007255 3300048925 Bacteria 12398
602 Ga0496122_0011140 3300048925 Bacteria 9158
603 Ga0496123_0006778 3300048926 Bacteria 11006
604 Ga0496123_0007415 3300048926 Bacteria 10343
605 Ga0496123_0009556 3300048926 Bacteria 8717
606 Ga0496123_0022950 3300048926 Bacteria 4792
607 Ga0496124_0013871 3300048927 Bacteria 7837
608 Ga0496124_0021994 3300048927 Bacteria 5862
609 Ga0496124_0033769 3300048927 Bacteria 4497
610 Ga0496124_0112903 3300048927 Bacteria 2184
611 Ga0496125_0000487 3300048928 Bacteria 69494
612 Ga0496125_0011120 3300048928 Bacteria 9027
613 Ga0496125_0126119 3300048928 Bacteria 1814
614 Ga0496126_0094685 3300048929 Bacteria 2621
615 Ga0496126_0162934 3300048929 Bacteria 1904
616 Ga0495678_000027 3300049459 Bacteria 222075
617 Ga0495678_001082 3300049459 Bacteria 23004
618 Ga0495678_001136 3300049459 Bacteria 22114
619 Ga0495678_001459 3300049459 Bacteria 18557
620 Ga0495678_002154 3300049459 Bacteria 13912
621 Ga0495678_004343 3300049459 Bacteria 8245
622 Ga0495678_006992 3300049459 Bacteria 5918
623 Ga0495678_012018 3300049459 Bacteria 4120
624 Ga0495678_012665 3300049459 Bacteria 3989
625 Ga0495678_023500 3300049459 Bacteria 2677
626 Ga0495682_0001880 3300049460 Bacteria 10462
627 Ga0495682_0004649 3300049460 Bacteria 5825
628 Ga0495682_0007972 3300049460 Bacteria 4186
629 Ga0495682_0017797 3300049460 Bacteria 2678
630 Ga0501034_0145341 3300049571 Bacteria 2349
631 Ga0501269_000385 3300049766 Bacteria 10570
632 Ga0501279_000681 3300049775 Bacteria 4452
633 Ga0501035_0009455 3300049822 Bacteria 9064
634 Ga0500594_0003545 3300053118 Bacteria 3435
635 Ga0500595_000862 3300053119 Bacteria 17316
636 Ga0500618_018130 3300053125 Bacteria 1743
637 Ga0500574_000191 3300053141 Bacteria 7225
638 Ga0500586_000619 3300053145 Bacteria 7214
639 Ga0500586_049295 3300053145 Bacteria 1449
640 Ga0500619_000200 3300053154 Bacteria 13776
641 Ga0587068_002129 3300059641 Bacteria 2365
642 Ga0466962_0039282 3300061719 Bacteria 2267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0001228 Ga0495633_0001228_568_1965 462
2 3300053145 Ga0500586_049295 Ga0500586_049295_25_1422 462
3 3300046507 Ga0495606_0002381 Ga0495606_0002381_20135_21535 463
4 3300046558 Ga0495633_0015925 Ga0495633_0015925_2159_3559 463
5 3300048928 Ga0496125_0126119 Ga0496125_0126119_256_1656 463
6 3300044765 Ga0466970_0018709 Ga0466970_0018709_1282_2766 465
7 3300045049 Ga0466959_0002186 Ga0466959_0002186_3059_4543 465
8 3300047472 Ga0495686_0038904 Ga0495686_0038904_1196_2764 469
9 3300046492 Ga0495585_0011361 Ga0495585_0011361_339_1763 471
10 3300047323 Ga0495683_0012603 Ga0495683_0012603_2649_4073 471
11 3300047446 Ga0495679_023405 Ga0495679_023405_265_1689 471
12 3300047469 Ga0495673_0000925 Ga0495673_0000925_355_1779 471
13 3300005339 Ga0070660_100002856 Ga0070660_1000028566 472
14 3300005344 Ga0070661_100007701 Ga0070661_1000077017 472
15 3300005366 Ga0070659_100004956 Ga0070659_1000049567 472
16 3300025919 Ga0207657_10018511 Ga0207657_100185116 472
17 3300025920 Ga0207649_10025866 Ga0207649_100258664 472
18 3300025932 Ga0207690_10013185 Ga0207690_100131856 472
19 3300046518 Ga0495631_0032702 Ga0495631_0032702_398_1909 474
20 3300047321 Ga0495676_0038611 Ga0495676_0038611_2011_3498 474
21 3300049459 Ga0495678_004343 Ga0495678_004343_635_2146 474
22 3300049460 Ga0495682_0004649 Ga0495682_0004649_3734_5245 474
23 3300048905 Ga0496102_0015984 Ga0496102_0015984_364_1836 476
24 3300061719 Ga0466962_0039282 Ga0466962_0039282_655_2133 476
25 3300044712 Ga0453684_0029009 Ga0453684_0029009_223_1740 478
26 3300046679 Ga0495623_0042242 Ga0495623_0042242_13_1449 478
27 3300046500 Ga0495596_0005660 Ga0495596_0005660_339_1856 479
28 3300046522 Ga0495643_0033135 Ga0495643_0033135_291_1808 479
29 3300003771 Ga0055526_1000149 Ga0055526_10001497 480
30 3300025295 Ga0209564_1000010 Ga0209564_1000010782 480
31 3300046471 Ga0495650_0027270 Ga0495650_0027270_792_2273 480
32 3300046491 Ga0495584_0004486 Ga0495584_0004486_356_1837 480
33 3300046538 Ga0495609_0008725 Ga0495609_0008725_396_1877 480
34 3300046538 Ga0495609_0017938 Ga0495609_0017938_1514_3007 480
35 3300046542 Ga0495597_0000754 Ga0495597_0000754_517_2010 480
36 3300047447 Ga0495685_013537 Ga0495685_013537_909_2390 480
37 3300047470 Ga0495681_0010291 Ga0495681_0010291_334_1827 480
38 3300048906 Ga0496103_0062805 Ga0496103_0062805_382_1875 480
39 3300005262 Ga0065165_1001081 Ga0065165_100108133 481
40 3300044842 Ga0466957_0079753 Ga0466957_0079753_90_1715 481
41 3300046457 Ga0495590_0000009 Ga0495590_0000009_318547_320028 481
42 3300046458 Ga0495591_000867 Ga0495591_000867_19363_20844 481
43 3300046474 Ga0495605_0005989 Ga0495605_0005989_4962_6443 481
44 3300046474 Ga0495605_0060256 Ga0495605_0060256_182_1693 481
45 3300046491 Ga0495584_0001978 Ga0495584_0001978_542_2023 481
46 3300046501 Ga0495607_0002568 Ga0495607_0002568_397_1878 481
47 3300046506 Ga0495583_0005584 Ga0495583_0005584_6575_8056 481
48 3300046506 Ga0495583_0023988 Ga0495583_0023988_1288_2769 481
49 3300046512 Ga0495610_0007708 Ga0495610_0007708_363_1844 481
50 3300046513 Ga0495616_0006198 Ga0495616_0006198_118_1599 481
51 3300046518 Ga0495631_0016477 Ga0495631_0016477_1681_3162 481
52 3300046519 Ga0495632_0041955 Ga0495632_0041955_398_1879 481
53 3300046520 Ga0495637_0000003 Ga0495637_0000003_482_1963 481
54 3300046522 Ga0495643_0029050 Ga0495643_0029050_346_1827 481
55 3300046524 Ga0495648_0048992 Ga0495648_0048992_585_2066 481
56 3300046538 Ga0495609_0012599 Ga0495609_0012599_585_2072 481
57 3300046558 Ga0495633_0003355 Ga0495633_0003355_8907_10388 481
58 3300046616 Ga0495668_0036185 Ga0495668_0036185_329_1810 481
59 3300046648 Ga0495611_0003521 Ga0495611_0003521_363_1844 481
60 3300046665 Ga0495661_0003740 Ga0495661_0003740_398_1879 481
61 3300046691 Ga0495670_0011273 Ga0495670_0011273_2678_4159 481
62 3300046694 Ga0495649_0006101 Ga0495649_0006101_581_2062 481
63 3300046694 Ga0495649_0023222 Ga0495649_0023222_468_2039 481
64 3300046794 Ga0495589_0047046 Ga0495589_0047046_404_1885 481
65 3300047320 Ga0495672_0001173 Ga0495672_0001173_24687_26168 481
66 3300047323 Ga0495683_0003886 Ga0495683_0003886_522_2003 481
67 3300047446 Ga0495679_018845 Ga0495679_018845_354_1835 481
68 3300047470 Ga0495681_0025984 Ga0495681_0025984_354_1835 481
69 3300047472 Ga0495686_0006159 Ga0495686_0006159_405_1907 481
