F474083

General Info

Members Datasets Scaffolds Average Seq Length
670 321 670 121

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_11613329|Ga0163163_116133291
Length 139
Sequence MCLEEVTRPLLYASSFMPLAADFQQILDSLPPDWTDLEVDVRIEDESQYVDSAVAVSQVNAQVYQHPHQEGWHWRLLIAKSFGHAAAPESVRGVLEKLDADDVAGELRVAEVREGRSEVVQMWGRPESVREEFRERRSL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
316 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
317 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
318 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
319 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 10.6
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1036030 3300000546 Unclassified 535
2 JGI24746J21847_1000470 3300001977 Bacteria 6029
3 JGI24740J21852_10003186 3300001979 Bacteria 7243
4 JGI24750J21931_1084678 3300002070 Bacteria 531
5 JGI24748J21848_1000663 3300002074 Bacteria 3705
6 JGI24034J26672_10000455 3300002239 Bacteria 5287
7 JGI24742J22300_10033543 3300002244 Bacteria 902
8 JGI24751J29686_10100313 3300002459 Unclassified 604
9 JGI25406J46586_10045753 3300003203 Bacteria 1504
10 JGI25404J52841_10010894 3300003659 Bacteria 1956
11 Ga0070658_10017126 3300005327 Bacteria 5799
12 Ga0070683_100003109 3300005329 Bacteria 13374
13 Ga0070683_100012149 3300005329 Bacteria 7473
14 Ga0070683_100012949 3300005329 Bacteria 7260
15 Ga0070683_100085314 3300005329 Bacteria 2960
16 Ga0070683_100453654 3300005329 Bacteria 1223
17 Ga0070670_100193620 3300005331 Bacteria 1766
18 Ga0070677_10000022 3300005333 Bacteria 45355
19 Ga0070666_10028671 3300005335 Bacteria 3654
20 Ga0070680_100149554 3300005336 Bacteria 1960
21 Ga0070680_100271909 3300005336 Bacteria 1435
22 Ga0070682_100000099 3300005337 Bacteria 77574
23 Ga0070682_100308430 3300005337 Unclassified 1164
24 Ga0070682_100431138 3300005337 Bacteria 1005
25 Ga0070682_102086806 3300005337 Bacteria 500
26 Ga0068868_100000450 3300005338 Bacteria 27515
27 Ga0070689_101117630 3300005340 Unclassified 705
28 Ga0070691_10000379 3300005341 Bacteria 16112
29 Ga0070661_100000102 3300005344 Bacteria 69941
30 Ga0070668_100316507 3300005347 Bacteria 1313
31 Ga0070668_101449615 3300005347 Bacteria 627
32 Ga0070675_100000027 3300005354 Bacteria 106172
33 Ga0070675_101583876 3300005354 Bacteria 604
34 Ga0070674_100000090 3300005356 Bacteria 42115
35 Ga0070674_100000683 3300005356 Bacteria 17159
36 Ga0070673_100005169 3300005364 Bacteria 8331
37 Ga0070688_100000738 3300005365 Bacteria 16106
38 Ga0070688_100003810 3300005365 Bacteria 7820
39 Ga0070659_100013281 3300005366 Bacteria 6126
40 Ga0070667_100140750 3300005367 Bacteria 2113
41 Ga0070667_100253940 3300005367 Bacteria 1572
42 Ga0070667_100400187 3300005367 Bacteria 1250
43 Ga0070703_10038768 3300005406 Bacteria 1474
44 Ga0070714_100029758 3300005435 Bacteria 4542
45 Ga0070713_100000085 3300005436 Bacteria 58902
46 Ga0070713_100094192 3300005436 Bacteria 2581
47 Ga0070701_10592547 3300005438 Unclassified 733
48 Ga0070711_100000734 3300005439 Bacteria 17090
49 Ga0070711_100856043 3300005439 Bacteria 774
50 Ga0070700_100097331 3300005441 Bacteria 1932
51 Ga0070663_100024055 3300005455 Bacteria 4092
52 Ga0070663_100078648 3300005455 Bacteria 2418
53 Ga0070678_100052362 3300005456 Bacteria 2964
54 Ga0070678_100128638 3300005456 Bacteria 2009
55 Ga0070678_100338615 3300005456 Unclassified 1290
56 Ga0070678_101218876 3300005456 Unclassified 698
57 Ga0068867_100000796 3300005459 Bacteria 21356
58 Ga0070685_10000141 3300005466 Bacteria 46333
59 Ga0070685_10000616 3300005466 Bacteria 19644
60 Ga0070685_10690849 3300005466 Bacteria 743
61 Ga0070685_10739997 3300005466 Bacteria 720
62 Ga0070679_100000243 3300005530 Bacteria 45435
63 Ga0070684_100055354 3300005535 Bacteria 3458
64 Ga0070684_100078721 3300005535 Bacteria 2913
65 Ga0070684_100108294 3300005535 Bacteria 2489
66 Ga0070684_100172790 3300005535 Bacteria 1963
67 Ga0070684_100631284 3300005535 Bacteria 997
68 Ga0068853_100042402 3300005539 Bacteria 3891
69 Ga0068853_100212198 3300005539 Bacteria 1765
70 Ga0068853_100346137 3300005539 Unclassified 1382
71 Ga0068853_101225435 3300005539 Bacteria 725
72 Ga0070672_100001367 3300005543 Bacteria 15049
73 Ga0070686_100326268 3300005544 Bacteria 1146
74 Ga0070695_100076867 3300005545 Bacteria 2199
75 Ga0070665_100000106 3300005548 Bacteria 157315
76 Ga0070665_100000950 3300005548 Bacteria 36935
77 Ga0070665_100076910 3300005548 Bacteria 3344
78 Ga0070665_100102705 3300005548 Bacteria 2862
79 Ga0070665_100513584 3300005548 Bacteria 1210
