F474218

General Info

Members Datasets Scaffolds Average Seq Length
672 261 1344 155

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100978423|Ga0070702_1009784231
Length 152
Sequence MIEDNSSSPFTNAASAEQPFGPPLIGALLRMPWETVQRHMLERLHERGFSDFDAAYLNVFQYPGPQGARPSELAARLRISKQSLGYLLRQLEQRPDPHDQRGKRIVVTRRGTRAIRVIRDAVSEIETTWTQQLGAEHFAQLKELLLKLNQLT

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.97
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100978423 3300005615 Bacteria 668
2 JGI24739J22299_10063664 3300001989 Unclassified 1161
3 JGI24743J22301_10011216 3300001991 Bacteria 1610
4 JGI24748J21848_1011319 3300002074 Unclassified 1051
5 JGI24738J21930_10018906 3300002075 Bacteria 1439
6 JGI24738J21930_10055735 3300002075 Unclassified 808
7 JGI24744J21845_10033527 3300002077 Unclassified 977
8 JGI24742J22300_10017346 3300002244 Unclassified 1217
9 Ga0070658_10017624 3300005327 Bacteria 5712
10 Ga0070658_10089138 3300005327 Bacteria 2540
11 Ga0070658_10366574 3300005327 Bacteria 1234
12 Ga0070658_10453549 3300005327 Unclassified 1105
13 Ga0070683_100006377 3300005329 Bacteria 9893
14 Ga0070683_100009748 3300005329 Bacteria 8227
15 Ga0070683_100027977 3300005329 Bacteria 5090
16 Ga0070683_100070285 3300005329 Bacteria 3265
17 Ga0070683_100084967 3300005329 Bacteria 2966
18 Ga0070683_100134638 3300005329 Bacteria 2340
19 Ga0070683_100156163 3300005329 Unclassified 2164
20 Ga0070683_100757129 3300005329 Archaea 931
21 Ga0070670_101604508 3300005331 Unclassified 598
22 Ga0068869_100866612 3300005334 Bacteria 780
23 Ga0070680_100197381 3300005336 Bacteria 1696
24 Ga0070680_100274816 3300005336 Bacteria 1427
25 Ga0070680_100310078 3300005336 Bacteria 1339
26 Ga0070680_100529501 3300005336 Bacteria 1009
27 Ga0070682_100042025 3300005337 Bacteria 2820
28 Ga0070682_100389514 3300005337 Bacteria 1051
29 Ga0068868_100009175 3300005338 Bacteria 7105
30 Ga0068868_100174214 3300005338 Unclassified 1782
31 Ga0070660_100018736 3300005339 Bacteria 5063
32 Ga0070660_100196895 3300005339 Bacteria 1634
33 Ga0070660_100300752 3300005339 Bacteria 1315
34 Ga0070660_100340147 3300005339 Bacteria 1235
35 Ga0070660_100597584 3300005339 Bacteria 922
36 Ga0070660_101385957 3300005339 Bacteria 597
37 Ga0070689_101209705 3300005340 Bacteria 678
38 Ga0070691_10081682 3300005341 Bacteria 1584
39 Ga0070691_10278848 3300005341 Bacteria 906
40 Ga0070687_100154883 3300005343 Bacteria 1349
41 Ga0070661_100002967 3300005344 Bacteria 11696
42 Ga0070661_100092176 3300005344 Bacteria 2245
43 Ga0070661_100291254 3300005344 Bacteria 1269
44 Ga0070692_10030073 3300005345 Bacteria 2713
45 Ga0070692_10036613 3300005345 Bacteria 2491
46 Ga0070668_100268641 3300005347 Bacteria 1421
47 Ga0070668_100283889 3300005347 Bacteria 1384
48 Ga0070675_100008476 3300005354 Bacteria 7979
49 Ga0070675_100553742 3300005354 Unclassified 1040
50 Ga0070674_100005044 3300005356 Bacteria 7587
51 Ga0070674_100151978 3300005356 Bacteria 1748
52 Ga0070674_100310312 3300005356 Bacteria 1261
53 Ga0070674_100440693 3300005356 Bacteria 1073
54 Ga0070673_100033227 3300005364 Bacteria 3892
55 Ga0070688_100105557 3300005365 Bacteria 1865
56 Ga0070659_100056824 3300005366 Bacteria 3085
57 Ga0070659_100080535 3300005366 Bacteria 2600
58 Ga0070659_100217104 3300005366 Bacteria 1578
59 Ga0070659_100384948 3300005366 Bacteria 1182
60 Ga0070659_100438909 3300005366 Bacteria 1106
61 Ga0070659_100810013 3300005366 Bacteria 815
62 Ga0070659_101514098 3300005366 Bacteria 598
63 Ga0070667_100977734 3300005367 Bacteria 789
64 Ga0070709_10334320 3300005434 Bacteria 1115
65 Ga0070714_100082091 3300005435 Unclassified 2808
66 Ga0070714_100556925 3300005435 Bacteria 1098
67 Ga0070714_100687734 3300005435 Bacteria 986
68 Ga0070714_101693027 3300005435 Bacteria 618
69 Ga0070713_101679022 3300005436 Bacteria 617
70 Ga0070710_10077477 3300005437 Bacteria 1932
71 Ga0070710_10933167 3300005437 Bacteria 628
72 Ga0070701_10004316 3300005438 Bacteria 5739
73 Ga0070711_100055631 3300005439 Bacteria 2734
74 Ga0070711_100080185 3300005439 Bacteria 2323
75 Ga0070711_100223998 3300005439 Bacteria 1463
76 Ga0070711_100961064 3300005439 Bacteria 731
77 Ga0070700_100052575 3300005441 Bacteria 2540
78 Ga0070700_100768452 3300005441 Unclassified 773
79 Ga0070694_100232163 3300005444 Bacteria 1388
80 Ga0070694_100249472 3300005444 Unclassified 1342
81 Ga0070694_100602235 3300005444 Bacteria 885
82 Ga0070663_100023583 3300005455 Bacteria 4126
83 Ga0070663_101516411 3300005455 Bacteria 596
84 Ga0070678_100001394 3300005456 Bacteria 12873
85 Ga0070678_100188627 3300005456 Bacteria 1693
86 Ga0070678_100605567 3300005456 Unclassified 978
87 Ga0070678_101141213 3300005456 Unclassified 721
88 Ga0070662_100009989 3300005457 Bacteria 6214
89 Ga0070662_100028635 3300005457 Bacteria 3878
90 Ga0070662_100414002 3300005457 Bacteria 1114
91 Ga0070681_10008529 3300005458 Bacteria 10035
92 Ga0070681_10022188 3300005458 Bacteria 6372
93 Ga0070681_10030309 3300005458 Bacteria 5427
94 Ga0070681_10071110 3300005458 Unclassified 3444
95 Ga0070681_10104479 3300005458 Bacteria 2775
96 Ga0070681_10436314 3300005458 Bacteria 1222
97 Ga0070681_10774781 3300005458 Unclassified 876
98 Ga0068867_100030408 3300005459 Bacteria 3896
99 Ga0070685_10068662 3300005466 Bacteria 2094
100 Ga0070685_10361058 3300005466 Bacteria 996
101 Ga0070679_100170449 3300005530 Bacteria 2150
102 Ga0070679_100593716 3300005530 Bacteria 1051
103 Ga0070679_100687930 3300005530 Bacteria 965
104 Ga0070684_100006669 3300005535 Bacteria 8947
105 Ga0070684_100016721 3300005535 Bacteria 6003
106 Ga0070684_100075903 3300005535 Bacteria 2965
107 Ga0070684_100104954 3300005535 Bacteria 2528
108 Ga0070684_100194988 3300005535 Bacteria 1844
109 Ga0070684_100287297 3300005535 Unclassified 1508
110 Ga0068853_100007302 3300005539 Bacteria 8845
111 Ga0068853_100696195 3300005539 Bacteria 969
112 Ga0068853_101552941 3300005539 Bacteria 641
113 Ga0070672_100005086 3300005543 Bacteria 8677
114 Ga0070686_100458358 3300005544 Unclassified 982
115 Ga0070686_101111320 3300005544 Bacteria 653
116 Ga0070695_100000615 3300005545 Bacteria 18906
117 Ga0070695_100445569 3300005545 Bacteria 991
118 Ga0070695_101242888 3300005545 Bacteria 614
119 Ga0070696_100437851 3300005546 Bacteria 1029
120 Ga0070696_101409456 3300005546 Bacteria 594