70 3300048091 Ga0495626_0009230 Ga0495626_0009230_354_1835 481
71 3300048091 Ga0495626_0041634 Ga0495626_0041634_92_1603 481
72 3300048091 Ga0495626_0042191 Ga0495626_0042191_296_1798 481
73 3300049459 Ga0495678_001459 Ga0495678_001459_398_1879 481
74 3300049460 Ga0495682_0017797 Ga0495682_0017797_817_2319 481
75 3300047319 Ga0495674_0009946 Ga0495674_0009946_352_1836 482
76 3300047323 Ga0495683_0064256 Ga0495683_0064256_253_1740 482
77 3300048091 Ga0495626_0031674 Ga0495626_0031674_762_2279 482
78 iso_pu_bacteria 2738541280 2738742650 482
79 iso_pu_bacteria 2738541300 2738842336 482
80 iso_pu_bacteria 2738543018 2739273090 482
81 iso_pu_bacteria 2738543030 2739342134 482
82 3300046471 Ga0495650_0001553 Ga0495650_0001553_523_2019 483
83 3300046500 Ga0495596_0017984 Ga0495596_0017984_1040_2536 483
84 3300046519 Ga0495632_0001345 Ga0495632_0001345_482_1993 483
85 3300046536 Ga0495587_0107167 Ga0495587_0107167_45_1532 483
86 3300046538 Ga0495609_0001172 Ga0495609_0001172_16148_17644 483
87 3300046665 Ga0495661_0027563 Ga0495661_0027563_1554_3065 483
88 3300046694 Ga0495649_0039096 Ga0495649_0039096_701_2212 483
89 3300047320 Ga0495672_0001685 Ga0495672_0001685_611_2107 483
90 3300047470 Ga0495681_0040177 Ga0495681_0040177_274_1785 483
91 3300048910 Ga0496107_0097410 Ga0496107_0097410_342_1838 483
92 3300048913 Ga0496110_0000659 Ga0496110_0000659_19418_20914 483
93 3300048918 Ga0496115_0025298 Ga0496115_0025298_2763_4250 483
94 3300048918 Ga0496115_0080112 Ga0496115_0080112_316_1797 483
95 iso_pu_bacteria 2643221638 2644214235 483
96 iso_pu_bacteria 2643221645 2644251734 483
97 iso_pu_bacteria 2643221664 2644356090 483
98 iso_pu_bacteria 2738541297 2738826022 483
99 iso_pu_bacteria 2738541357 2739149819 483
100 iso_pu_bacteria 2738543003 2739191738 483
101 iso_pu_bacteria 2738543026 2739318215 483
102 iso_pu_bacteria 2738543029 2739336456 483
103 iso_pu_bacteria 2821131069 2821136357 483
104 iso_pu_bacteria 2842711865 2842717660 483
105 iso_pu_bacteria 2857553236 2857558089 483
106 iso_pu_bacteria 2857558681 2857563437 483
107 iso_pu_bacteria 2857564685 2857570406 483
108 iso_pu_bacteria 2904424332 2904428541 483
109 iso_pu_bacteria 2919476304 2919476305 483
110 3300046452 Ga0495617_000010 Ga0495617_000010_536_2035 484
111 3300046453 Ga0495627_000690 Ga0495627_000690_23954_25453 484
112 3300046455 Ga0495603_0033142 Ga0495603_0033142_1252_2751 484
113 3300046459 Ga0495629_0034848 Ga0495629_0034848_1883_3400 484
114 3300046460 Ga0495638_0018956 Ga0495638_0018956_2659_4158 484
115 3300046463 Ga0495653_0021789 Ga0495653_0021789_292_1791 484
116 3300046463 Ga0495653_0048941 Ga0495653_0048941_243_1760 484
117 3300046474 Ga0495605_0001966 Ga0495605_0001966_11128_12627 484
118 3300046491 Ga0495584_0007603 Ga0495584_0007603_3790_5289 484
119 3300046491 Ga0495584_0026964 Ga0495584_0026964_80_1567 484
120 3300046491 Ga0495584_0044137 Ga0495584_0044137_526_2013 484
121 3300046491 Ga0495584_0070975 Ga0495584_0070975_221_1720 484
122 3300046492 Ga0495585_0001417 Ga0495585_0001417_416_1903 484
123 3300046492 Ga0495585_0022517 Ga0495585_0022517_329_1828 484
124 3300046499 Ga0495594_0034582 Ga0495594_0034582_1119_2606 484
125 3300046499 Ga0495594_0060757 Ga0495594_0060757_491_2002 484
126 3300046500 Ga0495596_0003154 Ga0495596_0003154_318_1817 484
127 3300046500 Ga0495596_0029258 Ga0495596_0029258_153_1904 484
128 3300046501 Ga0495607_0016975 Ga0495607_0016975_392_1891 484
129 3300046501 Ga0495607_0055384 Ga0495607_0055384_436_1935 484
130 3300046506 Ga0495583_0005015 Ga0495583_0005015_532_2031 484
131 3300046506 Ga0495583_0015248 Ga0495583_0015248_2117_3616 484
132 3300046506 Ga0495583_0024089 Ga0495583_0024089_556_2055 484
133 3300046513 Ga0495616_0001268 Ga0495616_0001268_398_1897 484
134 3300046513 Ga0495616_0039681 Ga0495616_0039681_559_2058 484
135 3300046513 Ga0495616_0045400 Ga0495616_0045400_149_1636 484
136 3300046518 Ga0495631_0000869 Ga0495631_0000869_16975_18474 484
137 3300046519 Ga0495632_0007159 Ga0495632_0007159_562_2061 484
138 3300046519 Ga0495632_0016710 Ga0495632_0016710_396_1895 484
139 3300046520 Ga0495637_0008969 Ga0495637_0008969_2847_4346 484
140 3300046522 Ga0495643_0006489 Ga0495643_0006489_68_1567 484
141 3300046522 Ga0495643_0064493 Ga0495643_0064493_162_1649 484
142 3300046522 Ga0495643_0071994 Ga0495643_0071994_110_1597 484
143 3300046523 Ga0495644_0028801 Ga0495644_0028801_501_2012 484
144 3300046524 Ga0495648_0003783 Ga0495648_0003783_536_2035 484
145 3300046524 Ga0495648_0063249 Ga0495648_0063249_32_1519 484
146 3300046526 Ga0495666_0005811 Ga0495666_0005811_305_1822 484
147 3300046526 Ga0495666_0016084 Ga0495666_0016084_233_1750 484
148 3300046528 Ga0495642_0001015 Ga0495642_0001015_11152_12651 484
149 3300046528 Ga0495642_0012745 Ga0495642_0012745_424_1923 484
150 3300046528 Ga0495642_0012999 Ga0495642_0012999_1382_2881 484
151 3300046528 Ga0495642_0030631 Ga0495642_0030631_409_1920 484
152 3300046530 Ga0495654_0012652 Ga0495654_0012652_420_1919 484
153 3300046530 Ga0495654_0037648 Ga0495654_0037648_433_1932 484
154 3300046531 Ga0495665_0006918 Ga0495665_0006918_286_1803 484
155 3300046531 Ga0495665_0036121 Ga0495665_0036121_214_1731 484
156 3300046535 Ga0495586_0018444 Ga0495586_0018444_244_1743 484
157 3300046535 Ga0495586_0054080 Ga0495586_0054080_317_1834 484
158 3300046542 Ga0495597_0001046 Ga0495597_0001046_19355_20968 484
159 3300046542 Ga0495597_0001377 Ga0495597_0001377_15769_17256 484
160 3300046542 Ga0495597_0010764 Ga0495597_0010764_327_1826 484
161 3300046542 Ga0495597_0011276 Ga0495597_0011276_554_2053 484
162 3300046557 Ga0495622_0019116 Ga0495622_0019116_268_1785 484
163 3300046558 Ga0495633_0016702 Ga0495633_0016702_343_1854 484
164 3300046616 Ga0495668_0003040 Ga0495668_0003040_11126_12625 484
165 3300046616 Ga0495668_0005969 Ga0495668_0005969_302_1801 484
166 3300046616 Ga0495668_0021260 Ga0495668_0021260_299_1798 484
167 3300046616 Ga0495668_0022165 Ga0495668_0022165_357_2003 484
168 3300046616 Ga0495668_0024931 Ga0495668_0024931_363_1862 484
169 3300046648 Ga0495611_0031927 Ga0495611_0031927_542_2029 484
170 3300046648 Ga0495611_0036620 Ga0495611_0036620_190_1689 484
171 3300046648 Ga0495611_0037483 Ga0495611_0037483_138_1637 484
172 3300046660 Ga0495625_0018246 Ga0495625_0018246_3426_4925 484