80 Ga0070665_100532510 3300005548 Bacteria 1187
81 Ga0070665_100646222 3300005548 Unclassified 1071
82 Ga0070665_101702637 3300005548 Bacteria 638
83 Ga0070704_100098991 3300005549 Bacteria 2192
84 Ga0068855_100220175 3300005563 Bacteria 2129
85 Ga0068855_100456315 3300005563 Bacteria 1394
86 Ga0068855_101875267 3300005563 Bacteria 608
87 Ga0070664_100168855 3300005564 Bacteria 1940
88 Ga0068857_100504968 3300005577 Bacteria 1135
89 Ga0068854_100040165 3300005578 Bacteria 3300
90 Ga0068856_100000629 3300005614 Bacteria 38394
91 Ga0068856_100009027 3300005614 Bacteria 9700
92 Ga0068856_100009431 3300005614 Bacteria 9476
93 Ga0068856_100251724 3300005614 Bacteria 1781
94 Ga0068856_100529929 3300005614 Bacteria 1199
95 Ga0070702_100061922 3300005615 Archaea 2180
96 Ga0068852_100000006 3300005616 Bacteria 159569
97 Ga0068852_101880785 3300005616 Bacteria 621
98 Ga0068859_102252646 3300005617 Unclassified 601
99 Ga0068864_100000053 3300005618 Bacteria 133049
100 Ga0068866_10000001 3300005718 Bacteria 519680
101 Ga0068866_10000685 3300005718 Bacteria 15430
102 Ga0068861_100185142 3300005719 Unclassified 1736
103 Ga0068861_100863997 3300005719 Unclassified 854
104 Ga0068863_100000342 3300005841 Bacteria 47536
105 Ga0068863_100010993 3300005841 Bacteria 8778
106 Ga0068863_100024630 3300005841 Bacteria 5739
107 Ga0068858_100000009 3300005842 Bacteria 237748
108 Ga0068858_100000065 3300005842 Bacteria 108233
109 Ga0068858_100701468 3300005842 Bacteria 985
110 Ga0068860_100015414 3300005843 Bacteria 7468
111 Ga0068860_100045535 3300005843 Bacteria 4184
112 Ga0068860_100073002 3300005843 Bacteria 3262
113 Ga0068862_100004868 3300005844 Bacteria 11306
114 Ga0081455_10030774 3300005937 Bacteria 4870
115 Ga0081455_10079300 3300005937 Bacteria 2696
116 Ga0081455_10134122 3300005937 Bacteria 1932
117 Ga0081538_10000224 3300005981 Bacteria 63610
118 Ga0081538_10000292 3300005981 Bacteria 57471
119 Ga0081538_10038874 3300005981 Bacteria 3060
120 Ga0081540_1000163 3300005983 Bacteria 68955
121 Ga0081539_10009804 3300005985 Bacteria 7915
122 Ga0081539_10036425 3300005985 Bacteria 2945
123 Ga0075364_10301570 3300006051 Unclassified 1090
124 Ga0070715_10000001 3300006163 Bacteria 693690
125 Ga0070712_100003543 3300006175 Bacteria 9611
126 Ga0070712_101414369 3300006175 Bacteria 607
127 Ga0075430_100251755 3300006846 Bacteria 1463
128 Ga0075430_100474680 3300006846 Bacteria 1032
129 Ga0075430_101640040 3300006846 Unclassified 528
130 Ga0075433_10000900 3300006852 Bacteria 20958
131 Ga0068865_100123957 3300006881 Bacteria 1926
132 Ga0097620_102253579 3300006931 Unclassified 601
133 Ga0105240_10341878 3300009093 Bacteria 1700
134 Ga0105240_10484914 3300009093 Unclassified 1377
135 Ga0105245_10000020 3300009098 Bacteria 181774
136 Ga0105245_10000254 3300009098 Bacteria 50918
137 Ga0105245_10005635 3300009098 Bacteria 11007
138 Ga0105245_10733841 3300009098 Bacteria 1023
139 Ga0105247_10000316 3300009101 Bacteria 43374
140 Ga0105247_10046632 3300009101 Bacteria 2660
141 Ga0105247_10057391 3300009101 Bacteria 2407
142 Ga0105247_10091080 3300009101 Bacteria 1936
143 Ga0105247_10793144 3300009101 Bacteria 722
144 Ga0114129_11055251 3300009147 Bacteria 1020
145 Ga0105243_10203452 3300009148 Bacteria 1738
146 Ga0105243_10461670 3300009148 Bacteria 1194
147 Ga0105241_10493297 3300009174 Bacteria 1091
148 Ga0105242_10000032 3300009176 Bacteria 98198
149 Ga0105242_10000454 3300009176 Bacteria 32662
150 Ga0105242_10034640 3300009176 Bacteria 4048
151 Ga0105242_11007705 3300009176 Bacteria 841
152 Ga0105248_10000008 3300009177 Bacteria 403910
153 Ga0105248_10464002 3300009177 Unclassified 1428
154 Ga0105248_10952990 3300009177 Bacteria 969
155 Ga0105237_10854796 3300009545 Bacteria 917
156 Ga0105238_10000011 3300009551 Bacteria 261080
157 Ga0105249_10000080 3300009553 Bacteria 138080
158 Ga0105249_10122790 3300009553 Bacteria 2470
159 Ga0105249_10236597 3300009553 Bacteria 1804
160 Ga0105249_10278023 3300009553 Bacteria 1671
161 Ga0105249_13559026 3300009553 Bacteria 502
162 Ga0105239_10198120 3300010375 Bacteria 2249
163 Ga0105239_10513843 3300010375 Bacteria 1362
164 Ga0105239_11372476 3300010375 Bacteria 816
165 Ga0105246_10086734 3300011119 Bacteria 2245
166 Ga0157370_11273517 3300013104 Bacteria 663
167 Ga0157369_10000020 3300013105 Bacteria 241679
168 Ga0157369_11180353 3300013105 Bacteria 781
169 Ga0157374_10001772 3300013296 Bacteria 18163
170 Ga0157374_10140331 3300013296 Bacteria 2345
171 Ga0157378_10011377 3300013297 Bacteria 7788
172 Ga0157378_10066419 3300013297 Bacteria 3231
