F474089

General Info

Members Datasets Scaffolds Average Seq Length
670 288 1340 128

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10348047|Ga0207659_103480471
Length 151
Sequence VRQAIATDQAPKAIGPYSQAITAGSLLYCSGQIPLDPATGALVQGDLAAQTRRVLDNVGAILAAAGTSFDRVVKTTVFLADMNDFAAMNEVYATYFTSPAPARSTVAAAGLPKGARIEIEGFGELHQQGRRKWPLIALHQIEIAWRDCQHF

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
271 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
272 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.76
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 15.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10348047 3300025926 Bacteria 1229
2 MRS1b_contig_551986 2162886011 Bacteria 1745
3 LJQas_1000046 3300000549 Bacteria 19569
4 JGI24751J29686_10039302 3300002459 Bacteria 979
5 JGI24751J29686_10083194 3300002459 Unclassified 664
6 JGI25406J46586_10017975 3300003203 Bacteria 2912
7 JGI25406J46586_10101567 3300003203 Bacteria 857
8 Ga0065712_10000329 3300005290 Bacteria 17463
9 Ga0065712_10004655 3300005290 Bacteria 6705
10 Ga0065715_10001890 3300005293 Bacteria 7149
11 Ga0065715_10126324 3300005293 Bacteria 2111
12 Ga0065715_10181738 3300005293 Bacteria 1472
13 Ga0065707_10166691 3300005295 Bacteria 1517
14 Ga0065707_10383896 3300005295 Bacteria 873
15 Ga0070676_10007361 3300005328 Bacteria 5906
16 Ga0070676_10103048 3300005328 Bacteria 1766
17 Ga0070676_10595593 3300005328 Bacteria 797
18 Ga0070683_101354420 3300005329 Bacteria 684
19 Ga0070690_100307618 3300005330 Bacteria 1138
20 Ga0070690_100773823 3300005330 Bacteria 743
21 Ga0070670_100000040 3300005331 Bacteria 149939
22 Ga0070670_100000177 3300005331 Bacteria 57701
23 Ga0070670_100002961 3300005331 Bacteria 14061
24 Ga0070670_100008026 3300005331 Bacteria 8980
25 Ga0070670_100075366 3300005331 Bacteria 2899
26 Ga0068869_100710809 3300005334 Bacteria 858
27 Ga0068869_101943091 3300005334 Bacteria 527
28 Ga0070680_101371364 3300005336 Bacteria 612
29 Ga0070682_101666982 3300005337 Bacteria 553
30 Ga0068868_100179457 3300005338 Bacteria 1756
31 Ga0068868_100433762 3300005338 Bacteria 1140
32 Ga0070689_100056898 3300005340 Bacteria 3034
33 Ga0070689_100231183 3300005340 Bacteria 1520
34 Ga0070689_100808792 3300005340 Bacteria 825
35 Ga0070691_10003956 3300005341 Bacteria 6703
36 Ga0070691_10724514 3300005341 Bacteria 599
37 Ga0070687_100492089 3300005343 Bacteria 824
38 Ga0070687_100760963 3300005343 Bacteria 682
39 Ga0070692_10276731 3300005345 Bacteria 1015
40 Ga0070692_10462046 3300005345 Unclassified 815
41 Ga0070668_100015638 3300005347 Bacteria 5673
42 Ga0070669_100051607 3300005353 Bacteria 3007
43 Ga0070669_100211602 3300005353 Bacteria 1530
44 Ga0070669_100385179 3300005353 Unclassified 1144
45 Ga0070675_100049947 3300005354 Bacteria 3434
46 Ga0070675_100085282 3300005354 Bacteria 2638
47 Ga0070675_100486313 3300005354 Bacteria 1111
48 Ga0070675_100554867 3300005354 Bacteria 1039
49 Ga0070671_100033098 3300005355 Bacteria 4274
50 Ga0070671_100224742 3300005355 Bacteria 1593
51 Ga0070671_100809206 3300005355 Bacteria 816
52 Ga0070674_100002662 3300005356 Bacteria 9894
53 Ga0070674_100005767 3300005356 Bacteria 7185
54 Ga0070674_100075290 3300005356 Bacteria 2397
55 Ga0070673_100163106 3300005364 Bacteria 1897
56 Ga0070673_100168830 3300005364 Bacteria 1866
57 Ga0070673_100425051 3300005364 Unclassified 1192
58 Ga0070673_100609210 3300005364 Bacteria 997
59 Ga0070688_100008752 3300005365 Bacteria 5505
60 Ga0070688_100010798 3300005365 Bacteria 5048
61 Ga0070688_100459181 3300005365 Bacteria 954
62 Ga0070659_100088747 3300005366 Bacteria 2476
63 Ga0070667_100316736 3300005367 Bacteria 1407
64 Ga0070667_100398187 3300005367 Bacteria 1253
65 Ga0070703_10048321 3300005406 Bacteria 1351
66 Ga0070709_10248779 3300005434 Bacteria 1280
67 Ga0070701_10022642 3300005438 Bacteria 3014
68 Ga0070701_10151103 3300005438 Bacteria 1337
69 Ga0070705_100006397 3300005440 Bacteria 5774
70 Ga0070705_100029428 3300005440 Bacteria 3021
71 Ga0070705_100458119 3300005440 Bacteria 958
72 Ga0070700_100009994 3300005441 Bacteria 5223
73 Ga0070700_100011679 3300005441 Bacteria 4872
74 Ga0070700_100026025 3300005441 Bacteria 3450
75 Ga0070700_100436678 3300005441 Unclassified 993
76 Ga0070700_100665313 3300005441 Bacteria 824
77 Ga0070694_100058835 3300005444 Bacteria 2616
78 Ga0070694_100786013 3300005444 Bacteria 779
79 Ga0070708_100005220 3300005445 Bacteria 10287
80 Ga0070708_100015034 3300005445 Archaea 6384
81 Ga0070708_100184211 3300005445 Archaea 1952
82 Ga0070708_101067551 3300005445 Bacteria 757
83 Ga0070678_100096650 3300005456 Bacteria 2279
84 Ga0070678_100187374 3300005456 Bacteria 1698
85 Ga0070662_100714127 3300005457 Bacteria 848
86 Ga0070681_10364398 3300005458 Unclassified 1355
87 Ga0068867_100017807 3300005459 Bacteria 5045
88 Ga0068867_100145891 3300005459 Bacteria 1855
89 Ga0068867_100178754 3300005459 Bacteria 1686
90 Ga0068867_100460233 3300005459 Unclassified 1086
91 Ga0068867_100677151 3300005459 Bacteria 908
92 Ga0068867_101016165 3300005459 Bacteria 753
93 Ga0070685_10011459 3300005466 Bacteria 4640
94 Ga0070685_10024892 3300005466 Bacteria 3292
95 Ga0070685_10045911 3300005466 Bacteria 2507
96 Ga0070706_100000223 3300005467 Bacteria 69475
97 Ga0070706_100021405 3300005467 Bacteria 5956
98 Ga0070706_100061416 3300005467 Bacteria 3470
99 Ga0070706_100338406 3300005467 Bacteria 1403
100 Ga0070707_100000030 3300005468 Unclassified 122924
101 Ga0070707_100083777 3300005468 Archaea 3081
102 Ga0070707_100244169 3300005468 Bacteria 1747
103 Ga0070707_100367042 3300005468 Bacteria 1398
104 Ga0070707_100413735 3300005468 Unclassified 1309
105 Ga0070698_100004458 3300005471 Bacteria 15388
106 Ga0074259_10176926 3300005507 Bacteria 855
107 Ga0070699_100372459 3300005518 Bacteria 1288
108 Ga0070699_100650597 3300005518 Bacteria 962
109 Ga0070699_101443933 3300005518 Bacteria 631
110 Ga0070684_100171712 3300005535 Bacteria 1969
111 Ga0070684_100176135 3300005535 Bacteria 1944
112 Ga0070684_100633334 3300005535 Unclassified 995
113 Ga0070684_100804320 3300005535 Bacteria 879
114 Ga0070697_100130966 3300005536 Archaea 2103
115 Ga0070697_100131712 3300005536 Bacteria 2098
116 Ga0070697_101336689 3300005536 Bacteria 639
117 Ga0068853_100176180 3300005539 Bacteria 1937
118 Ga0068853_101394995 3300005539 Bacteria 677
