F474221

General Info

Members Datasets Scaffolds Average Seq Length
672 413 1344 266

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100037718|Ga0075363_1000377183
Length 293
Sequence VPATAGPPEPDRSQALATGTEPPDTEPHPVRGGVRTGTRAAIDAPHLRTDRWWLAPAATAAGLLAFIVYSTWRAFADTDYYAAPYVSPFYSPCLAERCEPMRHGPNWELFGSWWGISPAIIILIFPLGFRLTCYYYRKAYYRGFWASPPACAVAEPHKKYTGETRFPLILQNIHRYFFYAAIVVAGILTYDTVLSFRDENYEWGHMGLGTVVFLVNIVLIWAYTASCHSCRHIVGGKLRHFSKHPVRYRAWQFVGRLNARHMQLAWASLVSVALADFYVYLLASGAFDDPRFF

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
141 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
142 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
143 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
144 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
145 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
301 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
302 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
303 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
304 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
305 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
306 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
310 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
311 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
312 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
313 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
314 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
321 2558860280 Kutzneria sp. 744 Isolate Unclassified
322 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
323 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
324 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
325 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
326 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
327 2643221647 Streptomyces sp. Root369 Isolate Unclassified
328 2643221670 Streptomyces sp. Root431 Isolate Unclassified
329 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
330 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
331 2643221714 Streptomyces sp. Root264 Isolate Unclassified
332 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
333 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
334 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
335 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
336 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
337 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
338 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
339 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
340 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
341 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
342 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
343 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
344 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
345 2808606394 Promicromonospora sp. C35 Isolate Unclassified
346 2808606448 Streptomyces sp. 193411 Isolate Unclassified
347 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
348 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
349 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
350 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
351 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
352 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
353 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
354 2862574272 Streptomyces sp. AcE210 Isolate Nodule
355 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
356 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
357 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
358 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
359 2867369537 Streptomyces sp. Z26 Isolate Unclassified
360 2867428634 Streptomyces sp. RP5T Isolate Unclassified
361 2867475112 Streptomyces sp. TM32 Isolate Unclassified
362 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
363 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
364 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
365 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
366 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
367 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
368 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
369 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
370 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
371 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
372 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
373 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
374 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
375 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
376 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
377 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
378 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
379 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
380 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
381 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
382 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
383 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
384 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
385 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
386 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
387 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
388 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
389 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
390 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
391 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
392 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
393 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
394 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
395 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
396 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
397 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
398 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
399 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
400 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
401 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
402 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
403 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
404 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
405 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
406 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
407 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
408 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
409 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
410 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
411 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
412 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