173 Ga0157378_10262517 3300013297 Bacteria 1657
174 Ga0163162_10900834 3300013306 Bacteria 998
175 Ga0157372_13462531 3300013307 Unclassified 502
176 Ga0157375_10001213 3300013308 Bacteria 22205
177 Ga0157375_10001538 3300013308 Bacteria 19849
178 Ga0157375_10037053 3300013308 Bacteria 4670
179 Ga0157375_10064237 3300013308 Bacteria 3654
180 Ga0157375_10623423 3300013308 Unclassified 1236
181 Ga0157375_11231945 3300013308 Unclassified 878
182 Ga0163163_10333782 3300014325 Bacteria 1571
183 Ga0163163_10457811 3300014325 Bacteria 1336
184 Ga0163163_10834815 3300014325 Unclassified 985
185 Ga0163163_11084014 3300014325 Bacteria 864
186 Ga0163163_11613329 3300014325 Bacteria 710
187 Ga0163163_11971430 3300014325 Bacteria 644
188 Ga0157380_11167437 3300014326 Unclassified 812
189 Ga0157379_10072798 3300014968 Bacteria 3075
190 Ga0157379_10215488 3300014968 Bacteria 1739
191 Ga0157379_10436563 3300014968 Bacteria 1207
192 Ga0157379_11103525 3300014968 Bacteria 760
193 Ga0157376_10025483 3300014969 Bacteria 4658
194 Ga0157376_10302501 3300014969 Bacteria 1515
195 Ga0163161_10129034 3300017792 Bacteria 1906
196 Ga0163161_10303339 3300017792 Bacteria 1258
197 Ga0207656_10059181 3300025321 Bacteria 1676
198 Ga0207653_10052614 3300025885 Bacteria 1358
199 Ga0207682_10000005 3300025893 Bacteria 95617
200 Ga0207642_10000002 3300025899 Bacteria 658166
201 Ga0207642_10000281 3300025899 Bacteria 15233
202 Ga0207710_10000458 3300025900 Bacteria 26155
203 Ga0207710_10047351 3300025900 Bacteria 1921
204 Ga0207710_10247242 3300025900 Bacteria 891
205 Ga0207680_10006139 3300025903 Bacteria 5792
206 Ga0207680_10143700 3300025903 Bacteria 1584
207 Ga0207685_10000027 3300025905 Bacteria 102101
208 Ga0207699_10709332 3300025906 Bacteria 737
209 Ga0207705_10032908 3300025909 Bacteria 3705
210 Ga0207654_10600706 3300025911 Bacteria 785
211 Ga0207707_10255808 3300025912 Bacteria 1520
212 Ga0207695_10280162 3300025913 Bacteria 1561
213 Ga0207693_10015289 3300025915 Bacteria 6159
214 Ga0207663_10000498 3300025916 Bacteria 17164
215 Ga0207663_10380579 3300025916 Bacteria 1075
216 Ga0207660_10117921 3300025917 Bacteria 2007
217 Ga0207660_11023398 3300025917 Unclassified 673
218 Ga0207662_11314574 3300025918 Unclassified 514
219 Ga0207649_10000009 3300025920 Bacteria 295544
220 Ga0207652_10002027 3300025921 Bacteria 17455
221 Ga0207652_10009957 3300025921 Bacteria 7653
222 Ga0207681_10059820 3300025923 Bacteria 2613
223 Ga0207694_10000004 3300025924 Bacteria 967075
224 Ga0207650_10134897 3300025925 Bacteria 1935
225 Ga0207659_10000010 3300025926 Bacteria 286639
226 Ga0207687_10000007 3300025927 Bacteria 604185
227 Ga0207687_10000013 3300025927 Bacteria 299826
228 Ga0207687_10002226 3300025927 Bacteria 13218
229 Ga0207700_10000027 3300025928 Bacteria 137708
230 Ga0207700_10018207 3300025928 Bacteria 4714
231 Ga0207664_10333168 3300025929 Bacteria 1341
232 Ga0207664_10568183 3300025929 Unclassified 1018
233 Ga0207690_10012815 3300025932 Bacteria 5023
234 Ga0207706_10000012 3300025933 Bacteria 195475
235 Ga0207686_10000048 3300025934 Bacteria 115595
236 Ga0207686_10000447 3300025934 Bacteria 27400
237 Ga0207686_10017927 3300025934 Bacteria 4000
238 Ga0207686_10021013 3300025934 Bacteria 3739
239 Ga0207709_10116622 3300025935 Bacteria 1795
240 Ga0207709_10387917 3300025935 Bacteria 1064
241 Ga0207669_10000018 3300025937 Bacteria 114254
242 Ga0207669_10000096 3300025937 Bacteria 44213
243 Ga0207704_10215492 3300025938 Bacteria 1417
244 Ga0207691_10003586 3300025940 Bacteria 15090
245 Ga0207711_10000006 3300025941 Bacteria 792692
246 Ga0207711_10321951 3300025941 Unclassified 1429
247 Ga0207711_10503612 3300025941 Bacteria 1129
248 Ga0207711_11317632 3300025941 Bacteria 664
249 Ga0207661_10000253 3300025944 Bacteria 34627
250 Ga0207661_10000347 3300025944 Bacteria 29715
251 Ga0207661_10007582 3300025944 Bacteria 7717
252 Ga0207661_10011874 3300025944 Bacteria 6327
253 Ga0207661_10019993 3300025944 Bacteria 4999
254 Ga0207661_10147525 3300025944 Bacteria 2031
255 Ga0207661_10237798 3300025944 Bacteria 1615
256 Ga0207679_10254057 3300025945 Bacteria 1496
257 Ga0207679_11714745 3300025945 Bacteria 575
258 Ga0207667_10184223 3300025949 Bacteria 2144
259 Ga0207667_10412911 3300025949 Bacteria 1374
260 Ga0207667_11020873 3300025949 Bacteria 813
261 Ga0207651_10033652 3300025960 Bacteria 3308
262 Ga0207712_10000007 3300025961 Bacteria 539589
263 Ga0207712_10084764 3300025961 Bacteria 2316
264 Ga0207712_10096858 3300025961 Bacteria 2185
265 Ga0207712_10168968 3300025961 Bacteria 1707