173 3300046665 Ga0495661_0001914 Ga0495661_0001914_507_2006 484
174 3300046665 Ga0495661_0007084 Ga0495661_0007084_285_1796 484
175 3300046665 Ga0495661_0030271 Ga0495661_0030271_1583_3121 484
176 3300046674 Ga0495588_0017386 Ga0495588_0017386_1732_3231 484
177 3300046674 Ga0495588_0023142 Ga0495588_0023142_123_1640 484
178 3300046674 Ga0495588_0025786 Ga0495588_0025786_893_2392 484
179 3300046674 Ga0495588_0067717 Ga0495588_0067717_38_1525 484
180 3300046684 Ga0495669_0000345 Ga0495669_0000345_22183_23934 484
181 3300046684 Ga0495669_0003212 Ga0495669_0003212_4971_6458 484
182 3300046684 Ga0495669_0010943 Ga0495669_0010943_580_2079 484
183 3300046684 Ga0495669_0025187 Ga0495669_0025187_845_2344 484
184 3300046690 Ga0495624_0026346 Ga0495624_0026346_1992_3509 484
185 3300046691 Ga0495670_0008565 Ga0495670_0008565_355_1854 484
186 3300046692 Ga0495671_0003794 Ga0495671_0003794_7362_8861 484
187 3300046692 Ga0495671_0013465 Ga0495671_0013465_489_1988 484
188 3300046692 Ga0495671_0026142 Ga0495671_0026142_1132_2766 484
189 3300046694 Ga0495649_0012477 Ga0495649_0012477_340_1839 484
190 3300046794 Ga0495589_0000733 Ga0495589_0000733_283_1896 484
191 3300046794 Ga0495589_0025222 Ga0495589_0025222_1207_2706 484
192 3300046794 Ga0495589_0045265 Ga0495589_0045265_252_1751 484
193 3300046809 Ga0495600_0023815 Ga0495600_0023815_179_1696 484
194 3300046810 Ga0495660_0014658 Ga0495660_0014658_230_1729 484
195 3300047315 Ga0495581_0026084 Ga0495581_0026084_1560_3077 484
196 3300047317 Ga0495604_0031201 Ga0495604_0031201_214_1731 484
197 3300047318 Ga0495636_0001239 Ga0495636_0001239_7668_9155 484
198 3300047320 Ga0495672_0006826 Ga0495672_0006826_382_2055 484
199 3300047321 Ga0495676_0000972 Ga0495676_0000972_22110_23609 484
200 3300047321 Ga0495676_0052653 Ga0495676_0052653_454_1941 484
201 3300047322 Ga0495680_0007712 Ga0495680_0007712_8178_9677 484
202 3300047323 Ga0495683_0026942 Ga0495683_0026942_437_1936 484
203 3300047443 Ga0495687_005264 Ga0495687_005264_202_1848 484
204 3300047443 Ga0495687_008736 Ga0495687_008736_3869_5368 484
205 3300047446 Ga0495679_021744 Ga0495679_021744_324_1823 484
206 3300047447 Ga0495685_008725 Ga0495685_008725_290_1789 484
207 3300047470 Ga0495681_0012752 Ga0495681_0012752_3086_4585 484
208 3300047470 Ga0495681_0029571 Ga0495681_0029571_734_2233 484
209 3300047673 Ga0495593_0008563 Ga0495593_0008563_317_1816 484
210 3300047673 Ga0495593_0047816 Ga0495593_0047816_159_1676 484
211 3300048088 Ga0495602_0040161 Ga0495602_0040161_817_2334 484
212 3300048089 Ga0495614_0001278 Ga0495614_0001278_343_1842 484
213 3300048091 Ga0495626_0009225 Ga0495626_0009225_3511_4998 484
214 3300048091 Ga0495626_0018816 Ga0495626_0018816_1617_3116 484
215 3300048091 Ga0495626_0028198 Ga0495626_0028198_586_2073 484
216 3300048091 Ga0495626_0040257 Ga0495626_0040257_224_1723 484
217 3300048091 Ga0495626_0050730 Ga0495626_0050730_10_1761 484
218 3300048904 Ga0496101_0031771 Ga0496101_0031771_311_1849 484
219 3300048905 Ga0496102_0001712 Ga0496102_0001712_17322_18821 484
220 3300048925 Ga0496122_0011140 Ga0496122_0011140_7187_8686 484
221 3300048926 Ga0496123_0007415 Ga0496123_0007415_8508_10007 484
222 3300048928 Ga0496125_0011120 Ga0496125_0011120_363_1862 484
223 3300049459 Ga0495678_001136 Ga0495678_001136_19756_21255 484
224 3300049459 Ga0495678_006992 Ga0495678_006992_374_2020 484
225 3300037418 Ga0395900_0020705 Ga0395900_0020705_286_1779 485
226 3300046507 Ga0495606_0000428 Ga0495606_0000428_481_2004 485
227 3300046526 Ga0495666_0061554 Ga0495666_0061554_211_1704 485
228 iso_pu_bacteria 2643221556 2643801145 485
229 iso_pu_bacteria 2643221684 2644471863 485
230 iso_pu_bacteria 8047673197 8047675460 485
231 3300002987 JGI25159J45721_1002946 JGI25159J45721_10029461 486
232 3300003771 Ga0055526_1001207 Ga0055526_100120720 486
233 3300003773 Ga0055537_1000578 Ga0055537_10005781 486
234 3300003775 Ga0055524_1000124 Ga0055524_10001241 486
235 3300003784 Ga0055534_1000489 Ga0055534_100048922 486
236 3300003790 Ga0055528_1000575 Ga0055528_10005751 486
237 3300005262 Ga0065165_1000167 Ga0065165_100016793 486
238 3300006948 Ga0099826_10002381 Ga0099826_100023812 486
239 3300025263 Ga0209565_1000112 Ga0209565_100011284 486
240 3300025263 Ga0209565_1014389 Ga0209565_10143891 486
241 3300025273 Ga0209673_1000210 Ga0209673_10002103 486
242 3300025284 Ga0209130_1000016 Ga0209130_1000016346 486
243 3300025291 Ga0209675_1000761 Ga0209675_10007613 486
244 3300025295 Ga0209564_1000245 Ga0209564_10002452 486
245 3300025295 Ga0209564_1020018 Ga0209564_10200181 486
246 3300025299 Ga0209256_1000268 Ga0209256_100026882 486
247 3300025299 Ga0209256_1001618 Ga0209256_100161821 486
248 3300027666 Ga0209282_1000066 Ga0209282_10000662 486
249 3300044735 Ga0466968_0047929 Ga0466968_0047929_170_1630 486
250 3300046501 Ga0495607_0005622 Ga0495607_0005622_320_1792 486
251 3300046506 Ga0495583_0028401 Ga0495583_0028401_320_1792 486
252 3300046507 Ga0495606_0007799 Ga0495606_0007799_136_1611 486
253 3300046530 Ga0495654_0034903 Ga0495654_0034903_836_2311 486
254 3300046538 Ga0495609_0000736 Ga0495609_0000736_22863_24335 486
255 3300046616 Ga0495668_0000188 Ga0495668_0000188_90521_91993 486
256 3300046660 Ga0495625_0052488 Ga0495625_0052488_1124_2599 486
257 3300046664 Ga0495659_0000345 Ga0495659_0000345_16387_17862 486
258 3300046664 Ga0495659_0018298 Ga0495659_0018298_542_2014 486
259 3300046684 Ga0495669_0016952 Ga0495669_0016952_157_1629 486
260 3300046692 Ga0495671_0001130 Ga0495671_0001130_461_1936 486
261 3300046810 Ga0495660_0042283 Ga0495660_0042283_305_1780 486
262 3300047320 Ga0495672_0000859 Ga0495672_0000859_30287_31762 486
263 3300047472 Ga0495686_0005894 Ga0495686_0005894_7896_9368 486
264 3300048928 Ga0496125_0000487 Ga0496125_0000487_34119_35618 486
265 3300049459 Ga0495678_023500 Ga0495678_023500_934_2406 486
266 iso_pu_bacteria 2600255292 2601666987 486
267 iso_pu_bacteria 2857547612 2857552881 486
268 iso_pu_bacteria 2885080285 2885083899 486
269 iso_pu_bacteria 2932410948 2932415543 486
270 iso_pu_bacteria 2932416698 2932421533 486
271 3300002774 JGI25150J39212_1003512 JGI25150J39212_10035121 487
272 3300003215 JGI25153J46596_10018066 JGI25153J46596_100180662 487
273 3300003374 JGI25161J50226_1001616 JGI25161J50226_10016166 487