121 Ga0070704_100221334 3300005549 Bacteria 1539
122 Ga0070704_100275551 3300005549 Bacteria 1392
123 Ga0070704_100704290 3300005549 Bacteria 896
124 Ga0068855_100019964 3300005563 Bacteria 8049
125 Ga0068855_100069405 3300005563 Bacteria 4101
126 Ga0068855_100284866 3300005563 Bacteria 1834
127 Ga0068855_100373695 3300005563 Bacteria 1566
128 Ga0068855_101027430 3300005563 Bacteria 865
129 Ga0070664_100038931 3300005564 Bacteria 4004
130 Ga0070664_100055509 3300005564 Unclassified 3363
131 Ga0068857_100650568 3300005577 Bacteria 999
132 Ga0068854_100002294 3300005578 Bacteria 11775
133 Ga0068854_100013117 3300005578 Bacteria 5433
134 Ga0068854_100180856 3300005578 Bacteria 1647
135 Ga0068854_100613799 3300005578 Bacteria 930
136 Ga0068854_100843404 3300005578 Bacteria 802
137 Ga0068854_101418617 3300005578 Bacteria 628
138 Ga0068856_100082675 3300005614 Bacteria 3187
139 Ga0068856_100826512 3300005614 Unclassified 946
140 Ga0068856_101253716 3300005614 Bacteria 757
141 Ga0070702_100016395 3300005615 Bacteria 3800
142 Ga0070702_100101223 3300005615 Bacteria 1768
143 Ga0070702_100419222 3300005615 Bacteria 963
144 Ga0070702_100596928 3300005615 Bacteria 827
145 Ga0068852_100014693 3300005616 Bacteria 6038
146 Ga0068852_100092119 3300005616 Bacteria 2714
147 Ga0068852_100278653 3300005616 Bacteria 1611
148 Ga0068852_100533946 3300005616 Bacteria 1172
149 Ga0068866_10018541 3300005718 Bacteria 3149
150 Ga0068866_10676930 3300005718 Unclassified 705
151 Ga0068861_100036085 3300005719 Bacteria 3667
152 Ga0068861_100053946 3300005719 Bacteria 3061
153 Ga0068851_10017864 3300005834 Bacteria 3413
154 Ga0068870_10228967 3300005840 Bacteria 1142
155 Ga0068870_10424390 3300005840 Bacteria 871
156 Ga0068870_10645989 3300005840 Bacteria 724
157 Ga0068860_100456469 3300005843 Bacteria 1271
158 Ga0081455_10024284 3300005937 Bacteria 5618
159 Ga0081455_10063071 3300005937 Bacteria 3111
160 Ga0081455_10107529 3300005937 Bacteria 2223
161 Ga0081455_10160557 3300005937 Bacteria 1723
162 Ga0081538_10067556 3300005981 Bacteria 1995
163 Ga0070717_10319773 3300006028 Bacteria 1383
164 Ga0070717_11745519 3300006028 Bacteria 563
165 Ga0070715_10016370 3300006163 Bacteria 2785
166 Ga0070712_100106504 3300006175 Bacteria 2084
167 Ga0070712_100276325 3300006175 Unclassified 1351
168 Ga0070712_100355310 3300006175 Unclassified 1200
169 Ga0070712_100490518 3300006175 Bacteria 1028
170 Ga0070712_100503518 3300006175 Unclassified 1015
171 Ga0097621_100058844 3300006237 Bacteria 3145
172 Ga0097621_100254910 3300006237 Unclassified 1538
173 Ga0068871_100062922 3300006358 Bacteria 3034
174 Ga0075431_101514291 3300006847 Unclassified 629
175 Ga0075433_10160428 3300006852 Bacteria 2001
176 Ga0075433_11408466 3300006852 Bacteria 603
177 Ga0075434_100003675 3300006871 Bacteria 13705
178 Ga0075434_100138323 3300006871 Bacteria 2455
179 Ga0075429_100038302 3300006880 Bacteria 4174
180 Ga0068865_100004362 3300006881 Bacteria 8534
181 Ga0068865_100039892 3300006881 Unclassified 3187
182 Ga0075436_100057423 3300006914 Bacteria 2688
183 Ga0075436_100874959 3300006914 Unclassified 671
184 Ga0075435_100035038 3300007076 Bacteria 3981
185 Ga0075435_100365579 3300007076 Bacteria 1238
186 Ga0075435_100417211 3300007076 Bacteria 1156
187 Ga0105240_10016267 3300009093 Bacteria 10078
188 Ga0105240_10631415 3300009093 Bacteria 1176
189 Ga0105240_10718590 3300009093 Bacteria 1089
190 Ga0105240_11183699 3300009093 Bacteria 810
191 Ga0105240_11276411 3300009093 Bacteria 775
192 Ga0111539_10053399 3300009094 Bacteria 4810
193 Ga0111539_11607644 3300009094 Unclassified 754
194 Ga0111539_12064530 3300009094 Unclassified 661
195 Ga0105245_10038853 3300009098 Bacteria 4235
196 Ga0105245_10139105 3300009098 Bacteria 2285
197 Ga0105245_10163804 3300009098 Bacteria 2112
198 Ga0105245_12894272 3300009098 Unclassified 532
199 Ga0105243_10124962 3300009148 Bacteria 2175
200 Ga0105243_10300788 3300009148 Bacteria 1454
201 Ga0105243_10824892 3300009148 Bacteria 916
202 Ga0105241_11256332 3300009174 Bacteria 703
203 Ga0105242_10016923 3300009176 Bacteria 5674
204 Ga0105242_10608760 3300009176 Bacteria 1056
205 Ga0105242_11831163 3300009176 Bacteria 646
206 Ga0105248_10067661 3300009177 Bacteria 4010
207 Ga0105248_11812553 3300009177 Bacteria 692
208 Ga0105237_11309257 3300009545 Unclassified 731
209 Ga0105238_10078587 3300009551 Bacteria 3289
210 Ga0105238_10225814 3300009551 Bacteria 1849
211 Ga0105238_10302215 3300009551 Bacteria 1584
212 Ga0105249_10267151 3300009553 Bacteria 1703
213 Ga0105249_10852117 3300009553 Bacteria 977
214 Ga0105249_11449302 3300009553 Unclassified 759
215 Ga0105239_10038227 3300010375 Bacteria 5259
216 Ga0105239_10292004 3300010375 Bacteria 1836
217 Ga0105239_10313400 3300010375 Bacteria 1768
218 Ga0105239_11066333 3300010375 Bacteria 930
219 Ga0105246_10195756 3300011119 Bacteria 1568
220 Ga0105246_10462057 3300011119 Bacteria 1069
221 Ga0157328_1025928 3300012478 Bacteria 526
222 Ga0157373_10055530 3300013100 Bacteria 2813
223 Ga0157373_10324182 3300013100 Bacteria 1096
224 Ga0157371_10009977 3300013102 Bacteria 7433
225 Ga0157371_10191791 3300013102 Bacteria 1463
226 Ga0157370_10002093 3300013104 Bacteria 24386
227 Ga0157370_10181250 3300013104 Unclassified 1957
228 Ga0157370_10439756 3300013104 Bacteria 1199
229 Ga0157370_10639098 3300013104 Bacteria 973
230 Ga0157369_10020061 3300013105 Bacteria 7476
231 Ga0157369_10020330 3300013105 Bacteria 7421
232 Ga0157369_10026673 3300013105 Bacteria 6407
233 Ga0157369_10149376 3300013105 Bacteria 2470
234 Ga0157369_11829734 3300013105 Bacteria 617
235 Ga0157374_10142680 3300013296 Bacteria 2325
236 Ga0157374_11310458 3300013296 Bacteria 746
237 Ga0157378_12102071 3300013297 Bacteria 615
238 Ga0157372_10054570 3300013307 Bacteria 4458
239 Ga0157372_10194535 3300013307 Bacteria 2349
240 Ga0157372_10688144 3300013307 Bacteria 1190
241 Ga0157372_10981227 3300013307 Bacteria 979
242 Ga0157372_11737398 3300013307 Bacteria 718
243 Ga0157375_10346248 3300013308 Bacteria 1652
244 Ga0157375_10479293 3300013308 Unclassified 1409
245 Ga0163163_10071430 3300014325 Unclassified 3459
246 Ga0163163_10293209 3300014325 Bacteria 1679
247 Ga0157377_10011937 3300014745 Bacteria 4353
248 Ga0157377_10086793 3300014745 Bacteria 1840