266 Ga0207668_10026773 3300025972 Bacteria 3749
267 Ga0207668_11136590 3300025972 Bacteria 701
268 Ga0207640_10003186 3300025981 Bacteria 8830
269 Ga0207658_10002826 3300025986 Bacteria 12451
270 Ga0207658_10105875 3300025986 Bacteria 2213
271 Ga0207677_10000200 3300026023 Bacteria 48320
272 Ga0207677_10018605 3300026023 Bacteria 4173
273 Ga0207703_10000018 3300026035 Bacteria 271377
274 Ga0207703_10000023 3300026035 Bacteria 222018
275 Ga0207703_11268719 3300026035 Unclassified 708
276 Ga0207639_10070507 3300026041 Bacteria 2730
277 Ga0207639_10108827 3300026041 Bacteria 2254
278 Ga0207639_10318358 3300026041 Unclassified 1381
279 Ga0207639_11157892 3300026041 Bacteria 726
280 Ga0207678_10006053 3300026067 Bacteria 10761
281 Ga0207678_10100948 3300026067 Bacteria 2465
282 Ga0207708_10146463 3300026075 Bacteria 1856
283 Ga0207702_10000158 3300026078 Bacteria 79984
284 Ga0207702_10004125 3300026078 Bacteria 13025
285 Ga0207702_10300350 3300026078 Bacteria 1524
286 Ga0207702_10485326 3300026078 Bacteria 1203
287 Ga0207702_11458704 3300026078 Bacteria 678
288 Ga0207641_10000238 3300026088 Bacteria 71152
289 Ga0207641_10004805 3300026088 Bacteria 11642
290 Ga0207648_10008647 3300026089 Bacteria 9832
291 Ga0207676_10000195 3300026095 Bacteria 52951
292 Ga0207674_10255185 3300026116 Bacteria 1700
293 Ga0207674_11165993 3300026116 Unclassified 740
294 Ga0207675_100129425 3300026118 Bacteria 2393
295 Ga0207675_100955456 3300026118 Unclassified 874
296 Ga0207683_10004283 3300026121 Bacteria 12324
297 Ga0207683_10012162 3300026121 Bacteria 7348
298 Ga0207683_10507001 3300026121 Bacteria 1114
299 Ga0207698_10000013 3300026142 Bacteria 255414
300 Ga0268266_10000047 3300028379 Bacteria 310996
301 Ga0268266_10000595 3300028379 Bacteria 49517
302 Ga0268266_10006385 3300028379 Bacteria 10799
303 Ga0268266_10129548 3300028379 Bacteria 2255
304 Ga0268266_10413967 3300028379 Bacteria 1276
305 Ga0268266_10617569 3300028379 Bacteria 1042
306 Ga0268266_11037507 3300028379 Bacteria 793
307 Ga0268265_10069595 3300028380 Bacteria 2733
308 Ga0268264_10029949 3300028381 Bacteria 4462
309 Ga0268264_10282597 3300028381 Bacteria 1555
310 Ga0268264_10404945 3300028381 Bacteria 1312
311 Ga0265337_1000807 3300028556 Bacteria 16498
312 Ga0265319_1000020 3300028563 Bacteria 153921
313 Ga0265334_10072019 3300028573 Bacteria 1286
314 Ga0265322_10000001 3300028654 Bacteria 543854
315 Ga0265336_10021063 3300028666 Bacteria 2086
316 Ga0265338_10001248 3300028800 Bacteria 41926
317 Ga0265324_10000755 3300029957 Bacteria 21443
318 Ga0265332_10089355 3300031238 Bacteria 1303
319 Ga0265328_10001094 3300031239 Bacteria 12441
320 Ga0265320_10000002 3300031240 Bacteria 542875
321 Ga0265325_10027972 3300031241 Bacteria 3044
322 Ga0265329_10010994 3300031242 Bacteria 3303
323 Ga0265339_10040002 3300031249 Bacteria 2607
324 Ga0265331_10009837 3300031250 Bacteria 5330
325 Ga0265331_10039701 3300031250 Bacteria 2294
326 Ga0265327_10000011 3300031251 Bacteria 543807
327 Ga0265316_10035392 3300031344 Bacteria 4047
328 Ga0307513_10422210 3300031456 Bacteria 1063
329 Ga0265314_10000062 3300031711 Bacteria 159496
330 Ga0265342_10130167 3300031712 Bacteria 1411
331 Ga0316576_10002655 3300031727 Bacteria 10215
332 Ga0316576_10766085 3300031727 Bacteria 696
333 Ga0316578_10272663 3300031728 Bacteria 1014
334 Ga0307415_100025696 3300032126 Bacteria 3701
335 Ga0316583_10075817 3300032133 Bacteria 1176
336 Ga0373953_0537388 3300035117 Unclassified 519
337 Ga0373957_0169454 3300035120 Unclassified 902
338 Ga0373955_0131489 3300035172 Unclassified 1461
339 Ga0316574_0007038 3300035398 Bacteria 6132
340 Ga0316574_0020608 3300035398 Bacteria 3904
341 Ga0316574_0769129 3300035398 Unclassified 588
342 Ga0373933_0514565 3300035724 Unclassified 784
343 Ga0373947_1233701 3300035725 Unclassified 509
344 Ga0373937_0065492 3300036401 Bacteria 3345
345 Ga0316584_0005290 3300036712 Bacteria 8643
346 Ga0316584_0361150 3300036712 Bacteria 1041
347 Ga0451804_1065570 3300041463 Unclassified 548
348 Ga0451807_2677790 3300041486 Unclassified 552
349 Ga0451849_0214338 3300041505 Bacteria 509
350 Ga0451853_2765288 3300041512 Bacteria 3303
351 Ga0466963_0000153 3300044694 Bacteria 27553
352 Ga0466963_0108599 3300044694 Bacteria 1903
353 Ga0466963_0111154 3300044694 Bacteria 1881
354 Ga0466963_1096648 3300044694 Bacteria 560
355 Ga0466967_0000009 3300045976 Bacteria 122610
356 Ga0466967_0006679 3300045976 Bacteria 8202
357 Ga0466967_0800594 3300045976 Unclassified 936
358 Ga0466967_1069266 3300045976 Bacteria 804