274 3300003771 Ga0055526_1005381 Ga0055526_10053811 487
275 3300003773 Ga0055537_1006621 Ga0055537_10066212 487
276 3300003773 Ga0055537_1011931 Ga0055537_10119311 487
277 3300003775 Ga0055524_1013278 Ga0055524_10132783 487
278 3300003791 Ga0055530_10004148 Ga0055530_100041488 487
279 3300003794 Ga0055531_10006260 Ga0055531_100062601 487
280 3300003794 Ga0055531_10028577 Ga0055531_100285772 487
281 3300004625 Ga0055543_1002129 Ga0055543_10021291 487
282 3300005262 Ga0065165_1005706 Ga0065165_10057067 487
283 3300015261 Ga0182006_1000216 Ga0182006_10002162 487
284 3300015265 Ga0182005_1000119 Ga0182005_10001192 487
285 3300025208 Ga0209436_101730 Ga0209436_1017302 487
286 3300025245 Ga0207425_1000493 Ga0207425_100049325 487
287 3300025245 Ga0207425_1000761 Ga0207425_10007612 487
288 3300025246 Ga0209646_1000384 Ga0209646_10003847 487
289 3300025258 Ga0209129_1000600 Ga0209129_100060025 487
290 3300025258 Ga0209129_1004176 Ga0209129_10041762 487
291 3300025263 Ga0209565_1002964 Ga0209565_10029646 487
292 3300025263 Ga0209565_1014178 Ga0209565_10141781 487
293 3300025284 Ga0209130_1002714 Ga0209130_10027149 487
294 3300025284 Ga0209130_1003164 Ga0209130_10031642 487
295 3300025284 Ga0209130_1004431 Ga0209130_10044311 487
296 3300025291 Ga0209675_1003306 Ga0209675_10033068 487
297 3300025291 Ga0209675_1013045 Ga0209675_10130451 487
298 3300025291 Ga0209675_1017794 Ga0209675_10177942 487
299 3300025295 Ga0209564_1002064 Ga0209564_10020641 487
300 3300025297 Ga0209758_1001720 Ga0209758_100172025 487
301 3300025298 Ga0209050_1000086 Ga0209050_1000086232 487
302 3300025298 Ga0209050_1002207 Ga0209050_10022072 487
303 3300025299 Ga0209256_1002073 Ga0209256_100207319 487
304 3300025299 Ga0209256_1002630 Ga0209256_10026301 487
305 3300025299 Ga0209256_1007095 Ga0209256_10070952 487
306 3300025303 Ga0209051_1006544 Ga0209051_10065441 487
307 3300025304 Ga0209257_1006299 Ga0209257_10062998 487
308 3300025304 Ga0209257_1007877 Ga0209257_10078776 487
309 3300027111 Ga0209281_1011138 Ga0209281_10111381 487
310 3300028794 Ga0307515_10099073 Ga0307515_100990732 487
311 3300031548 Ga0307408_100001878 Ga0307408_1000018782 487
312 3300031548 Ga0307408_100006441 Ga0307408_1000064412 487
313 3300031548 Ga0307408_100013856 Ga0307408_1000138561 487
314 3300031548 Ga0307408_100048403 Ga0307408_1000484032 487
315 3300037312 Ga0395899_0001822 Ga0395899_0001822_12934_14454 487
316 3300037471 Ga0395905_0055021 Ga0395905_0055021_696_2216 487
317 3300038443 Ga0395901_0006884 Ga0395901_0006884_1353_2843 487
318 3300039447 Ga0436361_0108001 Ga0436361_0108001_20240_21742 487
319 3300046452 Ga0495617_000471 Ga0495617_000471_19757_21229 487
320 3300046452 Ga0495617_013939 Ga0495617_013939_68_1552 487
321 3300046453 Ga0495627_000378 Ga0495627_000378_494_1966 487
322 3300046457 Ga0495590_0000201 Ga0495590_0000201_1517_2989 487
323 3300046460 Ga0495638_0004523 Ga0495638_0004523_8717_10198 487
324 3300046463 Ga0495653_0000959 Ga0495653_0000959_20311_21783 487
325 3300046471 Ga0495650_0003201 Ga0495650_0003201_420_1892 487
326 3300046474 Ga0495605_0004232 Ga0495605_0004232_6633_8114 487
327 3300046474 Ga0495605_0024319 Ga0495605_0024319_1406_2881 487
328 3300046491 Ga0495584_0014663 Ga0495584_0014663_338_1819 487
329 3300046492 Ga0495585_0046854 Ga0495585_0046854_233_1717 487
330 3300046501 Ga0495607_0001154 Ga0495607_0001154_20896_22368 487
331 3300046501 Ga0495607_0005305 Ga0495607_0005305_533_2008 487
332 3300046506 Ga0495583_0000952 Ga0495583_0000952_30632_32104 487
333 3300046506 Ga0495583_0001555 Ga0495583_0001555_242_1723 487
334 3300046507 Ga0495606_0001517 Ga0495606_0001517_29011_30483 487
335 3300046507 Ga0495606_0001842 Ga0495606_0001842_1466_2938 487
336 3300046507 Ga0495606_0001977 Ga0495606_0001977_23305_24777 487
337 3300046507 Ga0495606_0004131 Ga0495606_0004131_12885_14357 487
338 3300046512 Ga0495610_0003364 Ga0495610_0003364_6038_7510 487
339 3300046513 Ga0495616_0059304 Ga0495616_0059304_59_1540 487
340 3300046513 Ga0495616_0060690 Ga0495616_0060690_371_1846 487
341 3300046520 Ga0495637_0007025 Ga0495637_0007025_3651_5123 487
342 3300046522 Ga0495643_0000891 Ga0495643_0000891_25299_26771 487
343 3300046522 Ga0495643_0001105 Ga0495643_0001105_1483_2955 487
344 3300046523 Ga0495644_0008384 Ga0495644_0008384_2061_3545 487
345 3300046523 Ga0495644_0008814 Ga0495644_0008814_2061_3542 487
346 3300046524 Ga0495648_0000751 Ga0495648_0000751_1482_2954 487
347 3300046524 Ga0495648_0003454 Ga0495648_0003454_12181_13662 487
348 3300046524 Ga0495648_0013959 Ga0495648_0013959_1339_2811 487
349 3300046524 Ga0495648_0030685 Ga0495648_0030685_1855_3327 487
350 3300046528 Ga0495642_0001627 Ga0495642_0001627_7095_8567 487
351 3300046538 Ga0495609_0000038 Ga0495609_0000038_300_1775 487
352 3300046538 Ga0495609_0000927 Ga0495609_0000927_19382_20854 487
353 3300046538 Ga0495609_0019486 Ga0495609_0019486_1417_2898 487
354 3300046542 Ga0495597_0000288 Ga0495597_0000288_38871_40343 487
355 3300046542 Ga0495597_0003076 Ga0495597_0003076_1453_2925 487
356 3300046557 Ga0495622_0001964 Ga0495622_0001964_1542_3014 487
357 3300046558 Ga0495633_0000663 Ga0495633_0000663_29004_30476 487
358 3300046558 Ga0495633_0001987 Ga0495633_0001987_421_1893 487
359 3300046558 Ga0495633_0035248 Ga0495633_0035248_377_1849 487
360 3300046558 Ga0495633_0037159 Ga0495633_0037159_661_2145 487
361 3300046616 Ga0495668_0000944 Ga0495668_0000944_1548_3020 487
362 3300046616 Ga0495668_0001593 Ga0495668_0001593_19556_21028 487
363 3300046648 Ga0495611_0008645 Ga0495611_0008645_2389_3873 487
364 3300046660 Ga0495625_0001377 Ga0495625_0001377_1402_2874 487
365 3300046660 Ga0495625_0007279 Ga0495625_0007279_4643_6115 487
366 3300046664 Ga0495659_0003587 Ga0495659_0003587_3003_4484 487
367 3300046665 Ga0495661_0050080 Ga0495661_0050080_300_1775 487
368 3300046691 Ga0495670_0028735 Ga0495670_0028735_944_2425 487
369 3300046691 Ga0495670_0065275 Ga0495670_0065275_296_1777 487
370 3300046692 Ga0495671_0014611 Ga0495671_0014611_2482_3954 487
371 3300046794 Ga0495589_0000986 Ga0495589_0000986_300_1775 487
372 3300046810 Ga0495660_0010144 Ga0495660_0010144_1165_2637 487
373 3300046810 Ga0495660_0018713 Ga0495660_0018713_2269_3741 487
374 3300046810 Ga0495660_0030299 Ga0495660_0030299_1063_2535 487