119 Ga0070672_100004106 3300005543 Bacteria 9506
120 Ga0070672_100551720 3300005543 Bacteria 1001
121 Ga0070672_100671494 3300005543 Bacteria 906
122 Ga0070672_101368958 3300005543 Bacteria 633
123 Ga0070686_100008839 3300005544 Bacteria 5645
124 Ga0070686_100100640 3300005544 Bacteria 1952
125 Ga0070686_100167064 3300005544 Bacteria 1553
126 Ga0070695_100009270 3300005545 Bacteria 5851
127 Ga0070695_100157247 3300005545 Bacteria 1592
128 Ga0070696_100004210 3300005546 Bacteria 9582
129 Ga0070696_100269509 3300005546 Bacteria 1294
130 Ga0070665_100011544 3300005548 Bacteria 8928
131 Ga0070665_100518880 3300005548 Bacteria 1203
132 Ga0070704_100006282 3300005549 Bacteria 6993
133 Ga0070704_100545869 3300005549 Bacteria 1012
134 Ga0070704_100923341 3300005549 Bacteria 786
135 Ga0068855_100930783 3300005563 Bacteria 917
136 Ga0068855_101356614 3300005563 Bacteria 734
137 Ga0070664_100465160 3300005564 Bacteria 1162
138 Ga0068854_100005336 3300005578 Bacteria 8112
139 Ga0068854_100024287 3300005578 Unclassified 4148
140 Ga0068854_100326574 3300005578 Bacteria 1249
141 Ga0068854_100612274 3300005578 Unclassified 931
142 Ga0068854_100751779 3300005578 Unclassified 846
143 Ga0068856_100053873 3300005614 Bacteria 3967
144 Ga0068856_100997029 3300005614 Bacteria 856
145 Ga0070702_100008040 3300005615 Bacteria 5089
146 Ga0070702_100134791 3300005615 Bacteria 1565
147 Ga0068852_100841993 3300005616 Bacteria 933
148 Ga0068852_102779818 3300005616 Bacteria 508
149 Ga0068859_100075274 3300005617 Bacteria 3416
150 Ga0068859_100231920 3300005617 Bacteria 1934
151 Ga0068859_100423725 3300005617 Bacteria 1427
152 Ga0068859_102414827 3300005617 Bacteria 579
153 Ga0068864_100057981 3300005618 Bacteria 3346
154 Ga0068864_100160576 3300005618 Bacteria 2043
155 Ga0068866_10039141 3300005718 Bacteria 2340
156 Ga0068866_10111378 3300005718 Bacteria 1528
157 Ga0068866_10132054 3300005718 Bacteria 1422
158 Ga0068866_10179224 3300005718 Bacteria 1250
159 Ga0068866_10205655 3300005718 Bacteria 1179
160 Ga0068861_100306023 3300005719 Bacteria 1379
161 Ga0068861_101245452 3300005719 Unclassified 721
162 Ga0068851_10993439 3300005834 Bacteria 529
163 Ga0068870_10000685 3300005840 Bacteria 12965
164 Ga0068870_10166252 3300005840 Bacteria 1313
165 Ga0068870_10203436 3300005840 Bacteria 1202
166 Ga0068863_100043250 3300005841 Bacteria 4277
167 Ga0068863_100048593 3300005841 Bacteria 4023
168 Ga0068858_100548654 3300005842 Bacteria 1119
169 Ga0068858_100604918 3300005842 Bacteria 1063
170 Ga0068860_100151563 3300005843 Unclassified 2233
171 Ga0068860_100847786 3300005843 Bacteria 928
172 Ga0068860_100950722 3300005843 Unclassified 876
173 Ga0068860_101168907 3300005843 Bacteria 789
174 Ga0068862_100244414 3300005844 Bacteria 1633
175 Ga0068862_100874656 3300005844 Bacteria 882
176 Ga0068862_101138925 3300005844 Unclassified 777
177 Ga0081538_10052075 3300005981 Bacteria 2450
178 Ga0081539_10000041 3300005985 Bacteria 292660
179 Ga0081539_10010708 3300005985 Bacteria 7393
180 Ga0070717_11659735 3300006028 Bacteria 579
181 Ga0070716_100064759 3300006173 Bacteria 2126
182 Ga0070716_100151662 3300006173 Bacteria 1491
183 Ga0070716_101140262 3300006173 Bacteria 624
184 Ga0070712_100522929 3300006175 Bacteria 997
185 Ga0097621_100007602 3300006237 Bacteria 7766
186 Ga0097621_100214551 3300006237 Bacteria 1675
187 Ga0097621_100240940 3300006237 Unclassified 1581
188 Ga0068871_100051751 3300006358 Bacteria 3325
189 Ga0068871_100095394 3300006358 Bacteria 2484
190 Ga0068871_101652148 3300006358 Unclassified 607
191 Ga0068871_101768044 3300006358 Bacteria 587
192 Ga0075428_100107143 3300006844 Bacteria 3046
193 Ga0075430_100687286 3300006846 Bacteria 843
194 Ga0075431_100092902 3300006847 Bacteria 3114
195 Ga0075434_100060885 3300006871 Bacteria 3755
196 Ga0068865_100399369 3300006881 Bacteria 1126
197 Ga0068865_100665003 3300006881 Bacteria 887
198 Ga0068865_100943391 3300006881 Bacteria 753
199 Ga0075436_100030397 3300006914 Bacteria 3718
200 Ga0075436_100179751 3300006914 Bacteria 1495
201 Ga0075436_100797866 3300006914 Bacteria 703
202 Ga0097620_100075280 3300006931 Bacteria 3416
203 Ga0097620_100231937 3300006931 Bacteria 1934
204 Ga0097620_100423749 3300006931 Bacteria 1427
205 Ga0097620_102415603 3300006931 Bacteria 579
206 Ga0075435_100033994 3300007076 Bacteria 4036
207 Ga0075435_100832320 3300007076 Bacteria 804
208 Ga0075435_101292226 3300007076 Bacteria 639
209 Ga0099794_10003801 3300007265 Archaea 5828
210 Ga0099794_10045626 3300007265 Archaea 2097
211 Ga0099794_10071376 3300007265 Archaea 1701
212 Ga0099794_10548685 3300007265 Unclassified 610
213 Ga0105240_10662715 3300009093 Bacteria 1142
214 Ga0105240_11205569 3300009093 Unclassified 801
215 Ga0105240_11662143 3300009093 Bacteria 667
216 Ga0111539_10024118 3300009094 Bacteria 7470
217 Ga0111539_10071959 3300009094 Bacteria 4079
218 Ga0111539_10275055 3300009094 Bacteria 1960
219 Ga0105245_10049106 3300009098 Bacteria 3777
220 Ga0105245_10085806 3300009098 Bacteria 2886
221 Ga0105245_10107876 3300009098 Bacteria 2585
222 Ga0105245_10156900 3300009098 Unclassified 2156
223 Ga0105245_10369223 3300009098 Bacteria 1426
224 Ga0105245_12283323 3300009098 Bacteria 595
225 Ga0105247_10062295 3300009101 Bacteria 2314
226 Ga0105247_10065435 3300009101 Bacteria 2261
227 Ga0105247_10354561 3300009101 Bacteria 1033
228 Ga0105247_10548011 3300009101 Unclassified 850
229 Ga0114129_10032907 3300009147 Bacteria 7326
230 Ga0114129_10662521 3300009147 Bacteria 1346
231 Ga0114129_12040153 3300009147 Bacteria 693
232 Ga0114129_13401282 3300009147 Unclassified 512
233 Ga0105243_10048809 3300009148 Bacteria 3338
234 Ga0105243_10133199 3300009148 Bacteria 2111
235 Ga0105243_10482566 3300009148 Bacteria 1170
236 Ga0105243_10986333 3300009148 Bacteria 844
237 Ga0105241_10037969 3300009174 Bacteria 3631
238 Ga0105241_10729206 3300009174 Bacteria 907
239 Ga0105241_11187614 3300009174 Bacteria 722
240 Ga0105242_10078817 3300009176 Bacteria 2750
241 Ga0105242_10087129 3300009176 Bacteria 2622
242 Ga0105248_10023640 3300009177 Bacteria 6828
243 Ga0105248_10125076 3300009177 Bacteria 2901
244 Ga0105248_10203480 3300009177 Bacteria 2231
245 Ga0105248_10721139 3300009177 Bacteria 1125
246 Ga0105237_10294931 3300009545 Bacteria 1624