359 Ga0466967_1166160 3300045976 Bacteria 768
360 Ga0495592_0166417 3300046454 Bacteria 1513
361 Ga0495592_0389916 3300046454 Bacteria 884
362 Ga0495603_0001389 3300046455 Bacteria 14063
363 Ga0495603_0001462 3300046455 Bacteria 13743
364 Ga0495603_0806219 3300046455 Unclassified 535
365 Ga0495629_0000509 3300046459 Bacteria 32652
366 Ga0495629_0003113 3300046459 Bacteria 12579
367 Ga0495629_0045971 3300046459 Bacteria 3063
368 Ga0495629_0308837 3300046459 Unclassified 1082
369 Ga0495638_0016284 3300046460 Bacteria 4982
370 Ga0495641_0000228 3300046461 Bacteria 43671
371 Ga0495641_0542231 3300046461 Unclassified 531
372 Ga0495653_0048856 3300046463 Bacteria 3263
373 Ga0495653_0233765 3300046463 Unclassified 1229
374 Ga0495653_0240081 3300046463 Bacteria 1208
375 Ga0495653_0417681 3300046463 Bacteria 849
376 Ga0495653_0572655 3300046463 Bacteria 697
377 Ga0495653_0592416 3300046463 Bacteria 682
378 Ga0495582_0000726 3300046473 Bacteria 18153
379 Ga0495662_0028052 3300046476 Unclassified 2718
380 Ga0495664_0427419 3300046477 Bacteria 794
381 Ga0495594_0000029 3300046499 Bacteria 66789
382 Ga0495606_0000072 3300046507 Bacteria 173678
383 Ga0495608_0000060 3300046511 Bacteria 88189
384 Ga0495608_0000529 3300046511 Bacteria 26174
385 Ga0495608_0036783 3300046511 Bacteria 3294
386 Ga0495618_0204870 3300046514 Bacteria 1248
387 Ga0495618_0378611 3300046514 Bacteria 869
388 Ga0495620_0000824 3300046515 Bacteria 19119
389 Ga0495628_0009655 3300046516 Bacteria 8232
390 Ga0495628_0041865 3300046516 Bacteria 3655
391 Ga0495628_0080155 3300046516 Bacteria 2538
392 Ga0495628_0117946 3300046516 Bacteria 2038
393 Ga0495628_0139014 3300046516 Bacteria 1854
394 Ga0495628_0376004 3300046516 Bacteria 1041
395 Ga0495628_0498713 3300046516 Bacteria 879
396 Ga0495628_0880669 3300046516 Bacteria 622
397 Ga0495630_0000020 3300046517 Bacteria 176389
398 Ga0495630_0009440 3300046517 Bacteria 7015
399 Ga0495630_0085507 3300046517 Bacteria 2381
400 Ga0495630_0149936 3300046517 Bacteria 1774
401 Ga0495630_0544007 3300046517 Bacteria 890
402 Ga0495644_0014524 3300046523 Bacteria 3016
403 Ga0495644_0244209 3300046523 Bacteria 697
404 Ga0495652_0000407 3300046529 Bacteria 50232
405 Ga0495652_0045375 3300046529 Bacteria 3779
406 Ga0495652_0254272 3300046529 Bacteria 1300
407 Ga0495640_0036783 3300046533 Bacteria 3457
408 Ga0495640_0091005 3300046533 Bacteria 2013
409 Ga0495586_0021614 3300046535 Bacteria 3431
410 Ga0495586_0305432 3300046535 Unclassified 912
411 Ga0495587_0019281 3300046536 Bacteria 4224
412 Ga0495587_0047777 3300046536 Bacteria 2537
413 Ga0495587_0532161 3300046536 Bacteria 649
414 Ga0495598_0002610 3300046537 Bacteria 3731
415 Ga0495621_0006858 3300046539 Bacteria 3350
416 Ga0495621_0066218 3300046539 Bacteria 1321
417 Ga0495645_0006445 3300046543 Bacteria 8142
418 Ga0495645_0019986 3300046543 Bacteria 4828
419 Ga0495622_0000550 3300046557 Bacteria 22511
420 Ga0495667_0000018 3300046559 Bacteria 188610
421 Ga0495667_0074568 3300046559 Bacteria 2209
422 Ga0495656_0001090 3300046615 Bacteria 8799
423 Ga0495668_0720470 3300046616 Unclassified 552
424 Ga0495634_0000059 3300046642 Bacteria 88314
425 Ga0495634_0015499 3300046642 Bacteria 5475
426 Ga0495634_0253327 3300046642 Unclassified 1076
427 Ga0495634_0349180 3300046642 Bacteria 886
428 Ga0495634_0552366 3300046642 Unclassified 671
429 Ga0495625_0000756 3300046660 Bacteria 45145
430 Ga0495625_0253451 3300046660 Bacteria 1142
431 Ga0495625_0367777 3300046660 Bacteria 905
432 Ga0495635_0124963 3300046663 Bacteria 1754
433 Ga0495635_0220008 3300046663 Bacteria 1284
434 Ga0495635_0312271 3300046663 Bacteria 1053
435 Ga0495635_0587810 3300046663 Bacteria 728
436 Ga0495635_0944979 3300046663 Bacteria 550
437 Ga0495588_0000134 3300046674 Bacteria 117581
438 Ga0495657_0000004 3300046675 Bacteria 266465
439 Ga0495657_0051214 3300046675 Bacteria 2773
440 Ga0495599_0018403 3300046678 Bacteria 4352
441 Ga0495599_0074998 3300046678 Bacteria 2112
442 Ga0495623_0383476 3300046679 Unclassified 759
443 Ga0495623_0723111 3300046679 Unclassified 508
444 Ga0495646_0174008 3300046680 Bacteria 1185
445 Ga0495646_0381400 3300046680 Bacteria 735
446 Ga0495647_0000156 3300046681 Bacteria 17539
447 Ga0495647_0009525 3300046681 Bacteria 3293
448 Ga0495658_0000034 3300046683 Bacteria 69176
449 Ga0495658_0509780 3300046683 Unclassified 770
450 Ga0495658_1079639 3300046683 Archaea 512
451 Ga0495669_0000310 3300046684 Bacteria 26921
452 Ga0495613_0000801 3300046689 Bacteria 24391
453 Ga0495613_0004320 3300046689 Bacteria 10639