413 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.12
Metatranscriptomes 0.89
Isolates 13.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 0.15
Rhizoplane 2.53
Rhizosphere 80.65
Stem 0
Stem Tuber 0.15
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100037718 3300006048 Bacteria 2539
2 JGI24739J22299_10013326 3300001989 Bacteria 3003
3 JGI24743J22301_10029296 3300001991 Bacteria 1080
4 JGI24738J21930_10005233 3300002075 Bacteria 3130
5 JGI24738J21930_10005599 3300002075 Bacteria 2997
6 JGI24738J21930_10013072 3300002075 Bacteria 1801
7 rootH1_10001942 3300003316 Bacteria 3933
8 rootL2_10001350 3300003322 Bacteria 3547
9 rootH1_10032372 3300003323 Bacteria 5776
10 JGI25404J52841_10011000 3300003659 Bacteria 1948
11 Ga0070658_10004159 3300005327 Bacteria 11849
12 Ga0070690_100236727 3300005330 Bacteria 1286
13 Ga0070682_100047910 3300005337 Bacteria 2659
14 Ga0070689_100243091 3300005340 Bacteria 1483
15 Ga0070687_100009050 3300005343 Bacteria 4248
16 Ga0070661_100014379 3300005344 Bacteria 5576
17 Ga0070692_10019343 3300005345 Bacteria 3285
18 Ga0070709_10024567 3300005434 Bacteria 3549
19 Ga0070710_10311735 3300005437 Bacteria 1030
20 Ga0070701_10067150 3300005438 Bacteria 1907
21 Ga0070700_100009476 3300005441 Bacteria 5347
22 Ga0070663_100255227 3300005455 Bacteria 1389
23 Ga0070684_100102946 3300005535 Bacteria 2553
24 Ga0068853_100054232 3300005539 Bacteria 3454
25 Ga0068853_100101401 3300005539 Bacteria 2546
26 Ga0070672_100001614 3300005543 Bacteria 14019
27 Ga0070665_100063269 3300005548 Bacteria 3710
28 Ga0068855_100202212 3300005563 Bacteria 2236
29 Ga0070664_100000682 3300005564 Bacteria 25899
30 Ga0068857_100076099 3300005577 Bacteria 2993
31 Ga0068854_100101888 3300005578 Bacteria 2153
32 Ga0068854_100103428 3300005578 Bacteria 2138
33 Ga0068856_100006857 3300005614 Bacteria 11140
34 Ga0068856_100175554 3300005614 Bacteria 2155
35 Ga0070702_100013113 3300005615 Bacteria 4176
36 Ga0068852_100005409 3300005616 Bacteria 9135
37 Ga0068852_100112896 3300005616 Bacteria 2473
38 Ga0068852_100576995 3300005616 Bacteria 1127
39 Ga0068851_10220347 3300005834 Bacteria 1066
40 Ga0068870_10001942 3300005840 Bacteria 8534
41 Ga0068862_100105995 3300005844 Bacteria 2464
42 Ga0081455_10040298 3300005937 Bacteria 4120
43 Ga0081455_10045660 3300005937 Bacteria 3809
44 Ga0081540_1000201 3300005983 Bacteria 62353
45 Ga0081540_1000530 3300005983 Bacteria 37149
46 Ga0081540_1000903 3300005983 Bacteria 26812
47 Ga0075365_10196273 3300006038 Bacteria 1413
48 Ga0075368_10003859 3300006042 Bacteria 5045
49 Ga0075367_10008157 3300006178 Bacteria 5410
50 Ga0075370_10159960 3300006353 Bacteria 1321
51 Ga0075428_100290510 3300006844 Bacteria 1759
52 Ga0075429_100464629 3300006880 Bacteria 1109
53 Ga0068865_100048156 3300006881 Bacteria 2932
54 Ga0105251_10039905 3300009011 Bacteria 2291
55 Ga0105250_10012076 3300009092 Bacteria 3576
56 Ga0105240_10053552 3300009093 Bacteria 5065
57 Ga0111539_10221043 3300009094 Bacteria 2206
58 Ga0105245_10102894 3300009098 Bacteria 2645
59 Ga0105245_10116991 3300009098 Bacteria 2486
60 Ga0105245_10278883 3300009098 Bacteria 1633
61 Ga0105243_10126976 3300009148 Bacteria 2159
62 Ga0105248_10823092 3300009177 Bacteria 1048
63 Ga0105237_10066475 3300009545 Bacteria 3600
64 Ga0105238_10014242 3300009551 Bacteria 8042
65 Ga0105238_10026907 3300009551 Bacteria 5862
66 Ga0105238_10398497 3300009551 Bacteria 1369
67 Ga0105249_10011960 3300009553 Bacteria 7634
68 Ga0105239_10020856 3300010375 Bacteria 7230
69 Ga0105246_10110148 3300011119 Bacteria 2022
70 Ga0157369_10031601 3300013105 Bacteria 5828
71 Ga0163162_10203984 3300013306 Bacteria 2106
72 Ga0157372_10196363 3300013307 Bacteria 2337
73 Ga0157375_10293749 3300013308 Bacteria 1788
74 Ga0157375_10362189 3300013308 Bacteria 1616
75 Ga0163163_10061058 3300014325 Bacteria 3734
76 Ga0157380_10024948 3300014326 Bacteria 4530
77 Ga0182008_10005286 3300014497 Bacteria 7379
78 Ga0182008_10070429 3300014497 Bacteria 1720
79 Ga0182007_10000370 3300015262 Bacteria 28383
80 Ga0183367_1002 3300015688 Bacteria 1101531
81 Ga0206350_11053910 3300020080 Bacteria 1467
82 Ga0206353_10373363 3300020082 Bacteria 1649
83 Ga0213875_10005571 3300021388 Bacteria 6738
84 Ga0213875_10058552 3300021388 Bacteria 1803
85 Ga0224712_10039593 3300022467 Bacteria 1768
86 Ga0209758_1011481 3300025297 Bacteria 5121
87 Ga0207426_1003294 3300025302 Bacteria 8990
88 Ga0207426_1014699 3300025302 Bacteria 2861
89 Ga0207426_1046272 3300025302 Bacteria 1318
90 Ga0207692_10143822 3300025898 Bacteria 1359
91 Ga0207647_10088677 3300025904 Bacteria 1847
92 Ga0207699_10043884 3300025906 Bacteria 2600
93 Ga0207643_10001179 3300025908 Bacteria 15517
94 Ga0207705_10050116 3300025909 Bacteria 3005
95 Ga0207695_10026408 3300025913 Bacteria 6480
96 Ga0207662_10006154 3300025918 Bacteria 6457
97 Ga0207649_10003945 3300025920 Bacteria 8090
98 Ga0207694_10060868 3300025924 Bacteria 2939
99 Ga0207694_10121875 3300025924 Bacteria 2082
100 Ga0207659_10254663 3300025926 Bacteria 1425
101 Ga0207687_10356520 3300025927 Bacteria 1193
102 Ga0207700_10019898 3300025928 Bacteria 4544
103 Ga0207669_10033499 3300025937 Bacteria 2900
104 Ga0207704_10026604 3300025938 Bacteria 3176
105 Ga0207691_10002108 3300025940 Bacteria 19439
106 Ga0207711_10213820 3300025941 Bacteria 1762
107 Ga0207661_10085106 3300025944 Bacteria 2620
108 Ga0207679_10008838 3300025945 Bacteria 6421
109 Ga0207667_10358781 3300025949 Bacteria 1486
110 Ga0207668_10317376 3300025972 Bacteria 1292
111 Ga0207640_10067731 3300025981 Bacteria 2390
112 Ga0207677_10665883 3300026023 Bacteria 920
113 Ga0207639_10077742 3300026041 Bacteria 2617
114 Ga0207639_10163189 3300026041 Bacteria 1880
115 Ga0207678_10634828 3300026067 Bacteria 938
116 Ga0207708_10000253 3300026075 Bacteria 42020
117 Ga0207702_10029788 3300026078 Bacteria 4543
118 Ga0207702_10087228 3300026078 Bacteria 2723
119 Ga0207648_10004027 3300026089 Bacteria 15259
120 Ga0207674_10088775 3300026116 Bacteria 3084
121 Ga0207698_10007290 3300026142 Bacteria 6928
122 Ga0207698_10007525 3300026142 Bacteria 6824
123 Ga0209371_1007830 3300027312 Bacteria 3645
124 Ga0209371_1027279 3300027312 Bacteria 1287
125 Ga0268266_10140802 3300028379 Bacteria 2165
126 Ga0307517_10004859 3300028786 Bacteria 20484
127 Ga0307517_10020507 3300028786 Bacteria 8414
128 Ga0307515_10019680 3300028794 Bacteria 12120
129 Ga0307515_10135949 3300028794 Bacteria 2673
130 Ga0268256_1008104 3300030500 Bacteria 3645
131 Ga0268256_1012140 3300030500 Bacteria 2681
132 Ga0307511_10000701 3300030521 Bacteria 35773
133 Ga0307512_10000716 3300030522 Bacteria 49274
134 Ga0307512_10037711 3300030522 Bacteria 4077
135 Ga0316176_1203215 3300030732 Bacteria 1468
136 Ga0307513_10018177 3300031456 Bacteria 8412
137 Ga0307513_10251505 3300031456 Bacteria 1563
138 Ga0307509_10034051 3300031507 Bacteria 5600