247 Ga0105237_10313901 3300009545 Bacteria 1571
248 Ga0105237_10557922 3300009545 Bacteria 1152
249 Ga0105238_10420704 3300009551 Unclassified 1331
250 Ga0105249_11195378 3300009553 Bacteria 831
251 Ga0105249_11457354 3300009553 Bacteria 757
252 Ga0105239_10066883 3300010375 Bacteria 3947
253 Ga0105239_10105613 3300010375 Bacteria 3119
254 Ga0105239_10149616 3300010375 Bacteria 2605
255 Ga0105239_11223802 3300010375 Unclassified 865
256 Ga0105239_12765785 3300010375 Unclassified 573
257 Ga0105246_10012343 3300011119 Bacteria 5328
258 Ga0105246_10014513 3300011119 Bacteria 4955
259 Ga0105246_10235892 3300011119 Bacteria 1443
260 Ga0105246_10241382 3300011119 Bacteria 1428
261 Ga0105246_10470315 3300011119 Bacteria 1061
262 Ga0105246_11064072 3300011119 Bacteria 736
263 Ga0105246_12195017 3300011119 Bacteria 537
264 Ga0157325_1011236 3300012485 Unclassified 671
265 Ga0157373_10582196 3300013100 Unclassified 814
266 Ga0157374_10000021 3300013296 Bacteria 272840
267 Ga0157374_10564085 3300013296 Bacteria 1147
268 Ga0157378_10680324 3300013297 Bacteria 1047
269 Ga0157378_11122521 3300013297 Bacteria 824
270 Ga0163162_10046559 3300013306 Bacteria 4347
271 Ga0163162_10260284 3300013306 Bacteria 1867
272 Ga0163162_11219563 3300013306 Unclassified 854
273 Ga0157372_10039849 3300013307 Bacteria 5187
274 Ga0157372_11154790 3300013307 Unclassified 895
275 Ga0157375_10007205 3300013308 Bacteria 9724
276 Ga0157375_10243171 3300013308 Bacteria 1959
277 Ga0157375_10531628 3300013308 Bacteria 1338
278 Ga0157375_10623568 3300013308 Bacteria 1236
279 Ga0163163_10000275 3300014325 Bacteria 51570
280 Ga0163163_10034702 3300014325 Bacteria 4888
281 Ga0163163_10034994 3300014325 Bacteria 4869
282 Ga0163163_10159998 3300014325 Bacteria 2297
283 Ga0163163_10201557 3300014325 Bacteria 2038
284 Ga0163163_10503686 3300014325 Unclassified 1273
285 Ga0163163_10691785 3300014325 Unclassified 1083
286 Ga0157380_10015409 3300014326 Bacteria 5619
287 Ga0157380_10500316 3300014326 Bacteria 1180
288 Ga0157380_10879268 3300014326 Bacteria 920
289 Ga0157377_10000023 3300014745 Bacteria 146600
290 Ga0157377_10038673 3300014745 Bacteria 2635
291 Ga0157379_10083735 3300014968 Bacteria 2859
292 Ga0157379_10382350 3300014968 Bacteria 1292
293 Ga0157379_10390799 3300014968 Bacteria 1277
294 Ga0157379_10457255 3300014968 Bacteria 1179
295 Ga0157379_10634312 3300014968 Unclassified 999
296 Ga0157376_10000006 3300014969 Bacteria 368549
297 Ga0157376_10227683 3300014969 Unclassified 1730
298 Ga0157376_10404916 3300014969 Unclassified 1320
299 Ga0157376_10426217 3300014969 Bacteria 1288
300 Ga0157376_10900718 3300014969 Bacteria 903
301 Ga0157376_11139343 3300014969 Bacteria 807
302 Ga0163161_10003469 3300017792 Bacteria 11049
303 Ga0163161_10655606 3300017792 Bacteria 870
304 Ga0206350_10676508 3300020080 Unclassified 574
305 Ga0213872_10131334 3300021361 Unclassified 1103
306 Ga0213872_10212946 3300021361 Unclassified 825
307 Ga0213872_10432780 3300021361 Unclassified 530
308 Ga0213871_10119803 3300021441 Bacteria 784
309 Ga0207666_1013868 3300025271 Bacteria 1134
310 Ga0207697_10163975 3300025315 Unclassified 970
311 Ga0207656_10524668 3300025321 Bacteria 602
312 Ga0207653_10030087 3300025885 Bacteria 1751
313 Ga0207682_10086507 3300025893 Bacteria 1352
314 Ga0207642_10325624 3300025899 Bacteria 899
315 Ga0207642_10529486 3300025899 Unclassified 725
316 Ga0207642_10558153 3300025899 Bacteria 708
317 Ga0207710_10002045 3300025900 Bacteria 9583
318 Ga0207710_10029486 3300025900 Bacteria 2388
319 Ga0207688_10018235 3300025901 Bacteria 3821
320 Ga0207688_10037933 3300025901 Bacteria 2674
321 Ga0207688_10477918 3300025901 Bacteria 779
322 Ga0207680_10333288 3300025903 Bacteria 1063
323 Ga0207647_10190651 3300025904 Unclassified 1188
324 Ga0207699_10413225 3300025906 Bacteria 963
325 Ga0207645_10005026 3300025907 Bacteria 9690
326 Ga0207645_10065785 3300025907 Bacteria 2317
327 Ga0207645_10135881 3300025907 Bacteria 1601
328 Ga0207643_10111670 3300025908 Bacteria 1611
329 Ga0207684_10000312 3300025910 Bacteria 68977
330 Ga0207684_10080379 3300025910 Bacteria 2773
331 Ga0207684_10133471 3300025910 Unclassified 2131
332 Ga0207684_10352001 3300025910 Bacteria 1268
333 Ga0207654_10518770 3300025911 Bacteria 843
334 Ga0207671_10146994 3300025914 Unclassified 1819
335 Ga0207671_10430405 3300025914 Bacteria 1050
336 Ga0207693_10028023 3300025915 Bacteria 4452
337 Ga0207662_10263518 3300025918 Bacteria 1135
338 Ga0207662_10486974 3300025918 Bacteria 848
339 Ga0207652_10128962 3300025921 Bacteria 2255
340 Ga0207646_10019484 3300025922 Archaea 6305
341 Ga0207646_10034164 3300025922 Bacteria 4596
342 Ga0207646_10078224 3300025922 Archaea 2956
343 Ga0207646_10079498 3300025922 Unclassified 2932
344 Ga0207646_10574687 3300025922 Bacteria 1012
345 Ga0207681_10011395 3300025923 Bacteria 5464
346 Ga0207681_10209415 3300025923 Unclassified 1502
347 Ga0207681_10388212 3300025923 Bacteria 1125
348 Ga0207681_10742380 3300025923 Bacteria 818
349 Ga0207681_11350182 3300025923 Unclassified 598
350 Ga0207681_11622475 3300025923 Bacteria 541
351 Ga0207694_10497689 3300025924 Bacteria 1020
352 Ga0207694_10549947 3300025924 Unclassified 969
353 Ga0207650_10000067 3300025925 Bacteria 140196
354 Ga0207650_10000103 3300025925 Bacteria 111316
355 Ga0207650_10006716 3300025925 Bacteria 7845
356 Ga0207650_10015003 3300025925 Bacteria 5389
357 Ga0207650_10120620 3300025925 Unclassified 2041
358 Ga0207650_10503493 3300025925 Bacteria 1012
359 Ga0207659_10068554 3300025926 Bacteria 2580
360 Ga0207659_10083627 3300025926 Bacteria 2366
361 Ga0207659_10390551 3300025926 Bacteria 1162
362 Ga0207659_11526563 3300025926 Bacteria 571
363 Ga0207687_10128182 3300025927 Bacteria 1908
364 Ga0207687_10143218 3300025927 Bacteria 1816
365 Ga0207687_11499587 3300025927 Bacteria 579
366 Ga0207644_10323117 3300025931 Bacteria 1248
367 Ga0207644_10355837 3300025931 Bacteria 1190
368 Ga0207690_10148341 3300025932 Bacteria 1736
369 Ga0207706_10479861 3300025933 Bacteria 1074
370 Ga0207706_10722503 3300025933 Bacteria 850
371 Ga0207686_10108384 3300025934 Bacteria 1868
372 Ga0207686_10237658 3300025934 Bacteria 1324
373 Ga0207686_10271122 3300025934 Unclassified 1248
374 Ga0207709_10019408 3300025935 Bacteria 3822
375 Ga0207709_10191138 3300025935 Bacteria 1454