375 3300047318 Ga0495636_0008533 Ga0495636_0008533_1870_3351 487
376 3300047320 Ga0495672_0001040 Ga0495672_0001040_21833_23305 487
377 3300047320 Ga0495672_0029389 Ga0495672_0029389_335_1813 487
378 3300047323 Ga0495683_0003705 Ga0495683_0003705_7146_8627 487
379 3300047443 Ga0495687_001993 Ga0495687_001993_15560_17035 487
380 3300047443 Ga0495687_005076 Ga0495687_005076_6821_8302 487
381 3300047443 Ga0495687_005120 Ga0495687_005120_1543_3015 487
382 3300047443 Ga0495687_005317 Ga0495687_005317_5443_6915 487
383 3300047445 Ga0495677_0000527 Ga0495677_0000527_298_1773 487
384 3300047447 Ga0495685_000157 Ga0495685_000157_21393_22874 487
385 3300047469 Ga0495673_0000012 Ga0495673_0000012_655033_656505 487
386 3300047469 Ga0495673_0000604 Ga0495673_0000604_34004_35476 487
387 3300047470 Ga0495681_0008029 Ga0495681_0008029_513_1985 487
388 3300048091 Ga0495626_0001722 Ga0495626_0001722_14227_15702 487
389 3300048919 Ga0496116_0051207 Ga0496116_0051207_647_2119 487
390 3300048926 Ga0496123_0006778 Ga0496123_0006778_343_1815 487
391 3300048927 Ga0496124_0112903 Ga0496124_0112903_667_2139 487
392 3300048929 Ga0496126_0162934 Ga0496126_0162934_403_1875 487
393 3300049459 Ga0495678_000027 Ga0495678_000027_220265_221737 487
394 3300049459 Ga0495678_001082 Ga0495678_001082_16529_18001 487
395 3300049459 Ga0495678_002154 Ga0495678_002154_12190_13671 487
396 3300049459 Ga0495678_012018 Ga0495678_012018_1034_2506 487
397 3300049460 Ga0495682_0001880 Ga0495682_0001880_8740_10221 487
398 3300049460 Ga0495682_0007972 Ga0495682_0007972_2383_3867 487
399 3300049571 Ga0501034_0145341 Ga0501034_0145341_203_1723 487
400 3300049766 Ga0501269_000385 Ga0501269_000385_8751_10223 487
401 3300049775 Ga0501279_000681 Ga0501279_000681_247_1725 487
402 3300053125 Ga0500618_018130 Ga0500618_018130_55_1527 487
403 3300053145 Ga0500586_000619 Ga0500586_000619_376_1848 487
404 iso_pu_bacteria 2808606418 2809146554 487
405 3300003322 rootL2_10102555 rootL2_101025552 488
406 3300003763 Ga0055529_1000583 Ga0055529_10005831 488
407 3300003771 Ga0055526_1001052 Ga0055526_100105222 488
408 3300009036 Ga0105244_10013076 Ga0105244_100130762 488
409 3300017792 Ga0163161_10010197 Ga0163161_100101976 488
410 3300025245 Ga0207425_1001383 Ga0207425_100138310 488
411 3300025272 Ga0209455_1000484 Ga0209455_10004842 488
412 3300025294 Ga0209025_1014809 Ga0209025_10148095 488
413 3300025295 Ga0209564_1001321 Ga0209564_10013212 488
414 3300025297 Ga0209758_1000957 Ga0209758_100095733 488
415 3300025728 Ga0207655_1009754 Ga0207655_10097541 488
416 3300046471 Ga0495650_0001544 Ga0495650_0001544_298_1773 488
417 3300046471 Ga0495650_0003055 Ga0495650_0003055_334_1809 488
418 3300046474 Ga0495605_0000635 Ga0495605_0000635_25148_26623 488
419 3300046512 Ga0495610_0000014 Ga0495610_0000014_442913_444391 488
420 3300046530 Ga0495654_0000245 Ga0495654_0000245_291_1772 488
421 3300046616 Ga0495668_0005723 Ga0495668_0005723_441_1916 488
422 3300046616 Ga0495668_0006127 Ga0495668_0006127_300_1775 488
423 3300046660 Ga0495625_0002229 Ga0495625_0002229_424_1899 488
424 3300046692 Ga0495671_0006115 Ga0495671_0006115_303_1781 488
425 3300048927 Ga0496124_0033769 Ga0496124_0033769_297_1772 488
426 3300053118 Ga0500594_0003545 Ga0500594_0003545_1003_2523 488
427 iso_pu_bacteria 2643221603 2644029885 488
428 3300021361 Ga0213872_10000481 Ga0213872_1000048135 489
429 3300037312 Ga0395899_0000762 Ga0395899_0000762_16084_17586 489
430 3300037312 Ga0395899_0014827 Ga0395899_0014827_3973_5475 489
431 3300037418 Ga0395900_0004198 Ga0395900_0004198_13646_15127 489
432 3300037418 Ga0395900_0026862 Ga0395900_0026862_3720_5222 489
433 3300037418 Ga0395900_0049797 Ga0395900_0049797_2653_4155 489
434 3300037466 Ga0395898_0089301 Ga0395898_0089301_27_1529 489
435 3300038443 Ga0395901_0001364 Ga0395901_0001364_23712_25193 489
436 3300038443 Ga0395901_0050535 Ga0395901_0050535_654_2156 489
437 3300039447 Ga0436361_0217337 Ga0436361_0217337_212_1690 489
438 3300044658 Ga0466972_0026689 Ga0466972_0026689_208_1719 489
439 3300044683 Ga0466965_0030967 Ga0466965_0030967_467_1978 489
440 3300044684 Ga0466966_0087480 Ga0466966_0087480_195_1676 489
441 3300044684 Ga0466966_0089391 Ga0466966_0089391_183_1664 489
442 3300044706 Ga0466964_0000883 Ga0466964_0000883_7853_9364 489
443 3300044735 Ga0466968_0000881 Ga0466968_0000881_8735_10246 489
444 3300046457 Ga0495590_0024851 Ga0495590_0024851_406_1887 489
445 3300046474 Ga0495605_0000941 Ga0495605_0000941_18046_19527 489
446 3300046491 Ga0495584_0003316 Ga0495584_0003316_7162_8643 489
447 3300046501 Ga0495607_0016913 Ga0495607_0016913_372_1853 489
448 3300046501 Ga0495607_0051073 Ga0495607_0051073_578_2059 489
449 3300046507 Ga0495606_0012328 Ga0495606_0012328_1004_2485 489
450 3300046522 Ga0495643_0059405 Ga0495643_0059405_192_1673 489
451 3300046524 Ga0495648_0003840 Ga0495648_0003840_10917_12425 489
452 3300046528 Ga0495642_0008834 Ga0495642_0008834_253_1734 489
453 3300046665 Ga0495661_0012015 Ga0495661_0012015_4018_5499 489
454 3300046794 Ga0495589_0001840 Ga0495589_0001840_360_1841 489
455 3300046810 Ga0495660_0001060 Ga0495660_0001060_360_1841 489
456 3300046810 Ga0495660_0076761 Ga0495660_0076761_19_1500 489
457 3300047320 Ga0495672_0068974 Ga0495672_0068974_340_1821 489
458 3300047443 Ga0495687_000405 Ga0495687_000405_298_1779 489
459 3300047443 Ga0495687_000801 Ga0495687_000801_32091_33572 489
460 3300047445 Ga0495677_0009195 Ga0495677_0009195_52_1533 489
461 3300048091 Ga0495626_0001440 Ga0495626_0001440_17145_18626 489
462 3300048909 Ga0496106_0170774 Ga0496106_0170774_230_1711 489
463 3300048910 Ga0496107_0118093 Ga0496107_0118093_169_1650 489
464 3300048924 Ga0496121_0123103 Ga0496121_0123103_381_1862 489
465 3300049822 Ga0501035_0009455 Ga0501035_0009455_7485_8966 489
466 3300003762 Ga0055542_1007275 Ga0055542_10072752 490
467 3300014497 Ga0182008_10002513 Ga0182008_100025132 490
468 3300015261 Ga0182006_1000095 Ga0182006_10000956 490
469 3300015262 Ga0182007_10001265 Ga0182007_100012654 490
470 3300015265 Ga0182005_1000057 Ga0182005_10000576 490
471 3300021361 Ga0213872_10034755 Ga0213872_100347552 490
472 3300025254 Ga0209148_1000381 Ga0209148_10003812 490
473 3300037418 Ga0395900_0065519 Ga0395900_0065519_1946_3430 490
474 3300039447 Ga0436361_1031912 Ga0436361_1031912_49_1536 490