139 Ga0307509_10103539 3300031507 Bacteria 2874
140 Ga0307408_100098280 3300031548 Bacteria 2225
141 Ga0307508_10004014 3300031616 Bacteria 14587
142 Ga0307508_10005903 3300031616 Bacteria 11556
143 Ga0307508_10010497 3300031616 Bacteria 8477
144 Ga0307508_10041554 3300031616 Bacteria 4126
145 Ga0307514_10005164 3300031649 Bacteria 11776
146 Ga0307514_10066186 3300031649 Bacteria 2734
147 Ga0307514_10116393 3300031649 Bacteria 1877
148 Ga0307516_10001020 3300031730 Bacteria 38830
149 Ga0307516_10150323 3300031730 Bacteria 2090
150 Ga0307518_10237665 3300031838 Bacteria 1172
151 Ga0307406_10032143 3300031901 Bacteria 3201
152 Ga0307409_100253086 3300031995 Bacteria 1611
153 Ga0307414_10128083 3300032004 Bacteria 1965
154 Ga0307507_10000001 3300033179 Bacteria 417520
155 Ga0307507_10107702 3300033179 Bacteria 2295
156 Ga0307510_10045222 3300033180 Bacteria 4756
157 Ga0307510_10146585 3300033180 Bacteria 1990
158 Ga0307510_10336751 3300033180 Bacteria 962
159 Ga0373936_0005051 3300035113 Bacteria 4965
160 Ga0373946_0032831 3300035171 Bacteria 2086
161 Ga0373924_0131306 3300035410 Bacteria 1090
162 Ga0373935_0096135 3300035692 Bacteria 1946
163 Ga0373935_0331255 3300035692 Bacteria 1082
164 Ga0373947_0013078 3300035725 Bacteria 4757
165 Ga0373937_0001317 3300036401 Bacteria 20789
166 Ga0373937_0103368 3300036401 Bacteria 2646
167 Ga0373925_0021812 3300037068 Bacteria 4669
168 Ga0373925_0375094 3300037068 Bacteria 1158
169 Ga0395900_0028897 3300037418 Bacteria 5684
170 Ga0395900_0123152 3300037418 Bacteria 2660
171 Ga0395898_0143774 3300037466 Bacteria 2283
172 Ga0395898_0148356 3300037466 Bacteria 2245
173 Ga0436364_0801129 3300037853 Bacteria 53590
174 Ga0436364_1348411 3300037853 Bacteria 20101
175 Ga0395901_0042499 3300038443 Bacteria 4712
176 Ga0439436_0000226 3300041404 Bacteria 13575
177 Ga0439436_0000266 3300041404 Bacteria 12591
178 Ga0439439_0000523 3300041406 Bacteria 6628
179 Ga0439433_0045380 3300041999 Bacteria 1029
180 Ga0439442_011491 3300042002 Bacteria 1803
181 Ga0439448_0029277 3300042005 Bacteria 1743
182 Ga0439449_0000647 3300042007 Bacteria 13093
183 Ga0439449_0025647 3300042007 Bacteria 2202
184 Ga0439455_0001505 3300042012 Bacteria 3919
185 Ga0439455_0052055 3300042012 Bacteria 1071
186 Ga0439457_000058 3300042014 Bacteria 23477
187 Ga0439457_000383 3300042014 Bacteria 12473
188 Ga0439457_014779 3300042014 Bacteria 1745
189 Ga0439462_0000305 3300042015 Bacteria 9143
190 Ga0450894_000145 3300042131 Bacteria 12470
191 Ga0450896_002136 3300042133 Bacteria 2525
192 Ga0450898_001869 3300042134 Bacteria 2848
193 Ga0450899_000405 3300042135 Bacteria 4791
194 Ga0450900_001299 3300042136 Bacteria 2404
195 Ga0450903_000089 3300042138 Bacteria 18878
196 Ga0451577_0036359 3300042876 Bacteria 4432
197 Ga0466969_0021837 3300044656 Bacteria 3308
198 Ga0466969_0023598 3300044656 Bacteria 3168
199 Ga0466969_0053359 3300044656 Bacteria 1983
200 Ga0466969_0120773 3300044656 Bacteria 1220
201 Ga0453683_0068074 3300044673 Bacteria 2226
202 Ga0466965_0011315 3300044683 Bacteria 4178
203 Ga0466965_0120005 3300044683 Bacteria 1357
204 Ga0466966_0009667 3300044684 Bacteria 6384
205 Ga0466966_0014932 3300044684 Bacteria 5140
206 Ga0466966_0023395 3300044684 Bacteria 4045
207 Ga0466961_0001398 3300044693 Bacteria 14947
208 Ga0466961_0005357 3300044693 Bacteria 8072
209 Ga0466961_0063210 3300044693 Bacteria 2352
210 Ga0466961_0080406 3300044693 Bacteria 2063
211 Ga0466961_0095101 3300044693 Bacteria 1879
212 Ga0466963_0000478 3300044694 Bacteria 18660
213 Ga0466963_0006338 3300044694 Bacteria 6996
214 Ga0466963_0222320 3300044694 Bacteria 1322
215 Ga0466964_0013106 3300044706 Bacteria 3143
216 Ga0466971_0000952 3300044719 Bacteria 11885
217 Ga0466971_0008506 3300044719 Bacteria 4475
218 Ga0466971_0025452 3300044719 Bacteria 2643
219 Ga0466971_0032579 3300044719 Bacteria 2335
220 Ga0466971_0091901 3300044719 Bacteria 1390
221 Ga0466968_0023940 3300044735 Bacteria 2492
222 Ga0466970_0000504 3300044765 Bacteria 19228
223 Ga0466970_0008265 3300044765 Bacteria 5231
224 Ga0466957_0000371 3300044842 Bacteria 22070
225 Ga0466957_0271173 3300044842 Bacteria 1133
226 Ga0466957_0383819 3300044842 Bacteria 958
227 Ga0466960_0025615 3300044901 Bacteria 2670
228 Ga0466960_0036287 3300044901 Bacteria 2308
229 Ga0466959_0023487 3300045049 Bacteria 4562
230 Ga0466959_0110359 3300045049 Bacteria 1963
231 Ga0451576_0048691 3300045051 Bacteria 4450
232 Ga0466958_0006825 3300045836 Bacteria 6241
233 Ga0466958_0086804 3300045836 Bacteria 1931
234 Ga0466967_0002866 3300045976 Bacteria 10961
235 Ga0466967_0037378 3300045976 Bacteria 4154
236 Ga0466967_0275999 3300045976 Bacteria 1612
237 Ga0466967_0584892 3300045976 Bacteria 1101
238 Ga0495617_015519 3300046452 Bacteria 2579
239 Ga0495592_0023604 3300046454 Bacteria 4678
240 Ga0495603_0001181 3300046455 Bacteria 15218
241 Ga0495603_0001438 3300046455 Bacteria 13837
242 Ga0495603_0001724 3300046455 Bacteria 12884
243 Ga0495603_0036715 3300046455 Bacteria 2941
244 Ga0495603_0037885 3300046455 Bacteria 2893
245 Ga0495603_0060217 3300046455 Bacteria 2243
246 Ga0495603_0073510 3300046455 Bacteria 2008
247 Ga0495590_0026484 3300046457 Bacteria 2036
248 Ga0495629_0002037 3300046459 Bacteria 15715
249 Ga0495629_0003002 3300046459 Bacteria 12836
250 Ga0495629_0005707 3300046459 Bacteria 9295
251 Ga0495629_0017978 3300046459 Bacteria 5068
252 Ga0495629_0050764 3300046459 Bacteria 2904
253 Ga0495629_0075696 3300046459 Bacteria 2350
254 Ga0495629_0122156 3300046459 Bacteria 1814
255 Ga0495629_0169823 3300046459 Bacteria 1514
256 Ga0495638_0041927 3300046460 Bacteria 2893
257 Ga0495638_0091026 3300046460 Bacteria 1838
258 Ga0495638_0109608 3300046460 Bacteria 1641
259 Ga0495651_0006819 3300046462 Bacteria 8723
260 Ga0495651_0007807 3300046462 Bacteria 8190
261 Ga0495651_0017130 3300046462 Bacteria 5615
262 Ga0495651_0018513 3300046462 Bacteria 5395
263 Ga0495651_0024538 3300046462 Bacteria 4690
264 Ga0495653_0005446 3300046463 Bacteria 10372
265 Ga0495653_0030621 3300046463 Bacteria 4283
266 Ga0495653_0033438 3300046463 Bacteria 4074
267 Ga0495653_0168369 3300046463 Bacteria 1515
268 Ga0495580_0073757 3300046472 Bacteria 2382
269 Ga0495580_0195066 3300046472 Bacteria 1396
270 Ga0495580_0401983 3300046472 Bacteria 923
271 Ga0495582_0000326 3300046473 Bacteria 26091
272 Ga0495582_0056730 3300046473 Bacteria 2159
273 Ga0495582_0142498 3300046473 Bacteria 1359
274 Ga0495605_0011527 3300046474 Bacteria 4923
275 Ga0495605_0028696 3300046474 Bacteria 2871
276 Ga0495639_0007621 3300046475 Bacteria 4655
277 Ga0495639_0067593 3300046475 Bacteria 1646
278 Ga0495662_0000955 3300046476 Bacteria 14151
279 Ga0495662_0005268 3300046476 Bacteria 6480
280 Ga0495662_0033613 3300046476 Bacteria 2477
281 Ga0495664_0002010 3300046477 Bacteria 10860
282 Ga0495664_0002921 3300046477 Bacteria 9224
283 Ga0495664_0008613 3300046477 Bacteria 5691