376 Ga0207709_10979494 3300025935 Bacteria 690
377 Ga0207670_10047558 3300025936 Bacteria 2858
378 Ga0207670_10199170 3300025936 Bacteria 1520
379 Ga0207669_10030208 3300025937 Bacteria 3008
380 Ga0207669_10069304 3300025937 Bacteria 2206
381 Ga0207669_10261068 3300025937 Bacteria 1295
382 Ga0207669_11013689 3300025937 Unclassified 698
383 Ga0207704_10011319 3300025938 Bacteria 4387
384 Ga0207704_10034219 3300025938 Bacteria 2897
385 Ga0207704_10072914 3300025938 Bacteria 2185
386 Ga0207704_10233189 3300025938 Bacteria 1370
387 Ga0207704_10330907 3300025938 Bacteria 1179
388 Ga0207665_10021847 3300025939 Bacteria 4208
389 Ga0207665_10041424 3300025939 Bacteria 3075
390 Ga0207691_10007479 3300025940 Bacteria 10518
391 Ga0207691_10125850 3300025940 Bacteria 2268
392 Ga0207711_10327928 3300025941 Bacteria 1415
393 Ga0207711_10526478 3300025941 Bacteria 1102
394 Ga0207711_11173436 3300025941 Bacteria 709
395 Ga0207689_10999873 3300025942 Bacteria 705
396 Ga0207661_10109710 3300025944 Bacteria 2331
397 Ga0207679_10188165 3300025945 Bacteria 1714
398 Ga0207651_10043046 3300025960 Bacteria 3011
399 Ga0207651_10194795 3300025960 Unclassified 1619
400 Ga0207651_10314678 3300025960 Bacteria 1307
401 Ga0207651_10384322 3300025960 Bacteria 1190
402 Ga0207651_10584314 3300025960 Bacteria 975
403 Ga0207712_10073452 3300025961 Bacteria 2467
404 Ga0207712_11961938 3300025961 Bacteria 524
405 Ga0207668_10244302 3300025972 Unclassified 1454
406 Ga0207668_10267487 3300025972 Bacteria 1396
407 Ga0207640_10007968 3300025981 Bacteria 5851
408 Ga0207640_10019319 3300025981 Unclassified 4023
409 Ga0207640_10350171 3300025981 Bacteria 1186
410 Ga0207677_10000133 3300026023 Bacteria 61065
411 Ga0207703_10083922 3300026035 Bacteria 2663
412 Ga0207703_10917590 3300026035 Bacteria 839
413 Ga0207678_10201190 3300026067 Bacteria 1703
414 Ga0207678_10898447 3300026067 Bacteria 783
415 Ga0207708_10006686 3300026075 Bacteria 8528
416 Ga0207708_10007652 3300026075 Bacteria 7994
417 Ga0207708_10013419 3300026075 Bacteria 6124
418 Ga0207702_10039109 3300026078 Bacteria 3973
419 Ga0207702_10357580 3300026078 Bacteria 1399
420 Ga0207641_10934651 3300026088 Bacteria 862
421 Ga0207648_10051776 3300026089 Bacteria 3589
422 Ga0207648_10092720 3300026089 Bacteria 2641
423 Ga0207648_10331115 3300026089 Bacteria 1370
424 Ga0207648_11377492 3300026089 Bacteria 663
425 Ga0207676_10109275 3300026095 Bacteria 2310
426 Ga0207676_10179075 3300026095 Bacteria 1855
427 Ga0207674_10215514 3300026116 Bacteria 1868
428 Ga0207674_10794427 3300026116 Unclassified 913
429 Ga0207674_11843915 3300026116 Bacteria 571
430 Ga0207675_100072115 3300026118 Bacteria 3230
431 Ga0207675_101046825 3300026118 Bacteria 835
432 Ga0207683_10006229 3300026121 Bacteria 10227
433 Ga0207683_10020589 3300026121 Bacteria 5645
434 Ga0207683_10059685 3300026121 Bacteria 3350
435 Ga0207698_10734104 3300026142 Bacteria 985
436 Ga0207698_11832572 3300026142 Bacteria 622
437 Ga0209588_1000238 3300027671 Archaea 14657
438 Ga0209588_1047006 3300027671 Archaea 1396
439 Ga0207428_10009852 3300027907 Bacteria 8558
440 Ga0268266_10402154 3300028379 Bacteria 1295
441 Ga0268266_10456364 3300028379 Bacteria 1215
442 Ga0268265_10144917 3300028380 Bacteria 1994
443 Ga0268265_10554095 3300028380 Bacteria 1092
444 Ga0268264_10403726 3300028381 Bacteria 1314
445 Ga0268264_10416415 3300028381 Bacteria 1295
446 Ga0268264_10804358 3300028381 Unclassified 939
447 Ga0268264_12282400 3300028381 Bacteria 548
448 Ga0265338_10115093 3300028800 Bacteria 2157
449 Ga0307413_10035146 3300031824 Bacteria 2872
450 Ga0307410_10858678 3300031852 Bacteria 775
451 Ga0307410_10906010 3300031852 Bacteria 756
452 Ga0307406_10117138 3300031901 Bacteria 1845
453 Ga0307406_10554176 3300031901 Unclassified 941
454 Ga0307407_10624064 3300031903 Bacteria 805
455 Ga0307407_10948285 3300031903 Unclassified 662
456 Ga0307412_10024972 3300031911 Bacteria 3695
457 Ga0307412_10767293 3300031911 Bacteria 834
458 Ga0307409_100177819 3300031995 Bacteria 1880
459 Ga0307416_100097459 3300032002 Bacteria 2546
460 Ga0307414_11274225 3300032004 Bacteria 681
461 Ga0307411_10066794 3300032005 Bacteria 2417
462 Ga0307415_100039511 3300032126 Bacteria 3119
463 Ga0307415_100474814 3300032126 Unclassified 1087
464 Ga0373944_0069616 3300035089 Bacteria 1144
465 Ga0373944_0428100 3300035089 Unclassified 513
466 Ga0373942_0017351 3300035207 Bacteria 1774
467 Ga0373935_0099233 3300035692 Unclassified 1917
468 Ga0373927_0957599 3300035695 Unclassified 565
469 Ga0373937_0370826 3300036401 Unclassified 1357
470 Ga0395899_0191732 3300037312 Bacteria 1430
471 Ga0395900_0011556 3300037418 Bacteria 9034
472 Ga0395898_0093106 3300037466 Bacteria 2897
473 Ga0395905_0994154 3300037471 Bacteria 742
474 Ga0436364_1249034 3300037853 Unclassified 1018
475 Ga0395901_0025777 3300038443 Bacteria 6036
476 Ga0395901_0113940 3300038443 Bacteria 2840
477 Ga0395901_1401387 3300038443 Bacteria 657
478 Ga0242422_01099 3300038699 Unclassified 1843
479 Ga0436360_0253035 3300039438 Bacteria 3451
480 Ga0436360_1260888 3300039438 Bacteria 4219
481 Ga0436360_1270538 3300039438 Bacteria 1554
482 Ga0436361_0317298 3300039447 Bacteria 929
483 Ga0436361_0550221 3300039447 Bacteria 4543
484 Ga0436361_0649317 3300039447 Unclassified 2275
485 Ga0436361_0810969 3300039447 Bacteria 2124
486 Ga0436361_0892360 3300039447 Bacteria 4928
487 Ga0436361_0938542 3300039447 Bacteria 2663
488 Ga0436362_0442172 3300039453 Unclassified 1097
489 Ga0436362_0993857 3300039453 Bacteria 2356
490 Ga0451853_1239964 3300041512 Bacteria 913
491 Ga0439448_0117958 3300042005 Unclassified 910
492 Ga0451576_0076316 3300045051 Unclassified 3488
493 Ga0451576_0185677 3300045051 Bacteria 2171
494 Ga0495653_0522741 3300046463 Bacteria 737
495 Ga0495584_0315418 3300046491 Unclassified 794
496 Ga0495594_0666203 3300046499 Unclassified 589
497 Ga0495608_0216353 3300046511 Unclassified 1203
498 Ga0495665_0143798 3300046531 Bacteria 1246
499 Ga0495635_0574628 3300046663 Unclassified 737
500 Ga0495646_0635665 3300046680 Unclassified 540
501 Ga0495647_0188540 3300046681 Unclassified 900
502 Ga0495658_0212891 3300046683 Unclassified 1208
503 Ga0495613_0867479 3300046689 Unclassified 586
504 Ga0495600_0262385 3300046809 Bacteria 1097
505 Ga0495674_0187942 3300047319 Unclassified 1718