249 Ga0157379_11092076 3300014968 Unclassified 764
250 Ga0157376_10505398 3300014969 Bacteria 1188
251 Ga0163161_10206824 3300017792 Bacteria 1514
252 Ga0197907_10753629 3300020069 Bacteria 1046
253 Ga0206356_10288350 3300020070 Bacteria 1051
254 Ga0206356_11138170 3300020070 Bacteria 2476
255 Ga0206354_10392977 3300020081 Bacteria 1766
256 Ga0206354_10706762 3300020081 Unclassified 810
257 Ga0206354_11250015 3300020081 Bacteria 1066
258 Ga0206353_10708468 3300020082 Bacteria 3482
259 Ga0206353_11071379 3300020082 Bacteria 888
260 Ga0224712_10021866 3300022467 Bacteria 2196
261 Ga0207692_10350093 3300025898 Bacteria 910
262 Ga0207642_10023734 3300025899 Bacteria 2455
263 Ga0207688_10004375 3300025901 Bacteria 7693
264 Ga0207688_10047719 3300025901 Bacteria 2391
265 Ga0207688_10519834 3300025901 Bacteria 746
266 Ga0207647_10182607 3300025904 Bacteria 1218
267 Ga0207643_10416236 3300025908 Bacteria 851
268 Ga0207705_10041853 3300025909 Bacteria 3287
269 Ga0207705_10239967 3300025909 Bacteria 1380
270 Ga0207705_10891375 3300025909 Bacteria 689
271 Ga0207707_10174243 3300025912 Bacteria 1879
272 Ga0207707_10310115 3300025912 Bacteria 1363
273 Ga0207707_10322531 3300025912 Bacteria 1333
274 Ga0207707_10392702 3300025912 Unclassified 1192
275 Ga0207695_10032302 3300025913 Bacteria 5730
276 Ga0207695_10134850 3300025913 Bacteria 2423
277 Ga0207695_10392392 3300025913 Bacteria 1273
278 Ga0207695_10507250 3300025913 Unclassified 1088
279 Ga0207693_10036828 3300025915 Bacteria 3858
280 Ga0207693_10051984 3300025915 Bacteria 3214
281 Ga0207693_10554593 3300025915 Bacteria 896
282 Ga0207693_10640508 3300025915 Bacteria 826
283 Ga0207663_10128778 3300025916 Bacteria 1745
284 Ga0207663_10436035 3300025916 Bacteria 1008
285 Ga0207663_10523889 3300025916 Bacteria 923
286 Ga0207660_10102262 3300025917 Bacteria 2142
287 Ga0207660_10110350 3300025917 Bacteria 2069
288 Ga0207660_10174081 3300025917 Bacteria 1668
289 Ga0207660_10332837 3300025917 Unclassified 1214
290 Ga0207662_10080014 3300025918 Bacteria 1992
291 Ga0207657_10005818 3300025919 Bacteria 12842
292 Ga0207657_10009234 3300025919 Bacteria 9938
293 Ga0207657_10011669 3300025919 Bacteria 8708
294 Ga0207657_10020278 3300025919 Bacteria 6287
295 Ga0207657_10356587 3300025919 Bacteria 1153
296 Ga0207657_10368699 3300025919 Bacteria 1131
297 Ga0207657_11146554 3300025919 Bacteria 593
298 Ga0207649_10011899 3300025920 Bacteria 4814
299 Ga0207649_10182134 3300025920 Bacteria 1471
300 Ga0207649_10372767 3300025920 Bacteria 1062
301 Ga0207652_10193056 3300025921 Bacteria 1831
302 Ga0207652_10487433 3300025921 Unclassified 1110
303 Ga0207694_10378768 3300025924 Bacteria 1174
304 Ga0207694_11326177 3300025924 Unclassified 608
305 Ga0207659_10191601 3300025926 Bacteria 1628
306 Ga0207659_11441759 3300025926 Unclassified 590
307 Ga0207687_10332050 3300025927 Bacteria 1234
308 Ga0207700_10918050 3300025928 Bacteria 784
309 Ga0207664_10292538 3300025929 Bacteria 1431
310 Ga0207664_10403685 3300025929 Bacteria 1216
311 Ga0207664_10871981 3300025929 Bacteria 809
312 Ga0207690_10165494 3300025932 Bacteria 1652
313 Ga0207690_10245548 3300025932 Bacteria 1381
314 Ga0207690_10314433 3300025932 Bacteria 1229
315 Ga0207690_11139552 3300025932 Unclassified 650
316 Ga0207706_10009769 3300025933 Bacteria 8806
317 Ga0207706_10023628 3300025933 Bacteria 5520
318 Ga0207706_10108780 3300025933 Unclassified 2439
319 Ga0207686_10012742 3300025934 Bacteria 4631
320 Ga0207686_10264569 3300025934 Bacteria 1262
321 Ga0207686_10654163 3300025934 Bacteria 832
322 Ga0207686_10862879 3300025934 Unclassified 729
323 Ga0207709_10041847 3300025935 Bacteria 2752
324 Ga0207709_10805212 3300025935 Unclassified 758
325 Ga0207670_11613256 3300025936 Unclassified 552
326 Ga0207704_10098366 3300025938 Bacteria 1943
327 Ga0207704_10187185 3300025938 Unclassified 1502
328 Ga0207691_10008877 3300025940 Bacteria 9650
329 Ga0207711_10168250 3300025941 Bacteria 1988
330 Ga0207689_10150994 3300025942 Bacteria 1915
331 Ga0207661_10015392 3300025944 Bacteria 5628
332 Ga0207661_10040866 3300025944 Bacteria 3648
333 Ga0207661_10053139 3300025944 Bacteria 3240
334 Ga0207661_10128400 3300025944 Bacteria 2168
335 Ga0207661_10199393 3300025944 Bacteria 1759
336 Ga0207661_10289987 3300025944 Bacteria 1464
337 Ga0207661_10438206 3300025944 Unclassified 1189
338 Ga0207661_10661207 3300025944 Bacteria 960
339 Ga0207661_10687534 3300025944 Bacteria 941
340 Ga0207679_10093445 3300025945 Unclassified 2333
341 Ga0207679_10152951 3300025945 Bacteria 1880
342 Ga0207667_10375352 3300025949 Bacteria 1449
343 Ga0207667_10578333 3300025949 Bacteria 1134
344 Ga0207667_11232404 3300025949 Bacteria 727
345 Ga0207667_11455923 3300025949 Bacteria 657
346 Ga0207651_10084033 3300025960 Bacteria 2304
347 Ga0207712_11636661 3300025961 Unclassified 577
348 Ga0207712_11787162 3300025961 Unclassified 551
349 Ga0207668_10275588 3300025972 Bacteria 1377
350 Ga0207668_10328180 3300025972 Bacteria 1272
351 Ga0207640_10025917 3300025981 Bacteria 3555
352 Ga0207640_11004281 3300025981 Bacteria 734
353 Ga0207640_11021632 3300025981 Bacteria 728
354 Ga0207640_11056276 3300025981 Unclassified 717
355 Ga0207677_10162624 3300026023 Unclassified 1736
356 Ga0207677_10259373 3300026023 Bacteria 1416
357 Ga0207703_11364420 3300026035 Bacteria 682
358 Ga0207639_10201050 3300026041 Bacteria 1709
359 Ga0207639_10374925 3300026041 Bacteria 1276
360 Ga0207678_10043579 3300026067 Bacteria 3882
361 Ga0207678_11223976 3300026067 Bacteria 665
362 Ga0207708_10071672 3300026075 Bacteria 2655
363 Ga0207702_10035057 3300026078 Bacteria 4196
364 Ga0207648_10085316 3300026089 Bacteria 2755
365 Ga0207674_10002821 3300026116 Bacteria 21604
366 Ga0207675_100014290 3300026118 Bacteria 7400
367 Ga0207675_100260631 3300026118 Bacteria 1680
368 Ga0207683_10040890 3300026121 Bacteria 4048
369 Ga0207683_10062780 3300026121 Bacteria 3272
370 Ga0207698_10061556 3300026142 Bacteria 2926
371 Ga0207698_10327710 3300026142 Bacteria 1437
372 Ga0207698_10380670 3300026142 Bacteria 1342
373 Ga0207698_10912210 3300026142 Bacteria 886
374 Ga0268265_12265805 3300028380 Bacteria 550
375 Ga0268264_10645199 3300028381 Bacteria 1047
376 Ga0265327_10078428 3300031251 Unclassified 1636
377 Ga0307408_100325971 3300031548 Bacteria 1295
378 Ga0265313_10240111 3300031595 Bacteria 742