284 Ga0495585_0010912 3300046492 Bacteria 5398
285 Ga0495585_0128412 3300046492 Bacteria 1336
286 Ga0495585_0177507 3300046492 Bacteria 1096
287 Ga0495594_0000221 3300046499 Bacteria 27806
288 Ga0495594_0012173 3300046499 Bacteria 4479
289 Ga0495594_0024083 3300046499 Bacteria 3267
290 Ga0495594_0080574 3300046499 Bacteria 1817
291 Ga0495596_0012458 3300046500 Bacteria 3641
292 Ga0495607_0011472 3300046501 Bacteria 5895
293 Ga0495606_0021183 3300046507 Bacteria 4764
294 Ga0495606_0040722 3300046507 Bacteria 3121
295 Ga0495608_0002499 3300046511 Bacteria 13185
296 Ga0495608_0048058 3300046511 Bacteria 2836
297 Ga0495608_0175181 3300046511 Bacteria 1359
298 Ga0495610_0023708 3300046512 Bacteria 3328
299 Ga0495618_0052031 3300046514 Bacteria 2588
300 Ga0495618_0135726 3300046514 Bacteria 1574
301 Ga0495620_0039195 3300046515 Bacteria 2096
302 Ga0495628_0004832 3300046516 Bacteria 11853
303 Ga0495628_0036712 3300046516 Bacteria 3931
304 Ga0495628_0397990 3300046516 Bacteria 1006
305 Ga0495630_0007649 3300046517 Bacteria 7727
306 Ga0495630_0106601 3300046517 Bacteria 2122
307 Ga0495631_0008193 3300046518 Bacteria 5273
308 Ga0495637_0111761 3300046520 Bacteria 1058
309 Ga0495643_0000832 3300046522 Bacteria 33597
310 Ga0495643_0001743 3300046522 Bacteria 18764
311 Ga0495648_0051756 3300046524 Bacteria 2499
312 Ga0495666_0006067 3300046526 Bacteria 6084
313 Ga0495642_0047856 3300046528 Bacteria 1752
314 Ga0495652_0021082 3300046529 Bacteria 5792
315 Ga0495652_0024076 3300046529 Bacteria 5392
316 Ga0495654_0014886 3300046530 Bacteria 4133
317 Ga0495665_0012455 3300046531 Bacteria 4602
318 Ga0495665_0034807 3300046531 Bacteria 2694
319 Ga0495640_0007992 3300046533 Bacteria 8313
320 Ga0495640_0022997 3300046533 Bacteria 4550
321 Ga0495586_0007194 3300046535 Bacteria 5936
322 Ga0495587_0006780 3300046536 Bacteria 7455
323 Ga0495587_0008029 3300046536 Bacteria 6813
324 Ga0495587_0059795 3300046536 Bacteria 2235
325 Ga0495609_0009483 3300046538 Bacteria 4708
326 Ga0495609_0090724 3300046538 Bacteria 1329
327 Ga0495597_0029721 3300046542 Bacteria 2493
328 Ga0495645_0002797 3300046543 Bacteria 11839
329 Ga0495645_0123333 3300046543 Bacteria 1822
330 Ga0495622_0015516 3300046557 Bacteria 3541
331 Ga0495622_0018660 3300046557 Bacteria 3231
332 Ga0495622_0028074 3300046557 Bacteria 2627
333 Ga0495622_0046511 3300046557 Bacteria 2016
334 Ga0495633_0026263 3300046558 Bacteria 2858
335 Ga0495633_0076483 3300046558 Bacteria 1559
336 Ga0495667_0023705 3300046559 Bacteria 4133
337 Ga0495667_0178109 3300046559 Bacteria 1365
338 Ga0495667_0220294 3300046559 Bacteria 1211
339 Ga0495668_0010598 3300046616 Bacteria 5569
340 Ga0495668_0014108 3300046616 Bacteria 4694
341 Ga0495634_0003504 3300046642 Bacteria 12571
342 Ga0495634_0006926 3300046642 Bacteria 8565
343 Ga0495634_0007769 3300046642 Bacteria 8024
344 Ga0495634_0110757 3300046642 Bacteria 1765
345 Ga0495611_0013776 3300046648 Bacteria 3447
346 Ga0495611_0074438 3300046648 Bacteria 1555
347 Ga0495625_0007698 3300046660 Bacteria 9324
348 Ga0495625_0076576 3300046660 Bacteria 2338
349 Ga0495625_0118606 3300046660 Bacteria 1803
350 Ga0495635_0006083 3300046663 Bacteria 8417
351 Ga0495635_0144040 3300046663 Bacteria 1623
352 Ga0495661_0017009 3300046665 Bacteria 4805
353 Ga0495588_0008993 3300046674 Bacteria 4600
354 Ga0495588_0012367 3300046674 Bacteria 4033
355 Ga0495588_0126823 3300046674 Bacteria 1346
356 Ga0495657_0000556 3300046675 Bacteria 34468
357 Ga0495657_0001413 3300046675 Bacteria 20770
358 Ga0495657_0003897 3300046675 Bacteria 12005
359 Ga0495657_0007080 3300046675 Bacteria 8704
360 Ga0495657_0012620 3300046675 Bacteria 6270
361 Ga0495599_0156920 3300046678 Bacteria 1408
362 Ga0495623_0011657 3300046679 Bacteria 5694
363 Ga0495623_0096077 3300046679 Bacteria 1811
364 Ga0495646_0006483 3300046680 Bacteria 7425
365 Ga0495646_0084765 3300046680 Bacteria 1840
366 Ga0495658_0001418 3300046683 Bacteria 12604
367 Ga0495658_0030438 3300046683 Bacteria 2931
368 Ga0495613_0001711 3300046689 Bacteria 16709
369 Ga0495613_0004686 3300046689 Bacteria 10261
370 Ga0495613_0004815 3300046689 Bacteria 10123
371 Ga0495613_0005745 3300046689 Bacteria 9293
372 Ga0495613_0018198 3300046689 Bacteria 5238
373 Ga0495624_0024375 3300046690 Bacteria 3981
374 Ga0495624_0072546 3300046690 Bacteria 2141
375 Ga0495670_0003945 3300046691 Bacteria 7283
376 Ga0495671_0013813 3300046692 Bacteria 4359
377 Ga0495649_0013805 3300046694 Bacteria 4649
378 Ga0495589_0008886 3300046794 Bacteria 5226
379 Ga0495589_0010046 3300046794 Bacteria 4918
380 Ga0495589_0021782 3300046794 Bacteria 3275
381 Ga0495589_0021944 3300046794 Bacteria 3262
382 Ga0495600_0004873 3300046809 Bacteria 8064
383 Ga0495600_0005748 3300046809 Bacteria 7493
384 Ga0495600_0053893 3300046809 Bacteria 2626
385 Ga0495581_0004418 3300047315 Bacteria 8130
386 Ga0495581_0011314 3300047315 Bacteria 5161
387 Ga0495581_0077349 3300047315 Bacteria 1925
388 Ga0495581_0265772 3300047315 Bacteria 1003
389 Ga0495604_0000703 3300047317 Bacteria 28422
390 Ga0495604_0011562 3300047317 Bacteria 7014
391 Ga0495604_0019382 3300047317 Bacteria 5444
392 Ga0495636_0007192 3300047318 Bacteria 4382
393 Ga0495636_0018534 3300047318 Bacteria 2794
394 Ga0495636_0045978 3300047318 Bacteria 1820
395 Ga0495674_0052301 3300047319 Bacteria 3595
396 Ga0495676_0003994 3300047321 Bacteria 13428
397 Ga0495676_0004378 3300047321 Bacteria 12902
398 Ga0495676_0009985 3300047321 Bacteria 8624
399 Ga0495676_0031781 3300047321 Bacteria 4460
400 Ga0495676_0035638 3300047321 Bacteria 4160
401 Ga0495680_0005070 3300047322 Bacteria 12432
402 Ga0495680_0019374 3300047322 Bacteria 5743
403 Ga0495680_0022385 3300047322 Bacteria 5267
404 Ga0495683_0085066 3300047323 Bacteria 1538
405 Ga0495687_002528 3300047443 Bacteria 14516
406 Ga0495687_011152 3300047443 Bacteria 4854
407 Ga0495687_026134 3300047443 Bacteria 2752
408 Ga0495675_0016568 3300047444 Bacteria 4662
409 Ga0495675_0046753 3300047444 Bacteria 2754
410 Ga0495675_0048272 3300047444 Bacteria 2708
411 Ga0495675_0075815 3300047444 Bacteria 2119
412 Ga0495685_000575 3300047447 Bacteria 11338
413 Ga0495685_001405 3300047447 Bacteria 7351
414 Ga0495685_002972 3300047447 Bacteria 5367
415 Ga0495685_003339 3300047447 Bacteria 5109
416 Ga0495685_013853 3300047447 Bacteria 2736
417 Ga0495685_019400 3300047447 Bacteria 2337
418 Ga0495685_061664 3300047447 Bacteria 1263
419 Ga0495673_0039557 3300047469 Bacteria 2138
420 Ga0495681_0001870 3300047470 Bacteria 15461
421 Ga0495681_0007715 3300047470 Bacteria 6824
422 Ga0495681_0042282 3300047470 Bacteria 2207
423 Ga0495684_0018299 3300047471 Bacteria 5400
424 Ga0495684_0056314 3300047471 Bacteria 2997
425 Ga0495686_0020497 3300047472 Bacteria 4407
426 Ga0495686_0042057 3300047472 Bacteria 2907
427 Ga0495686_0126337 3300047472 Bacteria 1520
428 Ga0495593_0003008 3300047673 Bacteria 10160