506 Ga0495680_0313824 3300047322 Unclassified 1098
507 Ga0496100_0608762 3300048903 Bacteria 849
508 Ga0496100_1091623 3300048903 Bacteria 629
509 Ga0496101_0042375 3300048904 Unclassified 3249
510 Ga0496101_0498539 3300048904 Bacteria 962
511 Ga0496102_0196665 3300048905 Bacteria 1900
512 Ga0496102_0329723 3300048905 Bacteria 1438
513 Ga0496102_0358305 3300048905 Bacteria 1373
514 Ga0496103_0213205 3300048906 Bacteria 1242
515 Ga0496104_0002907 3300048907 Bacteria 14760
516 Ga0496104_0017375 3300048907 Bacteria 6549
517 Ga0496104_0384309 3300048907 Unclassified 1316
518 Ga0496105_0120171 3300048908 Bacteria 2167
519 Ga0496105_0219377 3300048908 Unclassified 1548
520 Ga0496105_0256244 3300048908 Bacteria 1416
521 Ga0496106_0039270 3300048909 Bacteria 3545
522 Ga0496106_0349194 3300048909 Bacteria 1188
523 Ga0496106_0694468 3300048909 Unclassified 811
524 Ga0496107_0142941 3300048910 Bacteria 1769
525 Ga0496107_0164442 3300048910 Bacteria 1645
526 Ga0496107_0876585 3300048910 Bacteria 655
527 Ga0496108_0010864 3300048911 Bacteria 7392
528 Ga0496108_0017366 3300048911 Bacteria 5887
529 Ga0496108_0059111 3300048911 Bacteria 3224
530 Ga0496108_0148234 3300048911 Bacteria 2024
531 Ga0496108_1154686 3300048911 Bacteria 656
532 Ga0496109_0004820 3300048912 Bacteria 11261
533 Ga0496109_0166418 3300048912 Bacteria 2067
534 Ga0496109_0563265 3300048912 Unclassified 1075
535 Ga0496109_1032605 3300048912 Unclassified 759
536 Ga0496109_1231207 3300048912 Unclassified 685
537 Ga0496109_1688467 3300048912 Bacteria 567
538 Ga0496109_2042789 3300048912 Bacteria 505
539 Ga0496110_0031719 3300048913 Bacteria 4561
540 Ga0496110_0210157 3300048913 Bacteria 1769
541 Ga0496111_0238681 3300048914 Bacteria 1350
542 Ga0496111_0247296 3300048914 Bacteria 1324
543 Ga0496111_0459633 3300048914 Bacteria 939
544 Ga0496112_0006980 3300048915 Bacteria 9969
545 Ga0496112_0064157 3300048915 Bacteria 3624
546 Ga0496112_0073850 3300048915 Bacteria 3371
547 Ga0496112_0578529 3300048915 Bacteria 1056
548 Ga0496112_0823680 3300048915 Unclassified 852
549 Ga0496113_0016065 3300048916 Bacteria 5165
550 Ga0496113_0181019 3300048916 Bacteria 1671
551 Ga0496113_0388694 3300048916 Bacteria 1120
552 Ga0496113_0643922 3300048916 Unclassified 848
553 Ga0496114_0006946 3300048917 Bacteria 8917
554 Ga0496114_0027544 3300048917 Bacteria 4656
555 Ga0496114_0045450 3300048917 Bacteria 3648
556 Ga0496114_0247522 3300048917 Bacteria 1568
557 Ga0496115_0009463 3300048918 Bacteria 7238
558 Ga0496115_0399072 3300048918 Bacteria 1116
559 Ga0501299_003046 3300049522 Bacteria 2391
560 Ga0501318_040946 3300049534 Unclassified 662
561 Ga0501032_0002549 3300049569 Bacteria 14258
562 Ga0501032_0432062 3300049569 Bacteria 844
563 Ga0501034_0000096 3300049571 Bacteria 161155
564 Ga0501034_0005171 3300049571 Bacteria 14311
565 Ga0501036_0003288 3300049572 Bacteria 12889
566 Ga0501036_0017391 3300049572 Bacteria 6011
567 Ga0501037_0294212 3300049573 Bacteria 1129
568 Ga0501038_0002622 3300049574 Bacteria 16807
569 Ga0501038_0049975 3300049574 Bacteria 3613
570 Ga0501038_0427269 3300049574 Bacteria 1021
571 Ga0501039_0003272 3300049575 Bacteria 12110
572 Ga0501040_0001492 3300049576 Bacteria 14846
573 Ga0501040_0056405 3300049576 Bacteria 2696
574 Ga0501041_0004752 3300049577 Bacteria 7883
575 Ga0501041_0015708 3300049577 Bacteria 4496
576 Ga0501041_0452402 3300049577 Bacteria 815
577 Ga0501042_0000116 3300049578 Bacteria 33871
578 Ga0501042_0018587 3300049578 Bacteria 4814
579 Ga0501042_1197302 3300049578 Bacteria 554
580 Ga0501043_0014740 3300049579 Bacteria 6120
581 Ga0501043_0046599 3300049579 Bacteria 3409
582 Ga0501046_0001229 3300049580 Bacteria 24836
583 Ga0501046_0003365 3300049580 Bacteria 14690
584 Ga0501046_0036243 3300049580 Bacteria 3971
585 Ga0501047_0000008 3300049581 Bacteria 441758
586 Ga0501048_0001070 3300049582 Bacteria 20523
587 Ga0501048_0001118 3300049582 Bacteria 20134
588 Ga0501048_0071263 3300049582 Bacteria 2453
589 Ga0501067_0009814 3300049583 Bacteria 5299
590 Ga0501067_0022554 3300049583 Bacteria 3484
591 Ga0501067_0181840 3300049583 Unclassified 1171
592 Ga0501068_0047850 3300049584 Bacteria 2580
593 Ga0501068_1150993 3300049584 Bacteria 513
594 Ga0501069_0002263 3300049585 Bacteria 9718
595 Ga0501070_0002869 3300049586 Bacteria 15012
596 Ga0501070_0011220 3300049586 Bacteria 7565
597 Ga0501071_0002369 3300049587 Bacteria 11409
598 Ga0501071_0030557 3300049587 Bacteria 3811
599 Ga0501071_0214844 3300049587 Bacteria 1447
600 Ga0501072_0000153 3300049588 Bacteria 51166
601 Ga0501072_0003182 3300049588 Bacteria 12348
602 Ga0501072_0307862 3300049588 Bacteria 1259
603 Ga0501073_0007388 3300049589 Bacteria 8169
604 Ga0501073_0022856 3300049589 Bacteria 4497
605 Ga0501074_0001110 3300049590 Bacteria 17548
606 Ga0501074_0002631 3300049590 Bacteria 12571
607 Ga0501074_0023368 3300049590 Bacteria 4495
608 Ga0501075_0001696 3300049591 Bacteria 14485
609 Ga0501076_0008270 3300049592 Bacteria 7622
610 Ga0501076_0047792 3300049592 Bacteria 3383
611 Ga0501077_0000711 3300049593 Bacteria 20088
612 Ga0501077_0037687 3300049593 Bacteria 3078
613 Ga0501077_0154574 3300049593 Bacteria 1456
614 Ga0501224_055617 3300049664 Unclassified 612
615 Ga0501235_036898 3300049669 Bacteria 1112
616 Ga0501221_038899 3300049704 Unclassified 1029
617 Ga0501225_0181055 3300049705 Unclassified 659
618 Ga0501234_005810 3300049707 Viruses 1928
619 Ga0501079_0000084 3300049741 Bacteria 44872
620 Ga0501079_0000221 3300049741 Bacteria 33871
621 Ga0501079_0043637 3300049741 Bacteria 3461
622 Ga0501079_0278575 3300049741 Bacteria 1308
623 Ga0501079_0539601 3300049741 Bacteria 917
624 Ga0501080_0002637 3300049742 Bacteria 15700
625 Ga0501080_0024552 3300049742 Bacteria 5588
626 Ga0501081_0000284 3300049743 Bacteria 26831
627 Ga0501081_0017319 3300049743 Bacteria 4767
628 Ga0501083_0006749 3300049744 Bacteria 8145
629 Ga0501083_0041386 3300049744 Bacteria 3125
630 Ga0501083_0058600 3300049744 Bacteria 2576
631 Ga0501083_0300263 3300049744 Bacteria 1044
632 Ga0501268_055212 3300049765 Unclassified 777
633 Ga0501270_014917 3300049767 Unclassified 1102
634 Ga0501283_013278 3300049779 Bacteria 1246
635 Ga0501035_0032783 3300049822 Bacteria 4724
636 Ga0501035_1002459 3300049822 Bacteria 657
637 Ga0501044_0045490 3300049823 Bacteria 4546