379 Ga0307405_10269747 3300031731 Bacteria 1275
380 Ga0307405_10606719 3300031731 Bacteria 894
381 Ga0307405_10928292 3300031731 Unclassified 738
382 Ga0307405_11601449 3300031731 Bacteria 575
383 Ga0307413_10110761 3300031824 Bacteria 1837
384 Ga0307410_10004565 3300031852 Bacteria 7178
385 Ga0307410_10474077 3300031852 Unclassified 1025
386 Ga0307406_10135191 3300031901 Bacteria 1737
387 Ga0307406_10144243 3300031901 Bacteria 1690
388 Ga0307406_10679520 3300031901 Unclassified 857
389 Ga0307407_10028268 3300031903 Bacteria 2996
390 Ga0307407_10241234 3300031903 Bacteria 1233
391 Ga0307409_100147658 3300031995 Bacteria 2036
392 Ga0307409_100187042 3300031995 Bacteria 1839
393 Ga0307416_100186778 3300032002 Bacteria 1949
394 Ga0307416_100342200 3300032002 Bacteria 1509
395 Ga0307416_100718632 3300032002 Bacteria 1089
396 Ga0307416_100952750 3300032002 Bacteria 960
397 Ga0307416_100980059 3300032002 Unclassified 948
398 Ga0307416_101061307 3300032002 Bacteria 914
399 Ga0307416_101620179 3300032002 Unclassified 752
400 Ga0307414_11224335 3300032004 Unclassified 695
401 Ga0307411_10345040 3300032005 Unclassified 1211
402 Ga0307411_10775537 3300032005 Bacteria 842
403 Ga0307415_100006229 3300032126 Bacteria 6412
404 Ga0307415_100178222 3300032126 Bacteria 1665
405 Ga0307415_101788145 3300032126 Bacteria 594
406 Ga0373958_0107407 3300034819 Bacteria 662
407 Ga0373960_0214849 3300035121 Bacteria 686
408 Ga0373955_0896075 3300035172 Unclassified 546
409 Ga0373937_0213227 3300036401 Bacteria 1817
410 Ga0373937_0439995 3300036401 Bacteria 1238
411 Ga0373937_0456438 3300036401 Bacteria 1214
412 Ga0395899_0047124 3300037312 Bacteria 3209
413 Ga0395900_0110019 3300037418 Unclassified 2831
414 Ga0395900_0116762 3300037418 Bacteria 2738
415 Ga0395900_0133038 3300037418 Bacteria 2548
416 Ga0395900_0288281 3300037418 Unclassified 1631
417 Ga0395898_0010024 3300037466 Bacteria 9923
418 Ga0395898_0032119 3300037466 Bacteria 5239
419 Ga0395898_0041231 3300037466 Bacteria 4560
420 Ga0395898_0109432 3300037466 Bacteria 2649
421 Ga0395898_0162389 3300037466 Unclassified 2137
422 Ga0395898_0383942 3300037466 Bacteria 1339
423 Ga0395898_0855523 3300037466 Bacteria 848
424 Ga0395898_0907257 3300037466 Bacteria 819
425 Ga0395905_0032431 3300037471 Bacteria 4913
426 Ga0395905_0224750 3300037471 Bacteria 1756
427 Ga0395905_0413950 3300037471 Bacteria 1243
428 Ga0395905_0472586 3300037471 Bacteria 1153
429 Ga0395905_0511181 3300037471 Bacteria 1101
430 Ga0395905_0694054 3300037471 Unclassified 920
431 Ga0395901_0009351 3300038443 Bacteria 9939
432 Ga0395901_0086071 3300038443 Bacteria 3286
433 Ga0395901_0143649 3300038443 Unclassified 2508
434 Ga0395901_0380905 3300038443 Unclassified 1452
435 Ga0451800_0185866 3300041459 Bacteria 574
436 Ga0451802_2027163 3300041460 Unclassified 574
437 Ga0451855_1642264 3300041511 Unclassified 922
438 Ga0451853_1209984 3300041512 Unclassified 542
439 Ga0439448_0030497 3300042005 Unclassified 1711
440 Ga0450906_071099 3300042145 Unclassified 623
441 Ga0466963_0003275 3300044694 Bacteria 9230
442 Ga0466963_0010934 3300044694 Bacteria 5513
443 Ga0466963_0019373 3300044694 Bacteria 4266
444 Ga0466963_0334207 3300044694 Bacteria 1067
445 Ga0453684_0530074 3300044712 Bacteria 1300
446 Ga0453684_0966795 3300044712 Bacteria 908
447 Ga0466957_0033675 3300044842 Unclassified 3074
448 Ga0466957_0241576 3300044842 Unclassified 1198
449 Ga0451576_0075378 3300045051 Bacteria 3510
450 Ga0466958_0005089 3300045836 Bacteria 7025
451 Ga0466958_0841724 3300045836 Unclassified 598
452 Ga0466967_0015853 3300045976 Bacteria 5923
453 Ga0466967_0041757 3300045976 Bacteria 3958
454 Ga0466967_0070756 3300045976 Bacteria 3121
455 Ga0466967_0143079 3300045976 Unclassified 2229
456 Ga0466967_0216703 3300045976 Bacteria 1817
457 Ga0466967_0229567 3300045976 Bacteria 1767
458 Ga0466967_0234468 3300045976 Unclassified 1748
459 Ga0466967_0461606 3300045976 Bacteria 1242
460 Ga0466967_0498170 3300045976 Bacteria 1195
461 Ga0466967_0740746 3300045976 Unclassified 974
462 Ga0466967_2129041 3300045976 Unclassified 557
463 Ga0495651_0037122 3300046462 Unclassified 3794
464 Ga0495651_0152974 3300046462 Bacteria 1661
465 Ga0495605_0393092 3300046474 Unclassified 577
466 Ga0495608_0404408 3300046511 Unclassified 835
467 Ga0495630_0567779 3300046517 Unclassified 870
468 Ga0495667_0268944 3300046559 Bacteria 1083
469 Ga0495599_0374118 3300046678 Bacteria 851
470 Ga0495613_0245863 3300046689 Bacteria 1250
471 Ga0495600_0108510 3300046809 Bacteria 1808
472 Ga0495674_0469097 3300047319 Unclassified 1010
473 Ga0495680_0044634 3300047322 Plasmid 3504
474 Ga0495680_0110396 3300047322 Bacteria 2039
475 Ga0495684_0178227 3300047471 Bacteria 1577
476 Ga0495684_0899147 3300047471 Bacteria 570
477 Ga0495602_0084627 3300048088 Bacteria 2653
478 Ga0495602_0214555 3300048088 Bacteria 1458
479 Ga0496100_0117915 3300048903 Bacteria 1853
480 Ga0496100_0126193 3300048903 Bacteria 1796
481 Ga0496100_0214710 3300048903 Bacteria 1409
482 Ga0496100_1443428 3300048903 Bacteria 543
483 Ga0496101_0020447 3300048904 Bacteria 4532
484 Ga0496101_0081866 3300048904 Bacteria 2388
485 Ga0496101_0213913 3300048904 Bacteria 1494
486 Ga0496101_0258703 3300048904 Bacteria 1357
487 Ga0496101_0891964 3300048904 Unclassified 700
488 Ga0496101_1203754 3300048904 Bacteria 593
489 Ga0496102_0002988 3300048905 Bacteria 14318
490 Ga0496102_0033530 3300048905 Bacteria 4615
491 Ga0496102_0095711 3300048905 Bacteria 2752
492 Ga0496102_0111748 3300048905 Bacteria 2547
493 Ga0496102_0318907 3300048905 Bacteria 1464
494 Ga0496102_0891507 3300048905 Bacteria 811
495 Ga0496102_1969472 3300048905 Bacteria 501
496 Ga0496103_0013376 3300048906 Bacteria 4864
497 Ga0496103_0018263 3300048906 Bacteria 4206
498 Ga0496103_0057943 3300048906 Bacteria 2406
499 Ga0496103_0528889 3300048906 Unclassified 753
500 Ga0496104_0051592 3300048907 Bacteria 3882
501 Ga0496105_0044974 3300048908 Bacteria 3642
502 Ga0496105_0064711 3300048908 Unclassified 3017
503 Ga0496105_0076528 3300048908 Bacteria 2763
504 Ga0496106_0002050 3300048909 Bacteria 15148
505 Ga0496106_0049483 3300048909 Bacteria 3166
506 Ga0496107_0033335 3300048910 Bacteria 3684
507 Ga0496107_0066149 3300048910 Unclassified 2620
508 Ga0496107_0127499 3300048910 Bacteria 1877