429 Ga0495593_0012125 3300047673 Bacteria 4932
430 Ga0495593_0017265 3300047673 Bacteria 4061
431 Ga0495593_0042887 3300047673 Bacteria 2427
432 Ga0495602_0013005 3300048088 Bacteria 8518
433 Ga0495602_0020601 3300048088 Bacteria 6513
434 Ga0495602_0148555 3300048088 Bacteria 1845
435 Ga0495614_0002671 3300048089 Bacteria 7926
436 Ga0495614_0037526 3300048089 Bacteria 2078
437 Ga0495626_0005060 3300048091 Bacteria 7864
438 Ga0496100_0027701 3300048903 Bacteria 3487
439 Ga0496101_0051612 3300048904 Bacteria 2963
440 Ga0496101_0071421 3300048904 Bacteria 2545
441 Ga0496102_0466947 3300048905 Bacteria 1183
442 Ga0496104_0198178 3300048907 Bacteria 1920
443 Ga0496104_0342027 3300048907 Bacteria 1409
444 Ga0496105_0020214 3300048908 Bacteria 5378
445 Ga0496106_0248910 3300048909 Bacteria 1421
446 Ga0496106_0346715 3300048909 Bacteria 1193
447 Ga0496108_0179257 3300048911 Bacteria 1834
448 Ga0496108_0521625 3300048911 Bacteria 1037
449 Ga0496109_0118467 3300048912 Bacteria 2465
450 Ga0496110_0033198 3300048913 Bacteria 4463
451 Ga0496112_0512321 3300048915 Bacteria 1135
452 Ga0496113_0311326 3300048916 Bacteria 1261
453 Ga0496114_0239028 3300048917 Bacteria 1597
454 Ga0501304_001884 3300049160 Bacteria 1402
455 Ga0495678_008905 3300049459 Bacteria 5018
456 Ga0501031_0009088 3300049568 Bacteria 6461
457 Ga0501031_0036432 3300049568 Bacteria 3209
458 Ga0501032_0010067 3300049569 Bacteria 6824
459 Ga0501032_0014834 3300049569 Bacteria 5514
460 Ga0501032_0024138 3300049569 Bacteria 4199
461 Ga0501032_0041299 3300049569 Bacteria 3133
462 Ga0501033_0004814 3300049570 Bacteria 10784
463 Ga0501033_0011264 3300049570 Bacteria 6845
464 Ga0501033_0075948 3300049570 Bacteria 2466
465 Ga0501033_0090354 3300049570 Bacteria 2240
466 Ga0501033_0092476 3300049570 Bacteria 2212
467 Ga0501034_0004090 3300049571 Bacteria 16369
468 Ga0501034_0021466 3300049571 Bacteria 6583
469 Ga0501034_0436260 3300049571 Bacteria 1229
470 Ga0501036_0009705 3300049572 Bacteria 7922
471 Ga0501036_0033481 3300049572 Bacteria 4346
472 Ga0501036_0050680 3300049572 Bacteria 3515
473 Ga0501037_0000573 3300049573 Bacteria 29070
474 Ga0501037_0023575 3300049573 Bacteria 4550
475 Ga0501038_0002326 3300049574 Bacteria 17687
476 Ga0501038_0004052 3300049574 Bacteria 13622
477 Ga0501039_0018586 3300049575 Bacteria 5335
478 Ga0501039_0031369 3300049575 Bacteria 4097
479 Ga0501039_0078422 3300049575 Bacteria 2570
480 Ga0501040_0014436 3300049576 Bacteria 5203
481 Ga0501040_0076406 3300049576 Bacteria 2316
482 Ga0501041_0006781 3300049577 Bacteria 6711
483 Ga0501042_0015108 3300049578 Bacteria 5279
484 Ga0501042_0179679 3300049578 Bacteria 1526
485 Ga0501043_0003835 3300049579 Bacteria 12361
486 Ga0501043_0006236 3300049579 Bacteria 9572
487 Ga0501043_0033621 3300049579 Bacteria 4034
488 Ga0501043_0140899 3300049579 Bacteria 1888
489 Ga0501046_0001264 3300049580 Bacteria 24502
490 Ga0501046_0021195 3300049580 Bacteria 5366
491 Ga0501046_0062276 3300049580 Bacteria 2915
492 Ga0501046_0121776 3300049580 Bacteria 1984
493 Ga0501047_0000336 3300049581 Bacteria 53637
494 Ga0501047_0038898 3300049581 Bacteria 4601
495 Ga0501047_0039031 3300049581 Bacteria 4593
496 Ga0501047_0102049 3300049581 Bacteria 2748
497 Ga0501047_0438426 3300049581 Bacteria 1136
498 Ga0501047_0445077 3300049581 Bacteria 1125
499 Ga0501048_0002421 3300049582 Bacteria 14235
500 Ga0501048_0007831 3300049582 Bacteria 8094
501 Ga0501048_0170599 3300049582 Bacteria 1541
502 Ga0501067_0002184 3300049583 Bacteria 10792
503 Ga0501067_0094329 3300049583 Bacteria 1661
504 Ga0501068_0005585 3300049584 Bacteria 6887
505 Ga0501069_0005802 3300049585 Bacteria 6428
506 Ga0501069_0069063 3300049585 Bacteria 1978
507 Ga0501070_0032133 3300049586 Bacteria 4393
508 Ga0501070_0199155 3300049586 Bacteria 1645
509 Ga0501070_0210087 3300049586 Bacteria 1598
510 Ga0501071_0008461 3300049587 Bacteria 6804
511 Ga0501072_0001019 3300049588 Bacteria 20746
512 Ga0501072_0017196 3300049588 Bacteria 5558
513 Ga0501073_0030186 3300049589 Bacteria 3871
514 Ga0501074_0007984 3300049590 Bacteria 7662
515 Ga0501076_0036101 3300049592 Bacteria 3871
516 Ga0501077_0024205 3300049593 Bacteria 3854
517 Ga0501079_0018687 3300049741 Bacteria 5295
518 Ga0501080_0012928 3300049742 Bacteria 7662
519 Ga0501080_0027919 3300049742 Bacteria 5248
520 Ga0501083_0004283 3300049744 Bacteria 10045
521 Ga0501035_0000762 3300049822 Bacteria 34623
522 Ga0501035_0014559 3300049822 Bacteria 7262
523 Ga0501035_0042823 3300049822 Bacteria 4082
524 Ga0501035_0048208 3300049822 Bacteria 3820
525 Ga0501035_0050972 3300049822 Bacteria 3707
526 Ga0501035_0167327 3300049822 Bacteria 1900
527 Ga0501044_0001145 3300049823 Bacteria 31413
528 Ga0501044_0001268 3300049823 Bacteria 29826
529 Ga0501044_0007891 3300049823 Bacteria 11702
530 Ga0501044_0090593 3300049823 Bacteria 3085
531 Ga0501044_0099875 3300049823 Bacteria 2920
532 Ga0501044_0107322 3300049823 Bacteria 2803
533 Ga0501044_0266186 3300049823 Bacteria 1651
534 Ga0501044_0344819 3300049823 Bacteria 1410
535 Ga0501045_0009566 3300049824 Bacteria 6781
536 nmdc:mga03n38_38335_c1 3300050490 Bacteria 2072
537 nmdc:mga03n38_7007_c1 3300050490 Bacteria 3961
538 nmdc:mga06z11_6526_c1 3300050494 Bacteria 4755
539 nmdc:mga04h51_5303_c1 3300050495 Bacteria 3277
540 nmdc:mga07m45_29792_c1 3300050496 Bacteria 3021
541 nmdc:mga07m45_59899_c1 3300050496 Bacteria 2154
542 nmdc:mga09592_424897_c1 3300050508 Bacteria 1147
543 nmdc:mga08y16_16060_c1 3300050511 Bacteria 7872
544 nmdc:mga08y16_178391_c1 3300050511 Bacteria 2206
545 nmdc:mga0n895_132756_c1 3300050512 Bacteria 2515
546 Ga0495601_0003640 3300053077 Bacteria 8859
547 Ga0495601_0070198 3300053077 Bacteria 2236
548 Ga0495612_0181297 3300053078 Bacteria 925
549 Ga0500610_0105001 3300053079 Bacteria 1458
550 Ga0495619_0040628 3300053085 Bacteria 3040
551 Ga0495619_0161433 3300053085 Bacteria 1548
552 Ga0495619_0259314 3300053085 Bacteria 1205
553 Ga0500578_0042859 3300053086 Bacteria 2905
554 Ga0500578_0104388 3300053086 Bacteria 1791
555 Ga0500646_0040395 3300053090 Bacteria 1312
556 Ga0500640_005900 3300053095 Bacteria 4620
557 Ga0500660_039399 3300053100 Bacteria 2413
558 Ga0500553_158197 3300053101 Bacteria 857
559 Ga0500558_127873 3300053106 Bacteria 975
560 Ga0500560_038059 3300053107 Bacteria 1494
561 Ga0500560_045007 3300053107 Bacteria 1398
562 Ga0500614_021887 3300053123 Bacteria 1487
563 Ga0500652_006043 3300053131 Bacteria 3865
564 Ga0500658_0006061 3300053134 Bacteria 4493
565 Ga0500573_0039211 3300053140 Bacteria 2737
566 Ga0500573_0131796 3300053140 Bacteria 1384
567 Ga0500600_0041042 3300053149 Bacteria 2669
568 Ga0500603_030401 3300053150 Bacteria 1390
569 Ga0500624_001502 3300053157 Bacteria 3689
570 Ga0500633_0002486 3300053160 Bacteria 3806
571 Ga0500587_000486 3300053739 Bacteria 4782
572 Ga0501084_0000962 3300054114 Bacteria 22310