475 3300044683 Ga0466965_0028388 Ga0466965_0028388_34_1542 490
476 3300046471 Ga0495650_0000062 Ga0495650_0000062_276243_277730 490
477 3300046530 Ga0495654_0032088 Ga0495654_0032088_207_1715 490
478 3300046538 Ga0495609_0018151 Ga0495609_0018151_1308_2990 490
479 3300046558 Ga0495633_0056263 Ga0495633_0056263_75_1583 490
480 3300046616 Ga0495668_0007409 Ga0495668_0007409_4972_6465 490
481 3300048919 Ga0496116_0071036 Ga0496116_0071036_592_2112 490
482 3300048920 Ga0496117_0000075 Ga0496117_0000075_9888_11408 490
483 3300048921 Ga0496118_0000055 Ga0496118_0000055_9888_11408 490
484 3300048924 Ga0496121_0003786 Ga0496121_0003786_9947_11467 490
485 3300048924 Ga0496121_0008034 Ga0496121_0008034_1232_2752 490
486 3300048925 Ga0496122_0007255 Ga0496122_0007255_9721_11241 490
487 3300049459 Ga0495678_012665 Ga0495678_012665_2142_3704 490
488 3300059641 Ga0587068_002129 Ga0587068_002129_730_2214 490
489 3300003759 Ga0055525_1000028 Ga0055525_1000028307 491
490 3300005331 Ga0070670_100173927 Ga0070670_1001739272 491
491 3300005339 Ga0070660_100139181 Ga0070660_1001391811 491
492 3300025230 Ga0209563_100011 Ga0209563_1000113 491
493 3300025253 Ga0209677_107612 Ga0209677_1076123 491
494 3300025919 Ga0207657_10146190 Ga0207657_101461902 491
495 3300025933 Ga0207706_10086551 Ga0207706_100865511 491
496 3300037418 Ga0395900_0170962 Ga0395900_0170962_552_2042 491
497 3300042128 Ga0450897_000149 Ga0450897_000149_829_2313 491
498 3300045049 Ga0466959_0044565 Ga0466959_0044565_180_1670 491
499 3300046499 Ga0495594_0045489 Ga0495594_0045489_416_1900 491
500 3300046522 Ga0495643_0060639 Ga0495643_0060639_150_1835 491
501 3300046674 Ga0495588_0000172 Ga0495588_0000172_79934_81424 491
502 3300046674 Ga0495588_0046363 Ga0495588_0046363_276_1790 491
503 3300047315 Ga0495581_0023785 Ga0495581_0023785_1747_3231 491
504 3300047321 Ga0495676_0035928 Ga0495676_0035928_306_1790 491
505 3300047472 Ga0495686_0006674 Ga0495686_0006674_7143_8618 491
506 3300048091 Ga0495626_0001243 Ga0495626_0001243_3270_4790 491
507 3300048904 Ga0496101_0044087 Ga0496101_0044087_1143_2627 491
508 3300048905 Ga0496102_0060081 Ga0496102_0060081_1634_3124 491
509 3300048907 Ga0496104_0158749 Ga0496104_0158749_14_1498 491
510 3300048908 Ga0496105_0082523 Ga0496105_0082523_181_1665 491
511 3300048910 Ga0496107_0091869 Ga0496107_0091869_228_1712 491
512 3300048913 Ga0496110_0043460 Ga0496110_0043460_169_1653 491
513 3300048914 Ga0496111_0002899 Ga0496111_0002899_6779_8263 491
514 3300048915 Ga0496112_0136023 Ga0496112_0136023_558_2048 491
515 3300048916 Ga0496113_0033743 Ga0496113_0033743_55_1545 491
516 3300048925 Ga0496122_0003341 Ga0496122_0003341_19374_20864 491
517 3300048926 Ga0496123_0009556 Ga0496123_0009556_6893_8383 491
518 3300048926 Ga0496123_0022950 Ga0496123_0022950_2900_4390 491
519 3300048927 Ga0496124_0013871 Ga0496124_0013871_6096_7658 491
520 3300005337 Ga0070682_100004447 Ga0070682_1000044476 492
521 3300005339 Ga0070660_100069403 Ga0070660_1000694032 492
522 3300005344 Ga0070661_100147763 Ga0070661_1001477631 492
523 3300005563 Ga0068855_100176608 Ga0068855_1001766081 492
524 3300005564 Ga0070664_100063092 Ga0070664_1000630923 492
525 3300009148 Ga0105243_10019283 Ga0105243_100192835 492
526 3300009174 Ga0105241_10066531 Ga0105241_100665313 492
527 3300009545 Ga0105237_10127719 Ga0105237_101277191 492
528 3300010375 Ga0105239_10283770 Ga0105239_102837702 492
529 3300025914 Ga0207671_10112100 Ga0207671_101121002 492
530 3300025919 Ga0207657_10095874 Ga0207657_100958741 492
531 3300025935 Ga0207709_10032012 Ga0207709_100320122 492
532 3300025945 Ga0207679_10144187 Ga0207679_101441871 492
533 3300031711 Ga0265314_10048457 Ga0265314_100484571 492
534 3300037312 Ga0395899_0000575 Ga0395899_0000575_37301_38788 492
535 3300037312 Ga0395899_0061046 Ga0395899_0061046_782_2350 492
536 3300037466 Ga0395898_0118987 Ga0395898_0118987_611_2257 492
537 3300037471 Ga0395905_0001070 Ga0395905_0001070_30125_31618 492
538 3300042005 Ga0439448_0008515 Ga0439448_0008515_1254_2747 492
539 3300042139 Ga0450904_000062 Ga0450904_000062_17590_19098 492
540 3300042157 Ga0439458_0002215 Ga0439458_0002215_13_1506 492
541 3300044658 Ga0466972_0000373 Ga0466972_0000373_9725_11227 492
542 3300044694 Ga0466963_0070914 Ga0466963_0070914_453_1946 492
543 3300044706 Ga0466964_0002132 Ga0466964_0002132_1870_3399 492
544 3300044706 Ga0466964_0011013 Ga0466964_0011013_1619_3112 492
545 3300044706 Ga0466964_0038294 Ga0466964_0038294_251_1780 492
546 3300044735 Ga0466968_0006523 Ga0466968_0006523_2338_3867 492
547 3300044842 Ga0466957_0000182 Ga0466957_0000182_26687_28342 492
548 3300044842 Ga0466957_0026183 Ga0466957_0026183_274_1767 492
549 3300045976 Ga0466967_0090863 Ga0466967_0090863_959_2452 492
550 3300046457 Ga0495590_0008255 Ga0495590_0008255_1981_3468 492
551 3300046460 Ga0495638_0021457 Ga0495638_0021457_2452_3939 492
552 3300046460 Ga0495638_0091992 Ga0495638_0091992_57_1565 492
553 3300046471 Ga0495650_0001085 Ga0495650_0001085_27870_29357 492
554 3300046491 Ga0495584_0000092 Ga0495584_0000092_409_1896 492
555 3300046491 Ga0495584_0004909 Ga0495584_0004909_5158_6645 492
556 3300046492 Ga0495585_0000984 Ga0495585_0000984_22015_23532 492
557 3300046492 Ga0495585_0001005 Ga0495585_0001005_21564_23051 492
558 3300046492 Ga0495585_0001517 Ga0495585_0001517_2063_3550 492
559 3300046492 Ga0495585_0004278 Ga0495585_0004278_477_1964 492
560 3300046492 Ga0495585_0031792 Ga0495585_0031792_447_1964 492
561 3300046492 Ga0495585_0043376 Ga0495585_0043376_716_2233 492
562 3300046499 Ga0495594_0052771 Ga0495594_0052771_448_1935 492
563 3300046500 Ga0495596_0000350 Ga0495596_0000350_28043_29560 492
564 3300046501 Ga0495607_0005276 Ga0495607_0005276_7259_8758 492
565 3300046506 Ga0495583_0000329 Ga0495583_0000329_528_2015 492
566 3300046506 Ga0495583_0001471 Ga0495583_0001471_491_1978 492
567 3300046506 Ga0495583_0024817 Ga0495583_0024817_1268_2791 492
568 3300046506 Ga0495583_0031168 Ga0495583_0031168_530_2029 492
569 3300046507 Ga0495606_0009754 Ga0495606_0009754_5756_7246 492
570 3300046507 Ga0495606_0031689 Ga0495606_0031689_308_1795 492
571 3300046507 Ga0495606_0095805 Ga0495606_0095805_307_1794 492
572 3300046513 Ga0495616_0000547 Ga0495616_0000547_265_1779 492
573 3300046513 Ga0495616_0001040 Ga0495616_0001040_419_1906 492