509 Ga0496107_0266445 3300048910 Bacteria 1275
510 Ga0496107_0744238 3300048910 Bacteria 719
511 Ga0496108_0001649 3300048911 Bacteria 17687
512 Ga0496108_0146337 3300048911 Bacteria 2037
513 Ga0496108_0973833 3300048911 Bacteria 725
514 Ga0496109_0001364 3300048912 Bacteria 20245
515 Ga0496109_0013381 3300048912 Bacteria 7114
516 Ga0496109_0033063 3300048912 Bacteria 4652
517 Ga0496109_0388003 3300048912 Unclassified 1319
518 Ga0496109_0401553 3300048912 Bacteria 1295
519 Ga0496109_0403205 3300048912 Bacteria 1292
520 Ga0496109_0757973 3300048912 Unclassified 908
521 Ga0496110_0025630 3300048913 Bacteria 5042
522 Ga0496110_0177421 3300048913 Unclassified 1934
523 Ga0496110_0354264 3300048913 Bacteria 1337
524 Ga0496110_0499689 3300048913 Bacteria 1107
525 Ga0496110_0501585 3300048913 Bacteria 1105
526 Ga0496110_1904318 3300048913 Bacteria 505
527 Ga0496112_0098174 3300048915 Unclassified 2899
528 Ga0496112_0159730 3300048915 Bacteria 2220
529 Ga0496112_0244451 3300048915 Bacteria 1747
530 Ga0496112_0339205 3300048915 Bacteria 1446
531 Ga0496113_0220912 3300048916 Bacteria 1510
532 Ga0496113_0393372 3300048916 Bacteria 1113
533 Ga0496113_0769398 3300048916 Bacteria 766
534 Ga0496113_0804355 3300048916 Bacteria 747
535 Ga0496114_0040617 3300048917 Bacteria 3852
536 Ga0496114_0074612 3300048917 Bacteria 2855
537 Ga0496114_0074891 3300048917 Bacteria 2850
538 Ga0496114_0209202 3300048917 Bacteria 1710
539 Ga0496114_0405944 3300048917 Unclassified 1206
540 Ga0496114_0551710 3300048917 Bacteria 1018
541 Ga0496115_0006039 3300048918 Bacteria 8844
542 Ga0496115_0064649 3300048918 Unclassified 2953
543 Ga0496115_0095562 3300048918 Bacteria 2432
544 Ga0501291_060934 3300049514 Unclassified 710
545 Ga0501031_0008602 3300049568 Bacteria 6642
546 Ga0501031_0019483 3300049568 Bacteria 4420
547 Ga0501031_0059993 3300049568 Bacteria 2479
548 Ga0501032_0011933 3300049569 Bacteria 6223
549 Ga0501033_0266149 3300049570 Bacteria 1212
550 Ga0501034_0078081 3300049571 Bacteria 3316
551 Ga0501034_0204587 3300049571 Bacteria 1931
552 Ga0501036_0090402 3300049572 Bacteria 2586
553 Ga0501036_0121928 3300049572 Bacteria 2201
554 Ga0501037_0045540 3300049573 Bacteria 3220
555 Ga0501037_0132301 3300049573 Bacteria 1788
556 Ga0501037_0340599 3300049573 Bacteria 1036
557 Ga0501038_0039034 3300049574 Bacteria 4155
558 Ga0501038_0185518 3300049574 Bacteria 1676
559 Ga0501039_0010595 3300049575 Bacteria 7024
560 Ga0501039_0147864 3300049575 Bacteria 1846
561 Ga0501040_0019106 3300049576 Bacteria 4556
562 Ga0501040_0045029 3300049576 Bacteria 3008
563 Ga0501040_0103605 3300049576 Bacteria 1986
564 Ga0501040_0130669 3300049576 Bacteria 1766
565 Ga0501040_0141684 3300049576 Bacteria 1694
566 Ga0501041_0020035 3300049577 Bacteria 3995
567 Ga0501041_0029413 3300049577 Bacteria 3314
568 Ga0501041_0055745 3300049577 Bacteria 2413
569 Ga0501041_0062808 3300049577 Bacteria 2274
570 Ga0501042_0002816 3300049578 Bacteria 10769
571 Ga0501042_0018437 3300049578 Bacteria 4831
572 Ga0501042_0055653 3300049578 Bacteria 2823
573 Ga0501043_0032947 3300049579 Bacteria 4075
574 Ga0501043_0073590 3300049579 Bacteria 2684
575 Ga0501043_0772601 3300049579 Bacteria 697
576 Ga0501046_0026444 3300049580 Bacteria 4740
577 Ga0501046_0122137 3300049580 Bacteria 1981
578 Ga0501046_0170897 3300049580 Bacteria 1631
579 Ga0501048_0042462 3300049582 Bacteria 3255
580 Ga0501048_0099833 3300049582 Bacteria 2047
581 Ga0501068_0038074 3300049584 Bacteria 2880
582 Ga0501068_1198826 3300049584 Bacteria 503
583 Ga0501069_0100759 3300049585 Bacteria 1639
584 Ga0501069_0162274 3300049585 Unclassified 1287
585 Ga0501070_0027634 3300049586 Bacteria 4759
586 Ga0501070_0473689 3300049586 Bacteria 1008
587 Ga0501071_0031950 3300049587 Bacteria 3735
588 Ga0501071_0035488 3300049587 Bacteria 3551
589 Ga0501071_0064761 3300049587 Bacteria 2652
590 Ga0501071_0076443 3300049587 Bacteria 2445
591 Ga0501071_0440509 3300049587 Bacteria 997
592 Ga0501072_0029550 3300049588 Bacteria 4282
593 Ga0501072_0036148 3300049588 Bacteria 3871
594 Ga0501072_0184292 3300049588 Bacteria 1665
595 Ga0501072_0194610 3300049588 Bacteria 1617
596 Ga0501072_0274197 3300049588 Bacteria 1342
597 Ga0501073_0211729 3300049589 Bacteria 1339
598 Ga0501074_0004376 3300049590 Bacteria 10093
599 Ga0501074_0005872 3300049590 Bacteria 8852
600 Ga0501074_0019203 3300049590 Bacteria 4963
601 Ga0501075_0016453 3300049591 Bacteria 5327
602 Ga0501075_0043909 3300049591 Bacteria 3352
603 Ga0501075_0351712 3300049591 Bacteria 1123
604 Ga0501076_0025152 3300049592 Bacteria 4605
605 Ga0501076_0080332 3300049592 Bacteria 2617
606 Ga0501076_0168544 3300049592 Bacteria 1785
607 Ga0501076_0559032 3300049592 Bacteria 943
608 Ga0501076_0666645 3300049592 Bacteria 858
609 Ga0501077_0006947 3300049593 Bacteria 6971
610 Ga0501077_0072553 3300049593 Bacteria 2181
611 Ga0501077_0121839 3300049593 Bacteria 1653
612 Ga0501077_0159034 3300049593 Bacteria 1434
613 Ga0501077_0230537 3300049593 Bacteria 1177
614 Ga0501079_0017261 3300049741 Bacteria 5509
615 Ga0501079_0113337 3300049741 Bacteria 2107
616 Ga0501079_0571755 3300049741 Bacteria 889
617 Ga0501080_0028201 3300049742 Bacteria 5221
618 Ga0501080_0047812 3300049742 Bacteria 3983
619 Ga0501080_0152754 3300049742 Bacteria 2133
620 Ga0501080_0412759 3300049742 Bacteria 1214
621 Ga0501081_0024187 3300049743 Bacteria 4077
622 Ga0501081_0111123 3300049743 Unclassified 1945
623 Ga0501081_0147705 3300049743 Bacteria 1687
624 Ga0501081_0231212 3300049743 Bacteria 1346
625 Ga0501081_0572659 3300049743 Bacteria 844
626 Ga0501083_0017675 3300049744 Bacteria 4971
627 Ga0501083_0426564 3300049744 Bacteria 863
628 Ga0501083_0710182 3300049744 Bacteria 654
629 Ga0501283_088662 3300049779 Unclassified 590
630 Ga0501035_0024468 3300049822 Bacteria 5536
631 Ga0501035_0051914 3300049822 Bacteria 3669
632 Ga0501035_0132095 3300049822 Bacteria 2176
633 Ga0501044_0100608 3300049823 Bacteria 2909
634 Ga0501044_0120440 3300049823 Bacteria 2626
635 Ga0501044_1191350 3300049823 Bacteria 630
636 Ga0501045_0013502 3300049824 Bacteria 5769
637 Ga0501045_0020594 3300049824 Bacteria 4713
638 Ga0501045_0189690 3300049824 Bacteria 1532
639 Ga0501045_0345474 3300049824 Bacteria 1107
640 nmdc:mga05p37_108012_c1 3300050507 Unclassified 3423