638 Ga0501045_0000729 3300049824 Bacteria 20961
639 Ga0501045_0028445 3300049824 Bacteria 4032
640 Ga0501045_0600822 3300049824 Unclassified 815
641 nmdc:mga05p37_1036991_c1 3300050507 Unclassified 867
642 nmdc:mga05p37_2275938_c1 3300050507 Unclassified 500
643 nmdc:mga05p37_323935_c1 3300050507 Unclassified 1823
644 nmdc:mga05p37_75706_c1 3300050507 Bacteria 4143
645 nmdc:mga05p37_78549_c1 3300050507 Bacteria 4064
646 nmdc:mga09592_1216049_c1 3300050508 Bacteria 622
647 nmdc:mga09592_62030_c1 3300050508 Bacteria 3162
648 nmdc:mga0qj67_302611_c1 3300050509 Bacteria 1295
649 nmdc:mga06r32_691657_c1 3300050510 Bacteria 986
650 nmdc:mga08y16_19023_c1 3300050511 Bacteria 7234
651 nmdc:mga08y16_472940_c1 3300050511 Unclassified 1276
652 nmdc:mga0rr50_1060058_c1 3300050513 Bacteria 690
653 nmdc:mga0rr50_74809_c1 3300050513 Bacteria 2594
654 nmdc:mga08x19_32336_c1 3300050514 Bacteria 3295
655 nmdc:mga08x19_356378_c1 3300050514 Bacteria 1022
656 nmdc:mga08x19_746418_c1 3300050514 Bacteria 695
657 nmdc:mga08x19_93386_c1 3300050514 Unclassified 1988
658 nmdc:mga0a205_16021_c1 3300050515 Bacteria 7016
659 Ga0495601_0151470 3300053077 Bacteria 1514
660 Ga0495612_0325431 3300053078 Unclassified 692
661 Ga0501084_0000135 3300054114 Bacteria 56033
662 Ga0501084_0003048 3300054114 Bacteria 13579
663 Ga0501084_0068893 3300054114 Bacteria 2961
664 Ga0501082_0001674 3300060353 Bacteria 19551
665 Ga0501082_0003297 3300060353 Bacteria 14087
666 Ga0501082_0039818 3300060353 Bacteria 4054
667 Ga0530510_0002740 3300061734 Bacteria 12110
668 Ga0530510_0036572 3300061734 Bacteria 3538
669 Ga0530510_0308797 3300061734 Bacteria 1184
670 Ga0530510_0947455 3300061734 Bacteria 658
671 Ga0207659_10348047
672 MRS1b_contig_551986
673 LJQas_1000046
674 JGI24751J29686_10039302
675 JGI24751J29686_10083194
676 JGI25406J46586_10017975
677 JGI25406J46586_10101567
678 Ga0065712_10000329
679 Ga0065712_10004655
680 Ga0065715_10001890
681 Ga0065715_10126324
682 Ga0065715_10181738
683 Ga0065707_10166691
684 Ga0065707_10383896
685 Ga0070676_10007361
686 Ga0070676_10103048
687 Ga0070676_10595593
688 Ga0070683_101354420
689 Ga0070690_100307618
690 Ga0070690_100773823
691 Ga0070670_100000040
692 Ga0070670_100000177
693 Ga0070670_100002961
694 Ga0070670_100008026
695 Ga0070670_100075366
696 Ga0068869_100710809
697 Ga0068869_101943091
698 Ga0070680_101371364
699 Ga0070682_101666982
700 Ga0068868_100179457
701 Ga0068868_100433762
702 Ga0070689_100056898
703 Ga0070689_100231183
704 Ga0070689_100808792
705 Ga0070691_10003956
706 Ga0070691_10724514
707 Ga0070687_100492089
708 Ga0070687_100760963
709 Ga0070692_10276731
710 Ga0070692_10462046
711 Ga0070668_100015638
712 Ga0070669_100051607
713 Ga0070669_100211602
714 Ga0070669_100385179
715 Ga0070675_100049947
716 Ga0070675_100085282
717 Ga0070675_100486313
718 Ga0070675_100554867
719 Ga0070671_100033098
720 Ga0070671_100224742
721 Ga0070671_100809206
722 Ga0070674_100002662
723 Ga0070674_100005767
724 Ga0070674_100075290
725 Ga0070673_100163106
726 Ga0070673_100168830
727 Ga0070673_100425051
728 Ga0070673_100609210
729 Ga0070688_100008752
730 Ga0070688_100010798
731 Ga0070688_100459181
732 Ga0070659_100088747
733 Ga0070667_100316736
734 Ga0070667_100398187
735 Ga0070703_10048321
736 Ga0070709_10248779
737 Ga0070701_10022642
738 Ga0070701_10151103
739 Ga0070705_100006397
740 Ga0070705_100029428
741 Ga0070705_100458119
742 Ga0070700_100009994
743 Ga0070700_100011679
744 Ga0070700_100026025
745 Ga0070700_100436678
746 Ga0070700_100665313
747 Ga0070694_100058835
748 Ga0070694_100786013
749 Ga0070708_100005220
750 Ga0070708_100015034
751 Ga0070708_100184211
752 Ga0070708_101067551
753 Ga0070678_100096650
754 Ga0070678_100187374
755 Ga0070662_100714127
756 Ga0070681_10364398
757 Ga0068867_100017807
758 Ga0068867_100145891
759 Ga0068867_100178754
760 Ga0068867_100460233
761 Ga0068867_100677151
762 Ga0068867_101016165
763 Ga0070685_10011459
764 Ga0070685_10024892
765 Ga0070685_10045911
766 Ga0070706_100000223
767 Ga0070706_100021405
768 Ga0070706_100061416
769 Ga0070706_100338406
770 Ga0070707_100000030
771 Ga0070707_100083777
772 Ga0070707_100244169
773 Ga0070707_100367042
774 Ga0070707_100413735
775 Ga0070698_100004458
776 Ga0074259_10176926
777 Ga0070699_100372459
778 Ga0070699_100650597
779 Ga0070699_101443933
780 Ga0070684_100171712
781 Ga0070684_100176135
782 Ga0070684_100633334
783 Ga0070684_100804320
784 Ga0070697_100130966
785 Ga0070697_100131712
786 Ga0070697_101336689
787 Ga0068853_100176180
788 Ga0068853_101394995
789 Ga0070672_100004106
790 Ga0070672_100551720
791 Ga0070672_100671494
792 Ga0070672_101368958
793 Ga0070686_100008839
794 Ga0070686_100100640
795 Ga0070686_100167064
796 Ga0070695_100009270
797 Ga0070695_100157247
798 Ga0070696_100004210
799 Ga0070696_100269509
800 Ga0070665_100011544
801 Ga0070665_100518880
802 Ga0070704_100006282
803 Ga0070704_100545869
804 Ga0070704_100923341
805 Ga0068855_100930783
806 Ga0068855_101356614
807 Ga0070664_100465160
808 Ga0068854_100005336
809 Ga0068854_100024287
810 Ga0068854_100326574
811 Ga0068854_100612274
812 Ga0068854_100751779
813 Ga0068856_100053873
814 Ga0068856_100997029
815 Ga0070702_100008040
816 Ga0070702_100134791
817 Ga0068852_100841993
818 Ga0068852_102779818
819 Ga0068859_100075274
820 Ga0068859_100231920
821 Ga0068859_100423725
822 Ga0068859_102414827
823 Ga0068864_100057981
824 Ga0068864_100160576
825 Ga0068866_10039141
826 Ga0068866_10111378
827 Ga0068866_10132054
828 Ga0068866_10179224
829 Ga0068866_10205655
830 Ga0068861_100306023
831 Ga0068861_101245452
832 Ga0068851_10993439
833 Ga0068870_10000685
834 Ga0068870_10166252
835 Ga0068870_10203436
836 Ga0068863_100043250
837 Ga0068863_100048593
838 Ga0068858_100548654
839 Ga0068858_100604918
840 Ga0068860_100151563
841 Ga0068860_100847786
842 Ga0068860_100950722
843 Ga0068860_101168907
844 Ga0068862_100244414
845 Ga0068862_100874656
846 Ga0068862_101138925
847 Ga0081538_10052075
848 Ga0081539_10000041
849 Ga0081539_10010708
850 Ga0070717_11659735
851 Ga0070716_100064759
852 Ga0070716_100151662
853 Ga0070716_101140262
854 Ga0070712_100522929
855 Ga0097621_100007602
856 Ga0097621_100214551
857 Ga0097621_100240940
858 Ga0068871_100051751
859 Ga0068871_100095394
860 Ga0068871_101652148
861 Ga0068871_101768044
862 Ga0075428_100107143