574 3300046513 Ga0495616_0046318 Ga0495616_0046318_308_1825 492
575 3300046515 Ga0495620_0035174 Ga0495620_0035174_321_1808 492
576 3300046518 Ga0495631_0031969 Ga0495631_0031969_388_1875 492
577 3300046519 Ga0495632_0005648 Ga0495632_0005648_165_1700 492
578 3300046520 Ga0495637_0029493 Ga0495637_0029493_240_1733 492
579 3300046522 Ga0495643_0001198 Ga0495643_0001198_20635_22128 492
580 3300046522 Ga0495643_0004987 Ga0495643_0004987_7136_8623 492
581 3300046522 Ga0495643_0013877 Ga0495643_0013877_102_1589 492
582 3300046522 Ga0495643_0018368 Ga0495643_0018368_2031_3518 492
583 3300046523 Ga0495644_0040765 Ga0495644_0040765_22_1542 492
584 3300046524 Ga0495648_0013960 Ga0495648_0013960_355_1872 492
585 3300046524 Ga0495648_0077271 Ga0495648_0077271_159_1646 492
586 3300046528 Ga0495642_0002398 Ga0495642_0002398_5563_7050 492
587 3300046528 Ga0495642_0019212 Ga0495642_0019212_289_1806 492
588 3300046528 Ga0495642_0021647 Ga0495642_0021647_175_1662 492
589 3300046528 Ga0495642_0030640 Ga0495642_0030640_321_1811 492
590 3300046528 Ga0495642_0045011 Ga0495642_0045011_189_1718 492
591 3300046530 Ga0495654_0024540 Ga0495654_0024540_261_1787 492
592 3300046530 Ga0495654_0050256 Ga0495654_0050256_319_1806 492
593 3300046538 Ga0495609_0029589 Ga0495609_0029589_683_2170 492
594 3300046542 Ga0495597_0032083 Ga0495597_0032083_602_2089 492
595 3300046557 Ga0495622_0000440 Ga0495622_0000440_236_1723 492
596 3300046558 Ga0495633_0009283 Ga0495633_0009283_369_1856 492
597 3300046616 Ga0495668_0017479 Ga0495668_0017479_270_1757 492
598 3300046616 Ga0495668_0017741 Ga0495668_0017741_412_1929 492
599 3300046648 Ga0495611_0047414 Ga0495611_0047414_365_1882 492
600 3300046648 Ga0495611_0049865 Ga0495611_0049865_235_1722 492
601 3300046660 Ga0495625_0053260 Ga0495625_0053260_948_2465 492
602 3300046665 Ga0495661_0000701 Ga0495661_0000701_22564_24051 492
603 3300046665 Ga0495661_0008346 Ga0495661_0008346_551_2050 492
604 3300046665 Ga0495661_0054827 Ga0495661_0054827_677_2194 492
605 3300046665 Ga0495661_0057819 Ga0495661_0057819_278_1765 492
606 3300046679 Ga0495623_0066424 Ga0495623_0066424_109_1596 492
607 3300046691 Ga0495670_0010105 Ga0495670_0010105_2733_4220 492
608 3300046691 Ga0495670_0024277 Ga0495670_0024277_975_2462 492
609 3300046794 Ga0495589_0026866 Ga0495589_0026866_332_1819 492
610 3300047320 Ga0495672_0000019 Ga0495672_0000019_441797_443326 492
611 3300047321 Ga0495676_0035194 Ga0495676_0035194_2337_3824 492
612 3300047323 Ga0495683_0000692 Ga0495683_0000692_22666_24153 492
613 3300047443 Ga0495687_017089 Ga0495687_017089_180_1667 492
614 3300047445 Ga0495677_0003170 Ga0495677_0003170_558_2057 492
615 3300047447 Ga0495685_006353 Ga0495685_006353_213_1700 492
616 3300047470 Ga0495681_0025206 Ga0495681_0025206_1231_2718 492
617 3300048091 Ga0495626_0008571 Ga0495626_0008571_347_1834 492
618 3300048091 Ga0495626_0055591 Ga0495626_0055591_302_1789 492
619 3300048906 Ga0496103_0095651 Ga0496103_0095651_245_1738 492
620 3300048927 Ga0496124_0021994 Ga0496124_0021994_1495_2997 492
621 3300048929 Ga0496126_0094685 Ga0496126_0094685_671_2206 492
622 3300030745 Ga0316182_1122702 Ga0316182_11227022 493
623 3300046472 Ga0495580_0082024 Ga0495580_0082024_450_1943 493
624 3300046473 Ga0495582_0001880 Ga0495582_0001880_10042_11535 493
625 3300046499 Ga0495594_0022587 Ga0495594_0022587_305_1798 493
626 3300046642 Ga0495634_0011154 Ga0495634_0011154_212_1705 493
627 3300047318 Ga0495636_0009579 Ga0495636_0009579_453_1943 493
628 3300047444 Ga0495675_0019271 Ga0495675_0019271_1829_3322 493
629 3300048091 Ga0495626_0000005 Ga0495626_0000005_335679_337196 493
630 3300048905 Ga0496102_0000082 Ga0496102_0000082_137272_138762 493
631 3300037471 Ga0395905_0009521 Ga0395905_0009521_7141_8628 494
632 3300046529 Ga0495652_0009821 Ga0495652_0009821_2842_4356 497
633 3300046680 Ga0495646_0004359 Ga0495646_0004359_3962_5476 497
634 3300048088 Ga0495602_0182991 Ga0495602_0182991_67_1581 497
635 iso_pu_bacteria 2818991436 2819542260 499
636 3300015265 Ga0182005_1000134 Ga0182005_100013449 503
637 3300046454 Ga0495592_0011996 Ga0495592_0011996_2303_3814 503
638 3300046463 Ga0495653_0007503 Ga0495653_0007503_3493_5004 503
639 3300046511 Ga0495608_0013893 Ga0495608_0013893_981_2492 503
640 3300046514 Ga0495618_0011394 Ga0495618_0011394_3066_4577 503
641 3300046516 Ga0495628_0003214 Ga0495628_0003214_12157_13668 503
642 3300046529 Ga0495652_0036452 Ga0495652_0036452_668_2179 503
643 3300046663 Ga0495635_0039741 Ga0495635_0039741_1668_3179 503
644 3300046678 Ga0495599_0000548 Ga0495599_0000548_11643_13154 503
645 3300046680 Ga0495646_0011253 Ga0495646_0011253_3873_5384 503
646 3300046809 Ga0495600_0000693 Ga0495600_0000693_6320_7831 503
647 3300047317 Ga0495604_0019774 Ga0495604_0019774_290_1801 503
648 3300048088 Ga0495602_0032543 Ga0495602_0032543_611_2122 503
649 3300053119 Ga0500595_000862 Ga0500595_000862_7075_8586 503
650 3300053141 Ga0500574_000191 Ga0500574_000191_1976_3487 503
651 3300053154 Ga0500619_000200 Ga0500619_000200_9411_10922 503
652 3300002737 JGI25162J39368_1000023 JGI25162J39368_1000023199 504
653 3300003214 JGI25165J46597_1000030 JGI25165J46597_1000030101 504
654 3300003751 Ga0055538_1000017 Ga0055538_1000017199 504
655 3300003752 Ga0055539_1000022 Ga0055539_1000022199 504
656 3300003756 Ga0055533_1000030 Ga0055533_1000030199 504
657 3300003759 Ga0055525_1000034 Ga0055525_1000034199 504
658 3300003841 Ga0055541_1000015 Ga0055541_1000015199 504
659 3300015262 Ga0182007_10001951 Ga0182007_100019517 504
660 3300025224 Ga0209784_100034 Ga0209784_100034101 504
661 3300025225 Ga0209566_100038 Ga0209566_100038198 504
662 3300025226 Ga0209674_100056 Ga0209674_100056101 504
663 3300025230 Ga0209563_100057 Ga0209563_100057198 504
664 3300025231 Ga0207427_100498 Ga0207427_1004985 504
665 3300025233 Ga0209437_100071 Ga0209437_100071198 504
666 3300025253 Ga0209677_100035 Ga0209677_100035101 504
667 3300025261 Ga0209233_1000094 Ga0209233_1000094198 504
668 3300046462 Ga0495651_0025844 Ga0495651_0025844_121_1635 504
669 3300046516 Ga0495628_0000076 Ga0495628_0000076_55377_56891 504
670 3300046529 Ga0495652_0003764 Ga0495652_0003764_5822_7336 504
671 3300046675 Ga0495657_0046654 Ga0495657_0046654_420_1934 504
672 3300048088 Ga0495602_0057841 Ga0495602_0057841_1688_3202 504