641 nmdc:mga09592_44223_c1 3300050508 Bacteria 3748
642 nmdc:mga0qj67_91904_c1 3300050509 Unclassified 2439
643 nmdc:mga08y16_442388_c1 3300050511 Bacteria 1326
644 nmdc:mga08y16_699973_c1 3300050511 Unclassified 1013
645 nmdc:mga0rr50_23536_c1 3300050513 Bacteria 4249
646 nmdc:mga0rr50_352327_c1 3300050513 Bacteria 1238
647 nmdc:mga08x19_183422_c1 3300050514 Bacteria 1429
648 nmdc:mga08x19_425192_c1 3300050514 Bacteria 933
649 nmdc:mga08x19_820001_c1 3300050514 Unclassified 661
650 nmdc:mga0a205_190886_c1 3300050515 Bacteria 1941
651 Ga0495601_0319909 3300053077 Unclassified 1010
652 Ga0495601_0722353 3300053077 Unclassified 635
653 Ga0495619_0205078 3300053085 Unclassified 1365
654 Ga0495619_0815299 3300053085 Bacteria 631
655 Ga0501084_0007001 3300054114 Bacteria 9294
656 Ga0501084_0021260 3300054114 Bacteria 5409
657 Ga0501084_0095359 3300054114 Bacteria 2499
658 Ga0501084_0097368 3300054114 Unclassified 2470
659 Ga0501084_0135840 3300054114 Bacteria 2070
660 Ga0501084_1293879 3300054114 Bacteria 611
661 Ga0501082_0022751 3300060353 Bacteria 5397
662 Ga0501082_0049863 3300060353 Bacteria 3610
663 Ga0501082_0057760 3300060353 Bacteria 3342
664 Ga0501082_0059558 3300060353 Bacteria 3291
665 Ga0501082_0186764 3300060353 Bacteria 1803
666 Ga0501082_0231025 3300060353 Bacteria 1610
667 Ga0466962_0120628 3300061719 Unclassified 1265
668 Ga0530510_0027262 3300061734 Bacteria 4094
669 Ga0530510_0046803 3300061734 Bacteria 3125
670 Ga0530510_0077158 3300061734 Bacteria 2421
671 Ga0530510_0100809 3300061734 Bacteria 2111
672 Ga0530510_0232749 3300061734 Bacteria 1371
673 Ga0070702_100978423
674 JGI24739J22299_10063664
675 JGI24743J22301_10011216
676 JGI24748J21848_1011319
677 JGI24738J21930_10018906
678 JGI24738J21930_10055735
679 JGI24744J21845_10033527
680 JGI24742J22300_10017346
681 Ga0070658_10017624
682 Ga0070658_10089138
683 Ga0070658_10366574
684 Ga0070658_10453549
685 Ga0070683_100006377
686 Ga0070683_100009748
687 Ga0070683_100027977
688 Ga0070683_100070285
689 Ga0070683_100084967
690 Ga0070683_100134638
691 Ga0070683_100156163
692 Ga0070683_100757129
693 Ga0070670_101604508
694 Ga0068869_100866612
695 Ga0070680_100197381
696 Ga0070680_100274816
697 Ga0070680_100310078
698 Ga0070680_100529501
699 Ga0070682_100042025
700 Ga0070682_100389514
701 Ga0068868_100009175
702 Ga0068868_100174214
703 Ga0070660_100018736
704 Ga0070660_100196895
705 Ga0070660_100300752
706 Ga0070660_100340147
707 Ga0070660_100597584
708 Ga0070660_101385957
709 Ga0070689_101209705
710 Ga0070691_10081682
711 Ga0070691_10278848
712 Ga0070687_100154883
713 Ga0070661_100002967
714 Ga0070661_100092176
715 Ga0070661_100291254
716 Ga0070692_10030073
717 Ga0070692_10036613
718 Ga0070668_100268641
719 Ga0070668_100283889
720 Ga0070675_100008476
721 Ga0070675_100553742
722 Ga0070674_100005044
723 Ga0070674_100151978
724 Ga0070674_100310312
725 Ga0070674_100440693
726 Ga0070673_100033227
727 Ga0070688_100105557
728 Ga0070659_100056824
729 Ga0070659_100080535
730 Ga0070659_100217104
731 Ga0070659_100384948
732 Ga0070659_100438909
733 Ga0070659_100810013
734 Ga0070659_101514098
735 Ga0070667_100977734
736 Ga0070709_10334320
737 Ga0070714_100082091
738 Ga0070714_100556925
739 Ga0070714_100687734
740 Ga0070714_101693027
741 Ga0070713_101679022
742 Ga0070710_10077477
743 Ga0070710_10933167
744 Ga0070701_10004316
745 Ga0070711_100055631
746 Ga0070711_100080185
747 Ga0070711_100223998
748 Ga0070711_100961064
749 Ga0070700_100052575
750 Ga0070700_100768452
751 Ga0070694_100232163
752 Ga0070694_100249472
753 Ga0070694_100602235
754 Ga0070663_100023583
755 Ga0070663_101516411
756 Ga0070678_100001394
757 Ga0070678_100188627
758 Ga0070678_100605567
759 Ga0070678_101141213
760 Ga0070662_100009989
761 Ga0070662_100028635
762 Ga0070662_100414002
763 Ga0070681_10008529
764 Ga0070681_10022188
765 Ga0070681_10030309
766 Ga0070681_10071110
767 Ga0070681_10104479
768 Ga0070681_10436314
769 Ga0070681_10774781
770 Ga0068867_100030408
771 Ga0070685_10068662
772 Ga0070685_10361058
773 Ga0070679_100170449
774 Ga0070679_100593716
775 Ga0070679_100687930
776 Ga0070684_100006669
777 Ga0070684_100016721
778 Ga0070684_100075903
779 Ga0070684_100104954
780 Ga0070684_100194988
781 Ga0070684_100287297
782 Ga0068853_100007302
783 Ga0068853_100696195
784 Ga0068853_101552941
785 Ga0070672_100005086
786 Ga0070686_100458358
787 Ga0070686_101111320
788 Ga0070695_100000615
789 Ga0070695_100445569
790 Ga0070695_101242888
791 Ga0070696_100437851
792 Ga0070696_101409456
793 Ga0070704_100221334
794 Ga0070704_100275551
795 Ga0070704_100704290
796 Ga0068855_100019964
797 Ga0068855_100069405
798 Ga0068855_100284866
799 Ga0068855_100373695
800 Ga0068855_101027430
801 Ga0070664_100038931
802 Ga0070664_100055509
803 Ga0068857_100650568
804 Ga0068854_100002294
805 Ga0068854_100013117
806 Ga0068854_100180856
807 Ga0068854_100613799
808 Ga0068854_100843404
809 Ga0068854_101418617
810 Ga0068856_100082675
811 Ga0068856_100826512
812 Ga0068856_101253716
813 Ga0070702_100016395
814 Ga0070702_100101223
815 Ga0070702_100419222
816 Ga0070702_100596928
817 Ga0068852_100014693
818 Ga0068852_100092119
819 Ga0068852_100278653
820 Ga0068852_100533946
821 Ga0068866_10018541
822 Ga0068866_10676930
823 Ga0068861_100036085
824 Ga0068861_100053946
825 Ga0068851_10017864
826 Ga0068870_10228967
827 Ga0068870_10424390
828 Ga0068870_10645989
829 Ga0068860_100456469
830 Ga0081455_10024284
831 Ga0081455_10063071
832 Ga0081455_10107529
833 Ga0081455_10160557
834 Ga0081538_10067556
835 Ga0070717_10319773
836 Ga0070717_11745519
837 Ga0070715_10016370
838 Ga0070712_100106504
839 Ga0070712_100276325
840 Ga0070712_100355310
841 Ga0070712_100490518
842 Ga0070712_100503518
843 Ga0097621_100058844
844 Ga0097621_100254910
845 Ga0068871_100062922
846 Ga0075431_101514291
847 Ga0075433_10160428
848 Ga0075433_11408466
849 Ga0075434_100003675
850 Ga0075434_100138323
851 Ga0075429_100038302
852 Ga0068865_100004362
853 Ga0068865_100039892
854 Ga0075436_100057423
855 Ga0075436_100874959
856 Ga0075435_100035038
857 Ga0075435_100365579
858 Ga0075435_100417211
859 Ga0105240_10016267
860 Ga0105240_10631415
861 Ga0105240_10718590
862 Ga0105240_11183699
863 Ga0105240_11276411
864 Ga0111539_10053399
865 Ga0111539_11607644
866 Ga0111539_12064530
867 Ga0105245_10038853
868 Ga0105245_10139105