573 Ga0587080_033605 3300059503 Bacteria 905
574 Ga0587067_028553 3300059640 Bacteria 1014
575 Ga0501082_0024130 3300060353 Bacteria 5245
576 Ga0466962_0000437 3300061719 Bacteria 18128
577 Ga0466962_0004812 3300061719 Bacteria 6498
578 Ga0466962_0078458 3300061719 Bacteria 1578
579 2547410950 2547132111 Bacteria 8013147
580 2559432696 2558860280 Bacteria 11429938
581 2585296323 2582581312 Bacteria 7308206
582 2585307073 2582581313 Bacteria 10042643
583 2585320485 2582581314 Bacteria 11452267
584 2616697021 2616644814 Bacteria 11555299
585 2643941601 2643221587 Bacteria 7586415
586 2644263641 2643221647 Bacteria 10741251
587 2644386628 2643221670 Bacteria 6497041
588 2644428685 2643221677 Bacteria 7584031
589 2644439753 2643221678 Bacteria 9540101
590 2644632918 2643221714 Bacteria 9015452
591 2738696420 2738541272 Bacteria 6848551
592 2739325568 2738543027 Bacteria 6409078
593 2739605320 2739367654 Bacteria 6049412
594 2760307822 2758568522 Bacteria 5953541
595 2760623657 2758568621 Bacteria 5967089
596 2776373424 2775506925 Bacteria 7237746
597 2784590156 2784132148 Bacteria 8627943
598 2785341468 2784746763 Bacteria 9783172
599 2785371204 2784746768 Bacteria 10036182
600 2786672390 2786546132 Bacteria 10419719
601 2793984895 2791355406 Bacteria 11364898
602 2808843760 2808606359 Bacteria 9866990
603 2808913305 2808606375 Bacteria 9466072
604 2809028543 2808606394 Bacteria 6248540
605 2809233810 2808606448 Bacteria 8656184
606 2811844712 2808606982 Bacteria 7791042
607 2812356274 2811994879 Bacteria 9313447
608 2819740864 2818991472 Bacteria 10089953
609 2852642004 2852635781 Bacteria 8251373
610 2862179250 2862178590 Bacteria 8583590
611 2862287440 2862281513 Bacteria 9621493
612 2862513206 2862507626 Bacteria 9425308
613 2862577796 2862574272 Bacteria 10567477
614 2862708276 2862705112 Bacteria 6563286
615 2863068776 2863067949 Bacteria 8541735
616 2866553198 2866552031 Bacteria 5824618
617 2867349423 2867346516 Bacteria 7608576
618 2867373616 2867369537 Bacteria 6501581
619 2867436619 2867428634 Bacteria 9590268
620 2867475570 2867475112 Bacteria 6909112
621 2873154322 2873151551 Bacteria 8625867
622 2877679394 2877676314 Bacteria 9512378
623 2884702930 2884693830 Bacteria 11273186
624 2895443888 2895442618 Bacteria 11027144
625 2899370132 2899370129 Bacteria 6781179
626 2912717991 2912715099 Bacteria 9460473
627 2912730421 2912723979 Bacteria 8557534
628 2912762494 2912757875 Bacteria 7940295
629 2918506217 2918501144 Bacteria 8668083
630 2919474266 2919468124 Bacteria 9133025
631 2935391615 2935390628 Bacteria 7043367
632 2946069585 2946064051 Bacteria 8957905
633 2946077472 2946072368 Bacteria 8999607
634 2947227229 2947224130 Bacteria 9938529
635 2954005163 2954002825 Bacteria 9173742
636 2954384285 2954380949 Bacteria 10050426
637 2954678658 2954673503 Bacteria 9685905
638 2954685498 2954682443 Bacteria 9862841
639 2954695106 2954691527 Bacteria 10720516
640 2954710281 2954701450 Bacteria 10834262
641 2954714597 2954711539 Bacteria 10867210
642 2954724542 2954721474 Bacteria 10456478
643 2954737277 2954731030 Bacteria 10243860
644 2954743463 2954740390 Bacteria 10229294
645 2954762420 2954759201 Bacteria 9358192
646 2990048444 2990044586 Bacteria 6603797
647 2990066012 2990059506 Bacteria 9321252
648 2995467350 2995463766 Bacteria 8577691
649 2997453332 2997451912 Bacteria 8492419
650 2997603151 2997600082 Bacteria 9896405
651 3006323927 3006321560 Bacteria 8247479
652 3006491504 3006486233 Bacteria 8157040
653 3006498680 3006493962 Bacteria 8825450
654 8008491249 8008485437 Bacteria 7198341
655 8008577436 8008574985 Bacteria 7815457
656 8023628924 8023623736 Bacteria 8593882
657 8025479608 8025478263 Bacteria 8209203
658 8025530578 8025524527 Bacteria 7197316
659 8025537536 8025530807 Bacteria 8495698
660 8033684519 8033684223 Bacteria 6906479
661 8047896429 8047893842 Bacteria 11723082
662 8048135700 8048127548 Bacteria 11053136
663 8048362506 8048356638 Bacteria 11044339
664 8048373438 8048369669 Bacteria 11666822
665 8048384804 8048379754 Bacteria 11877923
666 8048406721 8048406513 Bacteria 8936924
667 8054166095 8054160619 Bacteria 7783213
668 8056215537 8056207758 Bacteria 8639239
669 8056450864 8056447290 Bacteria 7680491
670 8056580969 8056579771 Bacteria 5840325
671 8056672133 8056667051 Bacteria 6953971
672 8056834916 8056829672 Bacteria 9045328
673 Ga0075363_100037718
674 JGI24739J22299_10013326
675 JGI24743J22301_10029296
676 JGI24738J21930_10005233
677 JGI24738J21930_10005599
678 JGI24738J21930_10013072
679 rootH1_10001942
680 rootL2_10001350
681 rootH1_10032372
682 JGI25404J52841_10011000
683 Ga0070658_10004159
684 Ga0070690_100236727
685 Ga0070682_100047910
686 Ga0070689_100243091
687 Ga0070687_100009050
688 Ga0070661_100014379
689 Ga0070692_10019343
690 Ga0070709_10024567
691 Ga0070710_10311735
692 Ga0070701_10067150
693 Ga0070700_100009476
694 Ga0070663_100255227
695 Ga0070684_100102946
696 Ga0068853_100054232
697 Ga0068853_100101401
698 Ga0070672_100001614
699 Ga0070665_100063269
700 Ga0068855_100202212
701 Ga0070664_100000682
702 Ga0068857_100076099
703 Ga0068854_100101888
704 Ga0068854_100103428
705 Ga0068856_100006857
706 Ga0068856_100175554
707 Ga0070702_100013113
708 Ga0068852_100005409
709 Ga0068852_100112896
710 Ga0068852_100576995
711 Ga0068851_10220347
712 Ga0068870_10001942
713 Ga0068862_100105995
714 Ga0081455_10040298
715 Ga0081455_10045660
716 Ga0081540_1000201
717 Ga0081540_1000530
718 Ga0081540_1000903
719 Ga0075365_10196273
720 Ga0075368_10003859
721 Ga0075367_10008157
722 Ga0075370_10159960
723 Ga0075428_100290510
724 Ga0075429_100464629
725 Ga0068865_100048156
726 Ga0105251_10039905
727 Ga0105250_10012076
728 Ga0105240_10053552
729 Ga0111539_10221043
730 Ga0105245_10102894
731 Ga0105245_10116991
732 Ga0105245_10278883
733 Ga0105243_10126976
734 Ga0105248_10823092
735 Ga0105237_10066475
736 Ga0105238_10014242
737 Ga0105238_10026907
738 Ga0105238_10398497
739 Ga0105249_10011960
740 Ga0105239_10020856
741 Ga0105246_10110148
742 Ga0157369_10031601
743 Ga0163162_10203984
744 Ga0157372_10196363
745 Ga0157375_10293749
746 Ga0157375_10362189
747 Ga0163163_10061058
748 Ga0157380_10024948
749 Ga0182008_10005286
750 Ga0182008_10070429
751 Ga0182007_10000370
752 Ga0183367_1002
753 Ga0206350_11053910
754 Ga0206353_10373363
755 Ga0213875_10005571
756 Ga0213875_10058552
757 Ga0224712_10039593
758 Ga0209758_1011481
759 Ga0207426_1003294
760 Ga0207426_1014699
761 Ga0207426_1046272
762 Ga0207692_10143822
763 Ga0207647_10088677
764 Ga0207699_10043884
765 Ga0207643_10001179
766 Ga0207705_10050116
767 Ga0207695_10026408
768 Ga0207662_10006154
769 Ga0207649_10003945
770 Ga0207694_10060868
771 Ga0207694_10121875
772 Ga0207659_10254663
773 Ga0207687_10356520
774 Ga0207700_10019898
775 Ga0207669_10033499
776 Ga0207704_10026604
777 Ga0207691_10002108
778 Ga0207711_10213820