454 Ga0495613_0071867 3300046689 Bacteria 2522
455 Ga0495613_0123022 3300046689 Bacteria 1862
456 Ga0495624_0002509 3300046690 Bacteria 13903
457 Ga0495670_0019959 3300046691 Bacteria 3303
458 Ga0495649_0008541 3300046694 Bacteria 6154
459 Ga0495600_0056445 3300046809 Bacteria 2565
460 Ga0495600_0457452 3300046809 Bacteria 788
461 Ga0495660_0238943 3300046810 Bacteria 848
462 Ga0495581_0036815 3300047315 Bacteria 2831
463 Ga0495604_0000055 3300047317 Bacteria 100430
464 Ga0495604_0000137 3300047317 Bacteria 62542
465 Ga0495604_0046921 3300047317 Bacteria 3367
466 Ga0495674_0000064 3300047319 Bacteria 71275
467 Ga0495674_0112482 3300047319 Bacteria 2307
468 Ga0495674_0295826 3300047319 Bacteria 1323
469 Ga0495672_0063979 3300047320 Bacteria 2108
470 Ga0495672_0157717 3300047320 Bacteria 1170
471 Ga0495672_0215233 3300047320 Unclassified 952
472 Ga0495676_0000130 3300047321 Bacteria 56693
473 Ga0495676_0011318 3300047321 Bacteria 8057
474 Ga0495680_0000550 3300047322 Bacteria 42291
475 Ga0495680_0004286 3300047322 Bacteria 13686
476 Ga0495680_0029878 3300047322 Bacteria 4457
477 Ga0495680_0143515 3300047322 Bacteria 1745
478 Ga0495675_0000040 3300047444 Bacteria 86266
479 Ga0495679_010145 3300047446 Bacteria 3718
480 Ga0495673_0020669 3300047469 Bacteria 3274
481 Ga0495686_0034255 3300047472 Bacteria 3272
482 Ga0495686_0082686 3300047472 Unclassified 1959
483 Ga0495602_0000041 3300048088 Bacteria 126954
484 Ga0495602_0013815 3300048088 Bacteria 8231
485 Ga0495602_0215823 3300048088 Bacteria 1452
486 Ga0495602_0231405 3300048088 Bacteria 1388
487 Ga0495602_0608090 3300048088 Bacteria 751
488 Ga0496100_0000002 3300048903 Bacteria 489057
489 Ga0496100_0000005 3300048903 Bacteria 312112
490 Ga0496100_0182269 3300048903 Bacteria 1519
491 Ga0496100_1454953 3300048903 Unclassified 541
492 Ga0496101_0000001 3300048904 Bacteria 489057
493 Ga0496101_0000101 3300048904 Bacteria 89424
494 Ga0496101_0281939 3300048904 Bacteria 1299
495 Ga0496101_0556121 3300048904 Bacteria 907
496 Ga0496102_0000115 3300048905 Bacteria 114224
497 Ga0496102_0117114 3300048905 Bacteria 2486
498 Ga0496103_0000008 3300048906 Bacteria 340474
499 Ga0496103_0072055 3300048906 Bacteria 2163
500 Ga0496103_0224914 3300048906 Bacteria 1207
501 Ga0496104_0000004 3300048907 Bacteria 641830
502 Ga0496104_0000009 3300048907 Bacteria 488055
503 Ga0496104_0006952 3300048907 Bacteria 9977
504 Ga0496104_0008811 3300048907 Bacteria 8969
505 Ga0496104_1293504 3300048907 Bacteria 632
506 Ga0496104_1628535 3300048907 Unclassified 548
507 Ga0496104_1663565 3300048907 Bacteria 541
508 Ga0496105_0000001 3300048908 Bacteria 1328178
509 Ga0496105_0000007 3300048908 Bacteria 339658
510 Ga0496105_0000650 3300048908 Bacteria 23286
511 Ga0496105_0142503 3300048908 Bacteria 1972
512 Ga0496105_0440104 3300048908 Bacteria 1030
513 Ga0496106_0000084 3300048909 Bacteria 74135
514 Ga0496106_0000151 3300048909 Bacteria 51430
515 Ga0496106_0000682 3300048909 Bacteria 24335
516 Ga0496106_0685917 3300048909 Bacteria 817
517 Ga0496107_0000003 3300048910 Bacteria 304038
518 Ga0496107_0000011 3300048910 Bacteria 201631
519 Ga0496107_0761173 3300048910 Bacteria 710
520 Ga0496107_1153170 3300048910 Bacteria 558
521 Ga0496108_0000001 3300048911 Bacteria 919044
522 Ga0496108_0000175 3300048911 Bacteria 59373
523 Ga0496108_0000587 3300048911 Bacteria 28462
524 Ga0496108_0029134 3300048911 Bacteria 4570
525 Ga0496108_0068044 3300048911 Bacteria 3004
526 Ga0496108_0603839 3300048911 Bacteria 956
527 Ga0496109_0000003 3300048912 Bacteria 420862
528 Ga0496109_0000121 3300048912 Bacteria 81487
529 Ga0496109_0000249 3300048912 Bacteria 51718
530 Ga0496109_0001118 3300048912 Bacteria 22284
531 Ga0496109_0071967 3300048912 Bacteria 3175
532 Ga0496109_0405406 3300048912 Bacteria 1288
533 Ga0496110_0004679 3300048913 Bacteria 10644
534 Ga0496110_0007407 3300048913 Bacteria 8762
535 Ga0496110_0023867 3300048913 Bacteria 5207
536 Ga0496110_0804744 3300048913 Bacteria 844
537 Ga0496110_0897091 3300048913 Unclassified 792
538 Ga0496111_0019839 3300048914 Bacteria 4675
539 Ga0496111_0148570 3300048914 Bacteria 1738
540 Ga0496111_0349392 3300048914 Bacteria 1095
541 Ga0496112_0000006 3300048915 Bacteria 365227
542 Ga0496112_0115785 3300048915 Bacteria 2651
543 Ga0496113_0062416 3300048916 Bacteria 2814
544 Ga0496113_0130971 3300048916 Bacteria 1968
545 Ga0496113_0162284 3300048916 Bacteria 1767
546 Ga0496113_0232221 3300048916 Bacteria 1471
547 Ga0496113_0475892 3300048916 Bacteria 1003
548 Ga0496113_0761794 3300048916 Bacteria 770