869 Ga0105245_10163804
870 Ga0105245_12894272
871 Ga0105243_10124962
872 Ga0105243_10300788
873 Ga0105243_10824892
874 Ga0105241_11256332
875 Ga0105242_10016923
876 Ga0105242_10608760
877 Ga0105242_11831163
878 Ga0105248_10067661
879 Ga0105248_11812553
880 Ga0105237_11309257
881 Ga0105238_10078587
882 Ga0105238_10225814
883 Ga0105238_10302215
884 Ga0105249_10267151
885 Ga0105249_10852117
886 Ga0105249_11449302
887 Ga0105239_10038227
888 Ga0105239_10292004
889 Ga0105239_10313400
890 Ga0105239_11066333
891 Ga0105246_10195756
892 Ga0105246_10462057
893 Ga0157328_1025928
894 Ga0157373_10055530
895 Ga0157373_10324182
896 Ga0157371_10009977
897 Ga0157371_10191791
898 Ga0157370_10002093
899 Ga0157370_10181250
900 Ga0157370_10439756
901 Ga0157370_10639098
902 Ga0157369_10020061
903 Ga0157369_10020330
904 Ga0157369_10026673
905 Ga0157369_10149376
906 Ga0157369_11829734
907 Ga0157374_10142680
908 Ga0157374_11310458
909 Ga0157378_12102071
910 Ga0157372_10054570
911 Ga0157372_10194535
912 Ga0157372_10688144
913 Ga0157372_10981227
914 Ga0157372_11737398
915 Ga0157375_10346248
916 Ga0157375_10479293
917 Ga0163163_10071430
918 Ga0163163_10293209
919 Ga0157377_10011937
920 Ga0157377_10086793
921 Ga0157379_11092076
922 Ga0157376_10505398
923 Ga0163161_10206824
924 Ga0197907_10753629
925 Ga0206356_10288350
926 Ga0206356_11138170
927 Ga0206354_10392977
928 Ga0206354_10706762
929 Ga0206354_11250015
930 Ga0206353_10708468
931 Ga0206353_11071379
932 Ga0224712_10021866
933 Ga0207692_10350093
934 Ga0207642_10023734
935 Ga0207688_10004375
936 Ga0207688_10047719
937 Ga0207688_10519834
938 Ga0207647_10182607
939 Ga0207643_10416236
940 Ga0207705_10041853
941 Ga0207705_10239967
942 Ga0207705_10891375
943 Ga0207707_10174243
944 Ga0207707_10310115
945 Ga0207707_10322531
946 Ga0207707_10392702
947 Ga0207695_10032302
948 Ga0207695_10134850
949 Ga0207695_10392392
950 Ga0207695_10507250
951 Ga0207693_10036828
952 Ga0207693_10051984
953 Ga0207693_10554593
954 Ga0207693_10640508
955 Ga0207663_10128778
956 Ga0207663_10436035
957 Ga0207663_10523889
958 Ga0207660_10102262
959 Ga0207660_10110350
960 Ga0207660_10174081
961 Ga0207660_10332837
962 Ga0207662_10080014
963 Ga0207657_10005818
964 Ga0207657_10009234
965 Ga0207657_10011669
966 Ga0207657_10020278
967 Ga0207657_10356587
968 Ga0207657_10368699
969 Ga0207657_11146554
970 Ga0207649_10011899
971 Ga0207649_10182134
972 Ga0207649_10372767
973 Ga0207652_10193056
974 Ga0207652_10487433
975 Ga0207694_10378768
976 Ga0207694_11326177
977 Ga0207659_10191601
978 Ga0207659_11441759
979 Ga0207687_10332050
980 Ga0207700_10918050
981 Ga0207664_10292538
982 Ga0207664_10403685
983 Ga0207664_10871981
984 Ga0207690_10165494
985 Ga0207690_10245548
986 Ga0207690_10314433
987 Ga0207690_11139552
988 Ga0207706_10009769
989 Ga0207706_10023628
990 Ga0207706_10108780
991 Ga0207686_10012742
992 Ga0207686_10264569
993 Ga0207686_10654163
994 Ga0207686_10862879
995 Ga0207709_10041847
996 Ga0207709_10805212
997 Ga0207670_11613256
998 Ga0207704_10098366
999 Ga0207704_10187185
1000 Ga0207691_10008877
1001 Ga0207711_10168250
1002 Ga0207689_10150994
1003 Ga0207661_10015392
1004 Ga0207661_10040866
1005 Ga0207661_10053139
1006 Ga0207661_10128400
1007 Ga0207661_10199393
1008 Ga0207661_10289987
1009 Ga0207661_10438206
1010 Ga0207661_10661207
1011 Ga0207661_10687534
1012 Ga0207679_10093445
1013 Ga0207679_10152951
1014 Ga0207667_10375352
1015 Ga0207667_10578333
1016 Ga0207667_11232404
1017 Ga0207667_11455923
1018 Ga0207651_10084033
1019 Ga0207712_11636661
1020 Ga0207712_11787162
1021 Ga0207668_10275588
1022 Ga0207668_10328180
1023 Ga0207640_10025917
1024 Ga0207640_11004281
1025 Ga0207640_11021632
1026 Ga0207640_11056276
1027 Ga0207677_10162624
1028 Ga0207677_10259373
1029 Ga0207703_11364420
1030 Ga0207639_10201050
1031 Ga0207639_10374925
1032 Ga0207678_10043579
1033 Ga0207678_11223976
1034 Ga0207708_10071672
1035 Ga0207702_10035057
1036 Ga0207648_10085316
1037 Ga0207674_10002821
1038 Ga0207675_100014290
1039 Ga0207675_100260631
1040 Ga0207683_10040890
1041 Ga0207683_10062780
1042 Ga0207698_10061556
1043 Ga0207698_10327710
1044 Ga0207698_10380670
1045 Ga0207698_10912210
1046 Ga0268265_12265805
1047 Ga0268264_10645199
1048 Ga0265327_10078428
1049 Ga0307408_100325971
1050 Ga0265313_10240111
1051 Ga0307405_10269747
1052 Ga0307405_10606719
1053 Ga0307405_10928292
1054 Ga0307405_11601449
1055 Ga0307413_10110761
1056 Ga0307410_10004565
1057 Ga0307410_10474077
1058 Ga0307406_10135191
1059 Ga0307406_10144243
1060 Ga0307406_10679520
1061 Ga0307407_10028268
1062 Ga0307407_10241234
1063 Ga0307409_100147658
1064 Ga0307409_100187042
1065 Ga0307416_100186778
1066 Ga0307416_100342200
1067 Ga0307416_100718632
1068 Ga0307416_100952750
1069 Ga0307416_100980059
1070 Ga0307416_101061307
1071 Ga0307416_101620179
1072 Ga0307414_11224335
1073 Ga0307411_10345040
1074 Ga0307411_10775537
1075 Ga0307415_100006229
1076 Ga0307415_100178222
1077 Ga0307415_101788145
1078 Ga0373958_0107407
1079 Ga0373960_0214849
1080 Ga0373955_0896075
1081 Ga0373937_0213227
1082 Ga0373937_0439995
1083 Ga0373937_0456438
1084 Ga0395899_0047124
1085 Ga0395900_0110019
1086 Ga0395900_0116762
1087 Ga0395900_0133038
1088 Ga0395900_0288281
1089 Ga0395898_0010024
1090 Ga0395898_0032119
1091 Ga0395898_0041231
1092 Ga0395898_0109432
1093 Ga0395898_0162389
1094 Ga0395898_0383942
1095 Ga0395898_0855523
1096 Ga0395898_0907257
1097 Ga0395905_0032431
1098 Ga0395905_0224750
1099 Ga0395905_0413950
1100 Ga0395905_0472586
1101 Ga0395905_0511181
1102 Ga0395905_0694054
1103 Ga0395901_0009351
1104 Ga0395901_0086071
1105 Ga0395901_0143649
1106 Ga0395901_0380905
1107 Ga0451800_0185866
1108 Ga0451802_2027163
1109 Ga0451855_1642264
1110 Ga0451853_1209984
1111 Ga0439448_0030497
1112 Ga0450906_071099
1113 Ga0466963_0003275
1114 Ga0466963_0010934
1115 Ga0466963_0019373
1116 Ga0466963_0334207
1117 Ga0453684_0530074
1118 Ga0453684_0966795
1119 Ga0466957_0033675
1120 Ga0466957_0241576
1121 Ga0451576_0075378
1122 Ga0466958_0005089
1123 Ga0466958_0841724
1124 Ga0466967_0015853
1125 Ga0466967_0041757
1126 Ga0466967_0070756
1127 Ga0466967_0143079
1128 Ga0466967_0216703
1129 Ga0466967_0229567
1130 Ga0466967_0234468
1131 Ga0466967_0461606
1132 Ga0466967_0498170
1133 Ga0466967_0740746
1134 Ga0466967_2129041
1135 Ga0495651_0037122
1136 Ga0495651_0152974
1137 Ga0495605_0393092