779 Ga0207661_10085106
780 Ga0207679_10008838
781 Ga0207667_10358781
782 Ga0207668_10317376
783 Ga0207640_10067731
784 Ga0207677_10665883
785 Ga0207639_10077742
786 Ga0207639_10163189
787 Ga0207678_10634828
788 Ga0207708_10000253
789 Ga0207702_10029788
790 Ga0207702_10087228
791 Ga0207648_10004027
792 Ga0207674_10088775
793 Ga0207698_10007290
794 Ga0207698_10007525
795 Ga0209371_1007830
796 Ga0209371_1027279
797 Ga0268266_10140802
798 Ga0307517_10004859
799 Ga0307517_10020507
800 Ga0307515_10019680
801 Ga0307515_10135949
802 Ga0268256_1008104
803 Ga0268256_1012140
804 Ga0307511_10000701
805 Ga0307512_10000716
806 Ga0307512_10037711
807 Ga0316176_1203215
808 Ga0307513_10018177
809 Ga0307513_10251505
810 Ga0307509_10034051
811 Ga0307509_10103539
812 Ga0307408_100098280
813 Ga0307508_10004014
814 Ga0307508_10005903
815 Ga0307508_10010497
816 Ga0307508_10041554
817 Ga0307514_10005164
818 Ga0307514_10066186
819 Ga0307514_10116393
820 Ga0307516_10001020
821 Ga0307516_10150323
822 Ga0307518_10237665
823 Ga0307406_10032143
824 Ga0307409_100253086
825 Ga0307414_10128083
826 Ga0307507_10000001
827 Ga0307507_10107702
828 Ga0307510_10045222
829 Ga0307510_10146585
830 Ga0307510_10336751
831 Ga0373936_0005051
832 Ga0373946_0032831
833 Ga0373924_0131306
834 Ga0373935_0096135
835 Ga0373935_0331255
836 Ga0373947_0013078
837 Ga0373937_0001317
838 Ga0373937_0103368
839 Ga0373925_0021812
840 Ga0373925_0375094
841 Ga0395900_0028897
842 Ga0395900_0123152
843 Ga0395898_0143774
844 Ga0395898_0148356
845 Ga0436364_0801129
846 Ga0436364_1348411
847 Ga0395901_0042499
848 Ga0439436_0000226
849 Ga0439436_0000266
850 Ga0439439_0000523
851 Ga0439433_0045380
852 Ga0439442_011491
853 Ga0439448_0029277
854 Ga0439449_0000647
855 Ga0439449_0025647
856 Ga0439455_0001505
857 Ga0439455_0052055
858 Ga0439457_000058
859 Ga0439457_000383
860 Ga0439457_014779
861 Ga0439462_0000305
862 Ga0450894_000145
863 Ga0450896_002136
864 Ga0450898_001869
865 Ga0450899_000405
866 Ga0450900_001299
867 Ga0450903_000089
868 Ga0451577_0036359
869 Ga0466969_0021837
870 Ga0466969_0023598
871 Ga0466969_0053359
872 Ga0466969_0120773
873 Ga0453683_0068074
874 Ga0466965_0011315
875 Ga0466965_0120005
876 Ga0466966_0009667
877 Ga0466966_0014932
878 Ga0466966_0023395
879 Ga0466961_0001398
880 Ga0466961_0005357
881 Ga0466961_0063210
882 Ga0466961_0080406
883 Ga0466961_0095101
884 Ga0466963_0000478
885 Ga0466963_0006338
886 Ga0466963_0222320
887 Ga0466964_0013106
888 Ga0466971_0000952
889 Ga0466971_0008506
890 Ga0466971_0025452
891 Ga0466971_0032579
892 Ga0466971_0091901
893 Ga0466968_0023940
894 Ga0466970_0000504
895 Ga0466970_0008265
896 Ga0466957_0000371
897 Ga0466957_0271173
898 Ga0466957_0383819
899 Ga0466960_0025615
900 Ga0466960_0036287
901 Ga0466959_0023487
902 Ga0466959_0110359
903 Ga0451576_0048691
904 Ga0466958_0006825
905 Ga0466958_0086804
906 Ga0466967_0002866
907 Ga0466967_0037378
908 Ga0466967_0275999
909 Ga0466967_0584892
910 Ga0495617_015519
911 Ga0495592_0023604
912 Ga0495603_0001181
913 Ga0495603_0001438
914 Ga0495603_0001724
915 Ga0495603_0036715
916 Ga0495603_0037885
917 Ga0495603_0060217
918 Ga0495603_0073510
919 Ga0495590_0026484
920 Ga0495629_0002037
921 Ga0495629_0003002
922 Ga0495629_0005707
923 Ga0495629_0017978
924 Ga0495629_0050764
925 Ga0495629_0075696
926 Ga0495629_0122156
927 Ga0495629_0169823
928 Ga0495638_0041927
929 Ga0495638_0091026
930 Ga0495638_0109608
931 Ga0495651_0006819
932 Ga0495651_0007807
933 Ga0495651_0017130
934 Ga0495651_0018513
935 Ga0495651_0024538
936 Ga0495653_0005446
937 Ga0495653_0030621
938 Ga0495653_0033438
939 Ga0495653_0168369
940 Ga0495580_0073757
941 Ga0495580_0195066
942 Ga0495580_0401983
943 Ga0495582_0000326
944 Ga0495582_0056730
945 Ga0495582_0142498
946 Ga0495605_0011527
947 Ga0495605_0028696
948 Ga0495639_0007621
949 Ga0495639_0067593
950 Ga0495662_0000955
951 Ga0495662_0005268
952 Ga0495662_0033613
953 Ga0495664_0002010
954 Ga0495664_0002921
955 Ga0495664_0008613
956 Ga0495585_0010912
957 Ga0495585_0128412
958 Ga0495585_0177507
959 Ga0495594_0000221
960 Ga0495594_0012173
961 Ga0495594_0024083
962 Ga0495594_0080574
963 Ga0495596_0012458
964 Ga0495607_0011472
965 Ga0495606_0021183
966 Ga0495606_0040722
967 Ga0495608_0002499
968 Ga0495608_0048058
969 Ga0495608_0175181
970 Ga0495610_0023708
971 Ga0495618_0052031
972 Ga0495618_0135726
973 Ga0495620_0039195
974 Ga0495628_0004832
975 Ga0495628_0036712
976 Ga0495628_0397990
977 Ga0495630_0007649
978 Ga0495630_0106601
979 Ga0495631_0008193
980 Ga0495637_0111761
981 Ga0495643_0000832
982 Ga0495643_0001743
983 Ga0495648_0051756
984 Ga0495666_0006067
985 Ga0495642_0047856
986 Ga0495652_0021082
987 Ga0495652_0024076
988 Ga0495654_0014886
989 Ga0495665_0012455
990 Ga0495665_0034807
991 Ga0495640_0007992
992 Ga0495640_0022997
993 Ga0495586_0007194
994 Ga0495587_0006780
995 Ga0495587_0008029
996 Ga0495587_0059795
997 Ga0495609_0009483
998 Ga0495609_0090724
999 Ga0495597_0029721
1000 Ga0495645_0002797
1001 Ga0495645_0123333
1002 Ga0495622_0015516
1003 Ga0495622_0018660
1004 Ga0495622_0028074
1005 Ga0495622_0046511
1006 Ga0495633_0026263
1007 Ga0495633_0076483
1008 Ga0495667_0023705
1009 Ga0495667_0178109
1010 Ga0495667_0220294
1011 Ga0495668_0010598
1012 Ga0495668_0014108
1013 Ga0495634_0003504
1014 Ga0495634_0006926
1015 Ga0495634_0007769
1016 Ga0495634_0110757
1017 Ga0495611_0013776
1018 Ga0495611_0074438
1019 Ga0495625_0007698
1020 Ga0495625_0076576
1021 Ga0495625_0118606
1022 Ga0495635_0006083
1023 Ga0495635_0144040
1024 Ga0495661_0017009
1025 Ga0495588_0008993
1026 Ga0495588_0012367
1027 Ga0495588_0126823
1028 Ga0495657_0000556
1029 Ga0495657_0001413
1030 Ga0495657_0003897
1031 Ga0495657_0007080
1032 Ga0495657_0012620
1033 Ga0495599_0156920
1034 Ga0495623_0011657
1035 Ga0495623_0096077
1036 Ga0495646_0006483
1037 Ga0495646_0084765
1038 Ga0495658_0001418
1039 Ga0495658_0030438
1040 Ga0495613_0001711
1041 Ga0495613_0004686
1042 Ga0495613_0004815
1043 Ga0495613_0005745
1044 Ga0495613_0018198
1045 Ga0495624_0024375
1046 Ga0495624_0072546
1047 Ga0495670_0003945
1048 Ga0495671_0013813
1049 Ga0495649_0013805
1050 Ga0495589_0008886
1051 Ga0495589_0010046
1052 Ga0495589_0021782
1053 Ga0495589_0021944
1054 Ga0495600_0004873
1055 Ga0495600_0005748
1056 Ga0495600_0053893
1057 Ga0495581_0004418
1058 Ga0495581_0011314
1059 Ga0495581_0077349
1060 Ga0495581_0265772
1061 Ga0495604_0000703
1062 Ga0495604_0011562
1063 Ga0495604_0019382
1064 Ga0495636_0007192
1065 Ga0495636_0018534
1066 Ga0495636_0045978
1067 Ga0495674_0052301
1068 Ga0495676_0003994
1069 Ga0495676_0004378
1070 Ga0495676_0009985
1071 Ga0495676_0031781
1072 Ga0495676_0035638
1073 Ga0495680_0005070
1074 Ga0495680_0019374
1075 Ga0495680_0022385
1076 Ga0495683_0085066
1077 Ga0495687_002528
1078 Ga0495687_011152
1079 Ga0495687_026134
1080 Ga0495675_0016568
1081 Ga0495675_0046753
1082 Ga0495675_0048272
1083 Ga0495675_0075815