863 Ga0075430_100687286
864 Ga0075431_100092902
865 Ga0075434_100060885
866 Ga0068865_100399369
867 Ga0068865_100665003
868 Ga0068865_100943391
869 Ga0075436_100030397
870 Ga0075436_100179751
871 Ga0075436_100797866
872 Ga0097620_100075280
873 Ga0097620_100231937
874 Ga0097620_100423749
875 Ga0097620_102415603
876 Ga0075435_100033994
877 Ga0075435_100832320
878 Ga0075435_101292226
879 Ga0099794_10003801
880 Ga0099794_10045626
881 Ga0099794_10071376
882 Ga0099794_10548685
883 Ga0105240_10662715
884 Ga0105240_11205569
885 Ga0105240_11662143
886 Ga0111539_10024118
887 Ga0111539_10071959
888 Ga0111539_10275055
889 Ga0105245_10049106
890 Ga0105245_10085806
891 Ga0105245_10107876
892 Ga0105245_10156900
893 Ga0105245_10369223
894 Ga0105245_12283323
895 Ga0105247_10062295
896 Ga0105247_10065435
897 Ga0105247_10354561
898 Ga0105247_10548011
899 Ga0114129_10032907
900 Ga0114129_10662521
901 Ga0114129_12040153
902 Ga0114129_13401282
903 Ga0105243_10048809
904 Ga0105243_10133199
905 Ga0105243_10482566
906 Ga0105243_10986333
907 Ga0105241_10037969
908 Ga0105241_10729206
909 Ga0105241_11187614
910 Ga0105242_10078817
911 Ga0105242_10087129
912 Ga0105248_10023640
913 Ga0105248_10125076
914 Ga0105248_10203480
915 Ga0105248_10721139
916 Ga0105237_10294931
917 Ga0105237_10313901
918 Ga0105237_10557922
919 Ga0105238_10420704
920 Ga0105249_11195378
921 Ga0105249_11457354
922 Ga0105239_10066883
923 Ga0105239_10105613
924 Ga0105239_10149616
925 Ga0105239_11223802
926 Ga0105239_12765785
927 Ga0105246_10012343
928 Ga0105246_10014513
929 Ga0105246_10235892
930 Ga0105246_10241382
931 Ga0105246_10470315
932 Ga0105246_11064072
933 Ga0105246_12195017
934 Ga0157325_1011236
935 Ga0157373_10582196
936 Ga0157374_10000021
937 Ga0157374_10564085
938 Ga0157378_10680324
939 Ga0157378_11122521
940 Ga0163162_10046559
941 Ga0163162_10260284
942 Ga0163162_11219563
943 Ga0157372_10039849
944 Ga0157372_11154790
945 Ga0157375_10007205
946 Ga0157375_10243171
947 Ga0157375_10531628
948 Ga0157375_10623568
949 Ga0163163_10000275
950 Ga0163163_10034702
951 Ga0163163_10034994
952 Ga0163163_10159998
953 Ga0163163_10201557
954 Ga0163163_10503686
955 Ga0163163_10691785
956 Ga0157380_10015409
957 Ga0157380_10500316
958 Ga0157380_10879268
959 Ga0157377_10000023
960 Ga0157377_10038673
961 Ga0157379_10083735
962 Ga0157379_10382350
963 Ga0157379_10390799
964 Ga0157379_10457255
965 Ga0157379_10634312
966 Ga0157376_10000006
967 Ga0157376_10227683
968 Ga0157376_10404916
969 Ga0157376_10426217
970 Ga0157376_10900718
971 Ga0157376_11139343
972 Ga0163161_10003469
973 Ga0163161_10655606
974 Ga0206350_10676508
975 Ga0213872_10131334
976 Ga0213872_10212946
977 Ga0213872_10432780
978 Ga0213871_10119803
979 Ga0207666_1013868
980 Ga0207697_10163975
981 Ga0207656_10524668
982 Ga0207653_10030087
983 Ga0207682_10086507
984 Ga0207642_10325624
985 Ga0207642_10529486
986 Ga0207642_10558153
987 Ga0207710_10002045
988 Ga0207710_10029486
989 Ga0207688_10018235
990 Ga0207688_10037933
991 Ga0207688_10477918
992 Ga0207680_10333288
993 Ga0207647_10190651
994 Ga0207699_10413225
995 Ga0207645_10005026
996 Ga0207645_10065785
997 Ga0207645_10135881
998 Ga0207643_10111670
999 Ga0207684_10000312
1000 Ga0207684_10080379
1001 Ga0207684_10133471
1002 Ga0207684_10352001
1003 Ga0207654_10518770
1004 Ga0207671_10146994
1005 Ga0207671_10430405
1006 Ga0207693_10028023
1007 Ga0207662_10263518
1008 Ga0207662_10486974
1009 Ga0207652_10128962
1010 Ga0207646_10019484
1011 Ga0207646_10034164
1012 Ga0207646_10078224
1013 Ga0207646_10079498
1014 Ga0207646_10574687
1015 Ga0207681_10011395
1016 Ga0207681_10209415
1017 Ga0207681_10388212
1018 Ga0207681_10742380
1019 Ga0207681_11350182
1020 Ga0207681_11622475
1021 Ga0207694_10497689
1022 Ga0207694_10549947
1023 Ga0207650_10000067
1024 Ga0207650_10000103
1025 Ga0207650_10006716
1026 Ga0207650_10015003
1027 Ga0207650_10120620
1028 Ga0207650_10503493
1029 Ga0207659_10068554
1030 Ga0207659_10083627
1031 Ga0207659_10390551
1032 Ga0207659_11526563
1033 Ga0207687_10128182
1034 Ga0207687_10143218
1035 Ga0207687_11499587
1036 Ga0207644_10323117
1037 Ga0207644_10355837
1038 Ga0207690_10148341
1039 Ga0207706_10479861
1040 Ga0207706_10722503
1041 Ga0207686_10108384
1042 Ga0207686_10237658
1043 Ga0207686_10271122
1044 Ga0207709_10019408
1045 Ga0207709_10191138
1046 Ga0207709_10979494
1047 Ga0207670_10047558
1048 Ga0207670_10199170
1049 Ga0207669_10030208
1050 Ga0207669_10069304
1051 Ga0207669_10261068
1052 Ga0207669_11013689
1053 Ga0207704_10011319
1054 Ga0207704_10034219
1055 Ga0207704_10072914
1056 Ga0207704_10233189
1057 Ga0207704_10330907
1058 Ga0207665_10021847
1059 Ga0207665_10041424
1060 Ga0207691_10007479
1061 Ga0207691_10125850
1062 Ga0207711_10327928
1063 Ga0207711_10526478
1064 Ga0207711_11173436
1065 Ga0207689_10999873
1066 Ga0207661_10109710
1067 Ga0207679_10188165
1068 Ga0207651_10043046
1069 Ga0207651_10194795
1070 Ga0207651_10314678
1071 Ga0207651_10384322
1072 Ga0207651_10584314
1073 Ga0207712_10073452
1074 Ga0207712_11961938
1075 Ga0207668_10244302
1076 Ga0207668_10267487
1077 Ga0207640_10007968
1078 Ga0207640_10019319
1079 Ga0207640_10350171
1080 Ga0207677_10000133
1081 Ga0207703_10083922
1082 Ga0207703_10917590
1083 Ga0207678_10201190
1084 Ga0207678_10898447
1085 Ga0207708_10006686
1086 Ga0207708_10007652
1087 Ga0207708_10013419
1088 Ga0207702_10039109
1089 Ga0207702_10357580
1090 Ga0207641_10934651
1091 Ga0207648_10051776
1092 Ga0207648_10092720
1093 Ga0207648_10331115
1094 Ga0207648_11377492
1095 Ga0207676_10109275
1096 Ga0207676_10179075
1097 Ga0207674_10215514
1098 Ga0207674_10794427
1099 Ga0207674_11843915
1100 Ga0207675_100072115
1101 Ga0207675_101046825
1102 Ga0207683_10006229
1103 Ga0207683_10020589
1104 Ga0207683_10059685
1105 Ga0207698_10734104
1106 Ga0207698_11832572
1107 Ga0209588_1000238
1108 Ga0209588_1047006
1109 Ga0207428_10009852
1110 Ga0268266_10402154
1111 Ga0268266_10456364
1112 Ga0268265_10144917
1113 Ga0268265_10554095
1114 Ga0268264_10403726
1115 Ga0268264_10416415
1116 Ga0268264_10804358
1117 Ga0268264_12282400
1118 Ga0265338_10115093
1119 Ga0307413_10035146
1120 Ga0307410_10858678
1121 Ga0307410_10906010
1122 Ga0307406_10117138
1123 Ga0307406_10554176
1124 Ga0307407_10624064
1125 Ga0307407_10948285
1126 Ga0307412_10024972
1127 Ga0307412_10767293
1128 Ga0307409_100177819