1138 Ga0495608_0404408
1139 Ga0495630_0567779
1140 Ga0495667_0268944
1141 Ga0495599_0374118
1142 Ga0495613_0245863
1143 Ga0495600_0108510
1144 Ga0495674_0469097
1145 Ga0495680_0044634
1146 Ga0495680_0110396
1147 Ga0495684_0178227
1148 Ga0495684_0899147
1149 Ga0495602_0084627
1150 Ga0495602_0214555
1151 Ga0496100_0117915
1152 Ga0496100_0126193
1153 Ga0496100_0214710
1154 Ga0496100_1443428
1155 Ga0496101_0020447
1156 Ga0496101_0081866
1157 Ga0496101_0213913
1158 Ga0496101_0258703
1159 Ga0496101_0891964
1160 Ga0496101_1203754
1161 Ga0496102_0002988
1162 Ga0496102_0033530
1163 Ga0496102_0095711
1164 Ga0496102_0111748
1165 Ga0496102_0318907
1166 Ga0496102_0891507
1167 Ga0496102_1969472
1168 Ga0496103_0013376
1169 Ga0496103_0018263
1170 Ga0496103_0057943
1171 Ga0496103_0528889
1172 Ga0496104_0051592
1173 Ga0496105_0044974
1174 Ga0496105_0064711
1175 Ga0496105_0076528
1176 Ga0496106_0002050
1177 Ga0496106_0049483
1178 Ga0496107_0033335
1179 Ga0496107_0066149
1180 Ga0496107_0127499
1181 Ga0496107_0266445
1182 Ga0496107_0744238
1183 Ga0496108_0001649
1184 Ga0496108_0146337
1185 Ga0496108_0973833
1186 Ga0496109_0001364
1187 Ga0496109_0013381
1188 Ga0496109_0033063
1189 Ga0496109_0388003
1190 Ga0496109_0401553
1191 Ga0496109_0403205
1192 Ga0496109_0757973
1193 Ga0496110_0025630
1194 Ga0496110_0177421
1195 Ga0496110_0354264
1196 Ga0496110_0499689
1197 Ga0496110_0501585
1198 Ga0496110_1904318
1199 Ga0496112_0098174
1200 Ga0496112_0159730
1201 Ga0496112_0244451
1202 Ga0496112_0339205
1203 Ga0496113_0220912
1204 Ga0496113_0393372
1205 Ga0496113_0769398
1206 Ga0496113_0804355
1207 Ga0496114_0040617
1208 Ga0496114_0074612
1209 Ga0496114_0074891
1210 Ga0496114_0209202
1211 Ga0496114_0405944
1212 Ga0496114_0551710
1213 Ga0496115_0006039
1214 Ga0496115_0064649
1215 Ga0496115_0095562
1216 Ga0501291_060934
1217 Ga0501031_0008602
1218 Ga0501031_0019483
1219 Ga0501031_0059993
1220 Ga0501032_0011933
1221 Ga0501033_0266149
1222 Ga0501034_0078081
1223 Ga0501034_0204587
1224 Ga0501036_0090402
1225 Ga0501036_0121928
1226 Ga0501037_0045540
1227 Ga0501037_0132301
1228 Ga0501037_0340599
1229 Ga0501038_0039034
1230 Ga0501038_0185518
1231 Ga0501039_0010595
1232 Ga0501039_0147864
1233 Ga0501040_0019106
1234 Ga0501040_0045029
1235 Ga0501040_0103605
1236 Ga0501040_0130669
1237 Ga0501040_0141684
1238 Ga0501041_0020035
1239 Ga0501041_0029413
1240 Ga0501041_0055745
1241 Ga0501041_0062808
1242 Ga0501042_0002816
1243 Ga0501042_0018437
1244 Ga0501042_0055653
1245 Ga0501043_0032947
1246 Ga0501043_0073590
1247 Ga0501043_0772601
1248 Ga0501046_0026444
1249 Ga0501046_0122137
1250 Ga0501046_0170897
1251 Ga0501048_0042462
1252 Ga0501048_0099833
1253 Ga0501068_0038074
1254 Ga0501068_1198826
1255 Ga0501069_0100759
1256 Ga0501069_0162274
1257 Ga0501070_0027634
1258 Ga0501070_0473689
1259 Ga0501071_0031950
1260 Ga0501071_0035488
1261 Ga0501071_0064761
1262 Ga0501071_0076443
1263 Ga0501071_0440509
1264 Ga0501072_0029550
1265 Ga0501072_0036148
1266 Ga0501072_0184292
1267 Ga0501072_0194610
1268 Ga0501072_0274197
1269 Ga0501073_0211729
1270 Ga0501074_0004376
1271 Ga0501074_0005872
1272 Ga0501074_0019203
1273 Ga0501075_0016453
1274 Ga0501075_0043909
1275 Ga0501075_0351712
1276 Ga0501076_0025152
1277 Ga0501076_0080332
1278 Ga0501076_0168544
1279 Ga0501076_0559032
1280 Ga0501076_0666645
1281 Ga0501077_0006947
1282 Ga0501077_0072553
1283 Ga0501077_0121839
1284 Ga0501077_0159034
1285 Ga0501077_0230537
1286 Ga0501079_0017261
1287 Ga0501079_0113337
1288 Ga0501079_0571755
1289 Ga0501080_0028201
1290 Ga0501080_0047812
1291 Ga0501080_0152754
1292 Ga0501080_0412759
1293 Ga0501081_0024187
1294 Ga0501081_0111123
1295 Ga0501081_0147705
1296 Ga0501081_0231212
1297 Ga0501081_0572659
1298 Ga0501083_0017675
1299 Ga0501083_0426564
1300 Ga0501083_0710182
1301 Ga0501283_088662
1302 Ga0501035_0024468
1303 Ga0501035_0051914
1304 Ga0501035_0132095
1305 Ga0501044_0100608
1306 Ga0501044_0120440
1307 Ga0501044_1191350
1308 Ga0501045_0013502
1309 Ga0501045_0020594
1310 Ga0501045_0189690
1311 Ga0501045_0345474
1312 nmdc:mga05p37_108012_c1
1313 nmdc:mga09592_44223_c1
1314 nmdc:mga0qj67_91904_c1
1315 nmdc:mga08y16_442388_c1
1316 nmdc:mga08y16_699973_c1
1317 nmdc:mga0rr50_23536_c1
1318 nmdc:mga0rr50_352327_c1
1319 nmdc:mga08x19_183422_c1
1320 nmdc:mga08x19_425192_c1
1321 nmdc:mga08x19_820001_c1
1322 nmdc:mga0a205_190886_c1
1323 Ga0495601_0319909
1324 Ga0495601_0722353
1325 Ga0495619_0205078
1326 Ga0495619_0815299
1327 Ga0501084_0007001
1328 Ga0501084_0021260
1329 Ga0501084_0095359
1330 Ga0501084_0097368
1331 Ga0501084_0135840
1332 Ga0501084_1293879
1333 Ga0501082_0022751
1334 Ga0501082_0049863
1335 Ga0501082_0057760
1336 Ga0501082_0059558
1337 Ga0501082_0186764
1338 Ga0501082_0231025
1339 Ga0466962_0120628
1340 Ga0530510_0027262
1341 Ga0530510_0046803
1342 Ga0530510_0077158
1343 Ga0530510_0100809
1344 Ga0530510_0232749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1v-assembly1.cif.gz_A dtxr-like iron-dependent regulator ider complexed with cobalt 0.908 68 121
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.906 68 115
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8968 68 113
3edp-assembly1.cif.gz_B the crystal structure of the protein lin2111 (functionally unknown) from listeria innocua clip11262 0.8734 68 113
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8334 55 114
ID Description Score Start End Superfamily
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.906 68 115 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8968 68 113 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8967 67 113 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8749 56 113 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8746 58 122 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7M2YUW7-F1-model_v4 Transcriptional regulator 0.9738 41 155 GO:0003677
GO:0003700
GO:0006950
AF-A0A2V8FMG1-F1-model_v4 MarR family transcriptional regulator 0.9618 23 158 GO:0003700
GO:0006950
AF-A0A6J4T4P2-F1-model_v4 HTH marR-type domain-containing protein 0.9552 14 156 GO:0003700
GO:0006950
AF-A0A7W8KE73-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9547 36 155 GO:0003677
GO:0003700
GO:0006950
AF-A0A6J4I1Q1-F1-model_v4 HTH marR-type domain-containing protein 0.9458 22 154 GO:0003700
GO:0005737
GO:0006950

Map