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13311

DUF4080

Protein of unknown function (DUF4080)

442

572

0.85

PF04055

Radical_SAM

Radical SAM superfamily

248

416

0.83

PF02310

B12-binding

B12 binding domain

86

205

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wtf-assembly2.cif.gz_B structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with tryptophan substrate and sam analog (aza-sam) bound 0.7636 2 359
6wte-assembly2.cif.gz_B structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with cobalamin and [4fe-4s] cluster bound 0.7595 1 365
6b4c-assembly10.cif.gz_J structure of viperin from trichoderma virens 0.7562 195 348
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.7512 168 351
6wte-assembly1.cif.gz_A structure of radical s-adenosylmethionine methyltransferase, tsrm, from kitasatospora setae with cobalamin and [4fe-4s] cluster bound 0.7506 1 372
ID Description Score Start End Superfamily
af_A0A1D6JM25_181_293_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.881 277 359 3.30.750.200
af_A4IGH2_157_284_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8562 276 365 3.30.750.200
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8103 276 359 3.30.750.200
af_Q4CUJ9_220_394_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8066 235 365 3.30.750.200
af_P96395_5_123_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8034 41 131 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A1Z5I5E2-F1-model_v4 deleted 0.9744 286 401
AF-A0A6S6RTR1-F1-model_v4 Mg-protoporphyrin IX monomethyl ester oxidative cyclase 0.9632 3 455 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051536
AF-A0A1F9LJS9-F1-model_v4 Uncharacterized protein 0.9543 1 471 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051536
AF-A0A356ULS6-F1-model_v4 deleted 0.9523 250 471
AF-A0A7C5CTK3-F1-model_v4 DUF4080 domain-containing protein 0.9509 1 471 GO:0003824
GO:0005829
GO:0031419
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
84.75 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map