549 Ga0496114_0000101 3300048917 Bacteria 61589
550 Ga0496114_0012931 3300048917 Bacteria 6686
551 Ga0496114_0150349 3300048917 Bacteria 2020
552 Ga0496114_0287856 3300048917 Bacteria 1449
553 Ga0496114_0349469 3300048917 Bacteria 1308
554 Ga0496114_0903270 3300048917 Bacteria 764
555 Ga0496115_0000003 3300048918 Bacteria 354994
556 Ga0496115_0000200 3300048918 Bacteria 55755
557 Ga0496116_0000735 3300048919 Bacteria 41771
558 Ga0496117_0004253 3300048920 Bacteria 15981
559 Ga0496118_0000833 3300048921 Bacteria 49030
560 Ga0496118_0093077 3300048921 Bacteria 2066
561 Ga0496118_0350948 3300048921 Bacteria 786
562 Ga0496119_0001290 3300048922 Bacteria 30949
563 Ga0496119_0006046 3300048922 Bacteria 11353
564 Ga0496119_0029762 3300048922 Bacteria 3693
565 Ga0496119_0045975 3300048922 Bacteria 2731
566 Ga0496120_0018289 3300048923 Bacteria 4523
567 Ga0496121_0151636 3300048924 Bacteria 1705
568 Ga0496124_0030661 3300048927 Bacteria 4769
569 Ga0496125_0064038 3300048928 Bacteria 2926
570 Ga0496125_0096337 3300048928 Bacteria 2197
571 Ga0496125_0226274 3300048928 Bacteria 1200
572 Ga0496126_0087237 3300048929 Bacteria 2749
573 Ga0496126_0090832 3300048929 Bacteria 2686
574 Ga0496126_0129957 3300048929 Bacteria 2177
575 Ga0495682_0135854 3300049460 Bacteria 879
576 Ga0501031_0003265 3300049568 Bacteria 10420
577 Ga0501032_0004103 3300049569 Bacteria 11037
578 Ga0501033_0000900 3300049570 Bacteria 27183
579 Ga0501034_0202876 3300049571 Bacteria 1940
580 Ga0501034_0628349 3300049571 Bacteria 977
581 Ga0501036_0044867 3300049572 Bacteria 3745
582 Ga0501037_0004199 3300049573 Bacteria 10445
583 Ga0501038_0007149 3300049574 Bacteria 10316
584 Ga0501039_0011339 3300049575 Bacteria 6788
585 Ga0501040_0300169 3300049576 Bacteria 1148
586 Ga0501042_0010369 3300049578 Bacteria 6244
587 Ga0501042_0208861 3300049578 Bacteria 1408
588 Ga0501042_0396399 3300049578 Bacteria 1000
589 Ga0501043_0010751 3300049579 Bacteria 7167
590 Ga0501043_0376583 3300049579 Bacteria 1075
591 Ga0501046_0006462 3300049580 Bacteria 10370
592 Ga0501047_0058444 3300049581 Bacteria 3725
593 Ga0501047_0330649 3300049581 Bacteria 1362
594 Ga0501048_0004528 3300049582 Bacteria 10586
595 Ga0501048_0188340 3300049582 Bacteria 1462
596 Ga0501067_0143109 3300049583 Bacteria 1332
597 Ga0501067_0401802 3300049583 Unclassified 764
598 Ga0501068_0218015 3300049584 Bacteria 1212
599 Ga0501069_0005540 3300049585 Bacteria 6571
600 Ga0501069_0301684 3300049585 Bacteria 939
601 Ga0501069_0575485 3300049585 Bacteria 675
602 Ga0501070_0000680 3300049586 Bacteria 31108
603 Ga0501070_0017909 3300049586 Bacteria 5947
604 Ga0501070_0446943 3300049586 Bacteria 1042
605 Ga0501071_0029507 3300049587 Bacteria 3872
606 Ga0501072_1207496 3300049588 Bacteria 587
607 Ga0501073_0004593 3300049589 Bacteria 10377
608 Ga0501074_0043778 3300049590 Bacteria 3240
609 Ga0501074_0432959 3300049590 Unclassified 933
610 Ga0501074_0587874 3300049590 Bacteria 787
611 Ga0501075_0407095 3300049591 Bacteria 1037
612 Ga0501076_0076196 3300049592 Bacteria 2689
613 Ga0501079_0004743 3300049741 Bacteria 10072
614 Ga0501079_0012155 3300049741 Bacteria 6572
615 Ga0501080_0298518 3300049742 Bacteria 1461
616 Ga0501080_0684506 3300049742 Bacteria 905
617 Ga0501083_0031048 3300049744 Bacteria 3666
618 Ga0501083_0040357 3300049744 Bacteria 3168
619 Ga0501083_0723119 3300049744 Unclassified 647
620 Ga0501035_0000887 3300049822 Bacteria 31755
621 Ga0501044_0009237 3300049823 Bacteria 10767
622 Ga0501044_0067858 3300049823 Bacteria 3633
623 Ga0501044_0545721 3300049823 Bacteria 1057
624 Ga0501045_0080074 3300049824 Bacteria 2408
625 nmdc:mga00v17_78423_c1 3300050491 Unclassified 2058
626 nmdc:mga00v17_99393_c1 3300050491 Bacteria 1835
627 nmdc:mga0qj67_158633_c1 3300050509 Bacteria 1836
628 nmdc:mga0a205_1483_c1 3300050515 Bacteria 11129
629 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
630 Ga0495601_0000013 3300053077 Bacteria 226476
631 Ga0495601_0000855 3300053077 Bacteria 16586
632 Ga0495601_0039086 3300053077 Bacteria 2970
633 Ga0495601_0085532 3300053077 Bacteria 2026
634 Ga0495601_0198319 3300053077 Bacteria 1312
635 Ga0495601_0203682 3300053077 Bacteria 1293
636 Ga0495601_0210744 3300053077 Bacteria 1269
637 Ga0495601_0230207 3300053077 Bacteria 1210
638 Ga0495601_0334959 3300053077 Bacteria 985
639 Ga0495601_0643775 3300053077 Bacteria 678
640 Ga0495612_0000164 3300053078 Bacteria 27579
641 Ga0495612_0006025 3300053078 Bacteria 4995
642 Ga0495612_0012980 3300053078 Bacteria 3356
643 Ga0495612_0084713 3300053078 Bacteria 1335