1129 Ga0307416_100097459
1130 Ga0307414_11274225
1131 Ga0307411_10066794
1132 Ga0307415_100039511
1133 Ga0307415_100474814
1134 Ga0373944_0069616
1135 Ga0373944_0428100
1136 Ga0373942_0017351
1137 Ga0373935_0099233
1138 Ga0373927_0957599
1139 Ga0373937_0370826
1140 Ga0395899_0191732
1141 Ga0395900_0011556
1142 Ga0395898_0093106
1143 Ga0395905_0994154
1144 Ga0436364_1249034
1145 Ga0395901_0025777
1146 Ga0395901_0113940
1147 Ga0395901_1401387
1148 Ga0242422_01099
1149 Ga0436360_0253035
1150 Ga0436360_1260888
1151 Ga0436360_1270538
1152 Ga0436361_0317298
1153 Ga0436361_0550221
1154 Ga0436361_0649317
1155 Ga0436361_0810969
1156 Ga0436361_0892360
1157 Ga0436361_0938542
1158 Ga0436362_0442172
1159 Ga0436362_0993857
1160 Ga0451853_1239964
1161 Ga0439448_0117958
1162 Ga0451576_0076316
1163 Ga0451576_0185677
1164 Ga0495653_0522741
1165 Ga0495584_0315418
1166 Ga0495594_0666203
1167 Ga0495608_0216353
1168 Ga0495665_0143798
1169 Ga0495635_0574628
1170 Ga0495646_0635665
1171 Ga0495647_0188540
1172 Ga0495658_0212891
1173 Ga0495613_0867479
1174 Ga0495600_0262385
1175 Ga0495674_0187942
1176 Ga0495680_0313824
1177 Ga0496100_0608762
1178 Ga0496100_1091623
1179 Ga0496101_0042375
1180 Ga0496101_0498539
1181 Ga0496102_0196665
1182 Ga0496102_0329723
1183 Ga0496102_0358305
1184 Ga0496103_0213205
1185 Ga0496104_0002907
1186 Ga0496104_0017375
1187 Ga0496104_0384309
1188 Ga0496105_0120171
1189 Ga0496105_0219377
1190 Ga0496105_0256244
1191 Ga0496106_0039270
1192 Ga0496106_0349194
1193 Ga0496106_0694468
1194 Ga0496107_0142941
1195 Ga0496107_0164442
1196 Ga0496107_0876585
1197 Ga0496108_0010864
1198 Ga0496108_0017366
1199 Ga0496108_0059111
1200 Ga0496108_0148234
1201 Ga0496108_1154686
1202 Ga0496109_0004820
1203 Ga0496109_0166418
1204 Ga0496109_0563265
1205 Ga0496109_1032605
1206 Ga0496109_1231207
1207 Ga0496109_1688467
1208 Ga0496109_2042789
1209 Ga0496110_0031719
1210 Ga0496110_0210157
1211 Ga0496111_0238681
1212 Ga0496111_0247296
1213 Ga0496111_0459633
1214 Ga0496112_0006980
1215 Ga0496112_0064157
1216 Ga0496112_0073850
1217 Ga0496112_0578529
1218 Ga0496112_0823680
1219 Ga0496113_0016065
1220 Ga0496113_0181019
1221 Ga0496113_0388694
1222 Ga0496113_0643922
1223 Ga0496114_0006946
1224 Ga0496114_0027544
1225 Ga0496114_0045450
1226 Ga0496114_0247522
1227 Ga0496115_0009463
1228 Ga0496115_0399072
1229 Ga0501299_003046
1230 Ga0501318_040946
1231 Ga0501032_0002549
1232 Ga0501032_0432062
1233 Ga0501034_0000096
1234 Ga0501034_0005171
1235 Ga0501036_0003288
1236 Ga0501036_0017391
1237 Ga0501037_0294212
1238 Ga0501038_0002622
1239 Ga0501038_0049975
1240 Ga0501038_0427269
1241 Ga0501039_0003272
1242 Ga0501040_0001492
1243 Ga0501040_0056405
1244 Ga0501041_0004752
1245 Ga0501041_0015708
1246 Ga0501041_0452402
1247 Ga0501042_0000116
1248 Ga0501042_0018587
1249 Ga0501042_1197302
1250 Ga0501043_0014740
1251 Ga0501043_0046599
1252 Ga0501046_0001229
1253 Ga0501046_0003365
1254 Ga0501046_0036243
1255 Ga0501047_0000008
1256 Ga0501048_0001070
1257 Ga0501048_0001118
1258 Ga0501048_0071263
1259 Ga0501067_0009814
1260 Ga0501067_0022554
1261 Ga0501067_0181840
1262 Ga0501068_0047850
1263 Ga0501068_1150993
1264 Ga0501069_0002263
1265 Ga0501070_0002869
1266 Ga0501070_0011220
1267 Ga0501071_0002369
1268 Ga0501071_0030557
1269 Ga0501071_0214844
1270 Ga0501072_0000153
1271 Ga0501072_0003182
1272 Ga0501072_0307862
1273 Ga0501073_0007388
1274 Ga0501073_0022856
1275 Ga0501074_0001110
1276 Ga0501074_0002631
1277 Ga0501074_0023368
1278 Ga0501075_0001696
1279 Ga0501076_0008270
1280 Ga0501076_0047792
1281 Ga0501077_0000711
1282 Ga0501077_0037687
1283 Ga0501077_0154574
1284 Ga0501224_055617
1285 Ga0501235_036898
1286 Ga0501221_038899
1287 Ga0501225_0181055
1288 Ga0501234_005810
1289 Ga0501079_0000084
1290 Ga0501079_0000221
1291 Ga0501079_0043637
1292 Ga0501079_0278575
1293 Ga0501079_0539601
1294 Ga0501080_0002637
1295 Ga0501080_0024552
1296 Ga0501081_0000284
1297 Ga0501081_0017319
1298 Ga0501083_0006749
1299 Ga0501083_0041386
1300 Ga0501083_0058600
1301 Ga0501083_0300263
1302 Ga0501268_055212
1303 Ga0501270_014917
1304 Ga0501283_013278
1305 Ga0501035_0032783
1306 Ga0501035_1002459
1307 Ga0501044_0045490
1308 Ga0501045_0000729
1309 Ga0501045_0028445
1310 Ga0501045_0600822
1311 nmdc:mga05p37_1036991_c1
1312 nmdc:mga05p37_2275938_c1
1313 nmdc:mga05p37_323935_c1
1314 nmdc:mga05p37_75706_c1
1315 nmdc:mga05p37_78549_c1
1316 nmdc:mga09592_1216049_c1
1317 nmdc:mga09592_62030_c1
1318 nmdc:mga0qj67_302611_c1
1319 nmdc:mga06r32_691657_c1
1320 nmdc:mga08y16_19023_c1
1321 nmdc:mga08y16_472940_c1
1322 nmdc:mga0rr50_1060058_c1
1323 nmdc:mga0rr50_74809_c1
1324 nmdc:mga08x19_32336_c1
1325 nmdc:mga08x19_356378_c1
1326 nmdc:mga08x19_746418_c1
1327 nmdc:mga08x19_93386_c1
1328 nmdc:mga0a205_16021_c1
1329 Ga0495601_0151470
1330 Ga0495612_0325431
1331 Ga0501084_0000135
1332 Ga0501084_0003048
1333 Ga0501084_0068893
1334 Ga0501082_0001674
1335 Ga0501082_0003297
1336 Ga0501082_0039818
1337 Ga0530510_0002740
1338 Ga0530510_0036572
1339 Ga0530510_0308797
1340 Ga0530510_0947455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

7

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9856 1 125
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.984 2 125
2csl-assembly1.cif.gz_B crystal structure of ttha0137 from thermus thermophilus hb8 0.9816 3 124
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.9813 1 124
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9799 3 124
ID Description Score Start End Superfamily
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.98 1 124 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9792 1 124 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9781 1 124 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9773 18 125 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9754 3 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2V8BM28-F1-model_v4 RidA family protein 0.9962 1 125 GO:0005829
GO:0019239
AF-A0A321LJU5-F1-model_v4 Reactive intermediate/imine deaminase 0.9956 1 125 GO:0005829
GO:0019239
AF-A0A1F5ZSH9-F1-model_v4 Reactive intermediate/imine deaminase 0.9956 1 124 GO:0005829
GO:0019239
AF-A0A7X8Z7B7-F1-model_v4 RidA family protein 0.9956 3 125 GO:0005829
GO:0019239
AF-A0A353A1P7-F1-model_v4 Reactive intermediate/imine deaminase 0.9951 3 124 GO:0005829
GO:0019239

Map