1084 Ga0495685_000575
1085 Ga0495685_001405
1086 Ga0495685_002972
1087 Ga0495685_003339
1088 Ga0495685_013853
1089 Ga0495685_019400
1090 Ga0495685_061664
1091 Ga0495673_0039557
1092 Ga0495681_0001870
1093 Ga0495681_0007715
1094 Ga0495681_0042282
1095 Ga0495684_0018299
1096 Ga0495684_0056314
1097 Ga0495686_0020497
1098 Ga0495686_0042057
1099 Ga0495686_0126337
1100 Ga0495593_0003008
1101 Ga0495593_0012125
1102 Ga0495593_0017265
1103 Ga0495593_0042887
1104 Ga0495602_0013005
1105 Ga0495602_0020601
1106 Ga0495602_0148555
1107 Ga0495614_0002671
1108 Ga0495614_0037526
1109 Ga0495626_0005060
1110 Ga0496100_0027701
1111 Ga0496101_0051612
1112 Ga0496101_0071421
1113 Ga0496102_0466947
1114 Ga0496104_0198178
1115 Ga0496104_0342027
1116 Ga0496105_0020214
1117 Ga0496106_0248910
1118 Ga0496106_0346715
1119 Ga0496108_0179257
1120 Ga0496108_0521625
1121 Ga0496109_0118467
1122 Ga0496110_0033198
1123 Ga0496112_0512321
1124 Ga0496113_0311326
1125 Ga0496114_0239028
1126 Ga0501304_001884
1127 Ga0495678_008905
1128 Ga0501031_0009088
1129 Ga0501031_0036432
1130 Ga0501032_0010067
1131 Ga0501032_0014834
1132 Ga0501032_0024138
1133 Ga0501032_0041299
1134 Ga0501033_0004814
1135 Ga0501033_0011264
1136 Ga0501033_0075948
1137 Ga0501033_0090354
1138 Ga0501033_0092476
1139 Ga0501034_0004090
1140 Ga0501034_0021466
1141 Ga0501034_0436260
1142 Ga0501036_0009705
1143 Ga0501036_0033481
1144 Ga0501036_0050680
1145 Ga0501037_0000573
1146 Ga0501037_0023575
1147 Ga0501038_0002326
1148 Ga0501038_0004052
1149 Ga0501039_0018586
1150 Ga0501039_0031369
1151 Ga0501039_0078422
1152 Ga0501040_0014436
1153 Ga0501040_0076406
1154 Ga0501041_0006781
1155 Ga0501042_0015108
1156 Ga0501042_0179679
1157 Ga0501043_0003835
1158 Ga0501043_0006236
1159 Ga0501043_0033621
1160 Ga0501043_0140899
1161 Ga0501046_0001264
1162 Ga0501046_0021195
1163 Ga0501046_0062276
1164 Ga0501046_0121776
1165 Ga0501047_0000336
1166 Ga0501047_0038898
1167 Ga0501047_0039031
1168 Ga0501047_0102049
1169 Ga0501047_0438426
1170 Ga0501047_0445077
1171 Ga0501048_0002421
1172 Ga0501048_0007831
1173 Ga0501048_0170599
1174 Ga0501067_0002184
1175 Ga0501067_0094329
1176 Ga0501068_0005585
1177 Ga0501069_0005802
1178 Ga0501069_0069063
1179 Ga0501070_0032133
1180 Ga0501070_0199155
1181 Ga0501070_0210087
1182 Ga0501071_0008461
1183 Ga0501072_0001019
1184 Ga0501072_0017196
1185 Ga0501073_0030186
1186 Ga0501074_0007984
1187 Ga0501076_0036101
1188 Ga0501077_0024205
1189 Ga0501079_0018687
1190 Ga0501080_0012928
1191 Ga0501080_0027919
1192 Ga0501083_0004283
1193 Ga0501035_0000762
1194 Ga0501035_0014559
1195 Ga0501035_0042823
1196 Ga0501035_0048208
1197 Ga0501035_0050972
1198 Ga0501035_0167327
1199 Ga0501044_0001145
1200 Ga0501044_0001268
1201 Ga0501044_0007891
1202 Ga0501044_0090593
1203 Ga0501044_0099875
1204 Ga0501044_0107322
1205 Ga0501044_0266186
1206 Ga0501044_0344819
1207 Ga0501045_0009566
1208 nmdc:mga03n38_38335_c1
1209 nmdc:mga03n38_7007_c1
1210 nmdc:mga06z11_6526_c1
1211 nmdc:mga04h51_5303_c1
1212 nmdc:mga07m45_29792_c1
1213 nmdc:mga07m45_59899_c1
1214 nmdc:mga09592_424897_c1
1215 nmdc:mga08y16_16060_c1
1216 nmdc:mga08y16_178391_c1
1217 nmdc:mga0n895_132756_c1
1218 Ga0495601_0003640
1219 Ga0495601_0070198
1220 Ga0495612_0181297
1221 Ga0500610_0105001
1222 Ga0495619_0040628
1223 Ga0495619_0161433
1224 Ga0495619_0259314
1225 Ga0500578_0042859
1226 Ga0500578_0104388
1227 Ga0500646_0040395
1228 Ga0500640_005900
1229 Ga0500660_039399
1230 Ga0500553_158197
1231 Ga0500558_127873
1232 Ga0500560_038059
1233 Ga0500560_045007
1234 Ga0500614_021887
1235 Ga0500652_006043
1236 Ga0500658_0006061
1237 Ga0500573_0039211
1238 Ga0500573_0131796
1239 Ga0500600_0041042
1240 Ga0500603_030401
1241 Ga0500624_001502
1242 Ga0500633_0002486
1243 Ga0500587_000486
1244 Ga0501084_0000962
1245 Ga0587080_033605
1246 Ga0587067_028553
1247 Ga0501082_0024130
1248 Ga0466962_0000437
1249 Ga0466962_0004812
1250 Ga0466962_0078458
1251 2547410950
1252 2559432696
1253 2585296323
1254 2585307073
1255 2585320485
1256 2616697021
1257 2643941601
1258 2644263641
1259 2644386628
1260 2644428685
1261 2644439753
1262 2644632918
1263 2738696420
1264 2739325568
1265 2739605320
1266 2760307822
1267 2760623657
1268 2776373424
1269 2784590156
1270 2785341468
1271 2785371204
1272 2786672390
1273 2793984895
1274 2808843760
1275 2808913305
1276 2809028543
1277 2809233810
1278 2811844712
1279 2812356274
1280 2819740864
1281 2852642004
1282 2862179250
1283 2862287440
1284 2862513206
1285 2862577796
1286 2862708276
1287 2863068776
1288 2866553198
1289 2867349423
1290 2867373616
1291 2867436619
1292 2867475570
1293 2873154322
1294 2877679394
1295 2884702930
1296 2895443888
1297 2899370132
1298 2912717991
1299 2912730421
1300 2912762494
1301 2918506217
1302 2919474266
1303 2935391615
1304 2946069585
1305 2946077472
1306 2947227229
1307 2954005163
1308 2954384285
1309 2954678658
1310 2954685498
1311 2954695106
1312 2954710281
1313 2954714597
1314 2954724542
1315 2954737277
1316 2954743463
1317 2954762420
1318 2990048444
1319 2990066012
1320 2995467350
1321 2997453332
1322 2997603151
1323 3006323927
1324 3006491504
1325 3006498680
1326 8008491249
1327 8008577436
1328 8023628924
1329 8025479608
1330 8025530578
1331 8025537536
1332 8033684519
1333 8047896429
1334 8048135700
1335 8048362506
1336 8048373438
1337 8048384804
1338 8048406721
1339 8054166095
1340 8056215537
1341 8056450864
1342 8056580969
1343 8056672133
1344 8056834916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7301 11 273
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.723 11 273
5vo5-assembly1.cif.gz_A crystal structure of lgd-shrub complex, single chain fusion 0.5785 189 266
5bpt-assembly1.cif.gz_A atomic-resolution structures of the apc/c subunits apc4 and the apc5 n-terminal domain 0.534 147 269
7x8v-assembly5.cif.gz_E cooperative regulation of pbi1 and mapks controls wrky45 transcription factor in rice immunity 0.528 136 263
ID Description Score Start End Superfamily
af_Q7HP03_2_368_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.5783 150 261 1.20.810.10
af_Q2AAC4_1_138_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5734 156 265 1.20.1070.10
af_A0A1D6ML49_3_186_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.5554 145 259 1.20.1410.10
af_C6KSU5_98_227_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.537 191 265 3.30.40.10
1f1mA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Lipoprotein, type 6 0.5316 152 266 1.20.120.240
ID Description Score Start End GO Terms
AF-X7ZAZ0-F1-model_v4 Putative membrane protein 0.8655 151 272 GO:0016020
AF-A0A2V5ZPF8-F1-model_v4 Succinate dehydrogenase 0.8623 142 273 GO:0016020
AF-A0A1H8HF10-F1-model_v4 Integral membrane protein 0.8467 36 273 GO:0016020
AF-A0A2V6H4D2-F1-model_v4 Succinate dehydrogenase 0.8461 184 273 GO:0016020
AF-A0A2V5ZPF8-F1-model_v4 Succinate dehydrogenase 0.8442 142 273 GO:0016020

Map