644 Ga0495612_0250617 3300053078 Bacteria 788
645 Ga0495612_0412231 3300053078 Unclassified 615
646 Ga0495655_0000001 3300053083 Bacteria 419518
647 Ga0495655_0011759 3300053083 Unclassified 1766
648 Ga0495595_0000003 3300053084 Bacteria 266465
649 Ga0495595_0156854 3300053084 Bacteria 1122
650 Ga0495619_0000025 3300053085 Bacteria 167905
651 Ga0495619_0000116 3300053085 Bacteria 58748
652 Ga0495619_0000157 3300053085 Bacteria 49848
653 Ga0495619_0001204 3300053085 Bacteria 16989
654 Ga0495619_0003131 3300053085 Bacteria 10732
655 Ga0495619_0044114 3300053085 Bacteria 2925
656 Ga0495619_0268201 3300053085 Bacteria 1183
657 Ga0500643_213611 3300053087 Bacteria 518
658 Ga0500566_0022439 3300053094 Bacteria 3708
659 Ga0500566_0075425 3300053094 Bacteria 1887
660 Ga0500641_0208742 3300053096 Bacteria 832
661 Ga0500572_076874 3300053111 Bacteria 1040
662 Ga0500595_054701 3300053119 Bacteria 1224
663 Ga0500595_057063 3300053119 Bacteria 1191
664 Ga0500614_001338 3300053123 Bacteria 5937
665 Ga0500628_000033 3300053129 Bacteria 52431
666 Ga0500568_0060755 3300053139 Bacteria 1463
667 Ga0501084_1534596 3300054114 Unclassified 557
668 Ga0501082_0302140 3300060353 Bacteria 1394
669 Ga0501082_0517109 3300060353 Bacteria 1043
670 Ga0501082_1720997 3300060353 Unclassified 547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0230207 Ga0495601_0230207_893_1195 100
2 3300005455 Ga0070663_100078648 Ga0070663_1000786483 107
3 3300026067 Ga0207678_10100948 Ga0207678_101009483 107
4 3300028666 Ga0265336_10021063 Ga0265336_100210632 107
5 3300031239 Ga0265328_10001094 Ga0265328_1000109410 107
6 3300031344 Ga0265316_10035392 Ga0265316_100353924 107
7 3300026116 Ga0207674_11165993 Ga0207674_111659932 110
8 3300046499 Ga0495594_0000029 Ga0495594_0000029_31535_31870 111
9 3300046557 Ga0495622_0000550 Ga0495622_0000550_21678_22013 111
10 3300010375 Ga0105239_10198120 Ga0105239_101981203 118
11 3300013296 Ga0157374_10001772 Ga0157374_100017729 118
12 3300013296 Ga0157374_10140331 Ga0157374_101403313 118
13 3300013308 Ga0157375_10001538 Ga0157375_100015387 118
14 3300013308 Ga0157375_10037053 Ga0157375_100370533 118
15 3300035725 Ga0373947_1233701 Ga0373947_1233701_91_447 118
16 3300046454 Ga0495592_0166417 Ga0495592_0166417_110_466 118
17 3300046455 Ga0495603_0001389 Ga0495603_0001389_12817_13173 118
18 3300046463 Ga0495653_0048856 Ga0495653_0048856_2712_3068 118
19 3300046516 Ga0495628_0117946 Ga0495628_0117946_1633_1989 118
20 3300046517 Ga0495630_0149936 Ga0495630_0149936_219_575 118
21 3300046536 Ga0495587_0019281 Ga0495587_0019281_2719_3075 118
22 3300046559 Ga0495667_0000018 Ga0495667_0000018_66032_66388 118
23 3300046615 Ga0495656_0001090 Ga0495656_0001090_1429_1785 118
24 3300046616 Ga0495668_0720470 Ga0495668_0720470_122_478 118
25 3300046683 Ga0495658_0509780 Ga0495658_0509780_239_595 118
26 3300047317 Ga0495604_0046921 Ga0495604_0046921_819_1175 118
27 3300047322 Ga0495680_0004286 Ga0495680_0004286_2606_2962 118
28 3300048903 Ga0496100_1454953 Ga0496100_1454953_12_368 118
29 3300048904 Ga0496101_0556121 Ga0496101_0556121_421_777 118
30 3300048911 Ga0496108_0000587 Ga0496108_0000587_1574_1930 118
31 3300048912 Ga0496109_0001118 Ga0496109_0001118_12159_12515 118
32 3300048917 Ga0496114_0287856 Ga0496114_0287856_530_886 118
33 3300048918 Ga0496115_0000003 Ga0496115_0000003_110420_110776 118
34 3300050515 nmdc:mga0a205_1483_c1 nmdc:mga0a205_1483_c1_9275_9631 118
35 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_113249_113605 118
36 3300046516 Ga0495628_0880669 Ga0495628_0880669_70_435 119
37 3300001977 JGI24746J21847_1000470 JGI24746J21847_10004704 120
38 3300001979 JGI24740J21852_10003186 JGI24740J21852_100031866 120
39 3300002074 JGI24748J21848_1000663 JGI24748J21848_10006633 120
40 3300002239 JGI24034J26672_10000455 JGI24034J26672_100004555 120
41 3300002244 JGI24742J22300_10033543 JGI24742J22300_100335432 120
42 3300002459 JGI24751J29686_10100313 JGI24751J29686_101003131 120
43 3300003203 JGI25406J46586_10045753 JGI25406J46586_100457533 120
44 3300003659 JGI25404J52841_10010894 JGI25404J52841_100108942 120
45 3300005329 Ga0070683_100003109 Ga0070683_1000031096 120
46 3300005329 Ga0070683_100085314 Ga0070683_1000853142 120
47 3300005333 Ga0070677_10000022 Ga0070677_1000002237 120
48 3300005336 Ga0070680_100149554 Ga0070680_1001495543 120
49 3300005337 Ga0070682_100000099 Ga0070682_10000009986 120
50 3300005337 Ga0070682_100308430 Ga0070682_1003084303 120
51 3300005337 Ga0070682_100431138 Ga0070682_1004311383 120
52 3300005338 Ga0068868_100000450 Ga0068868_10000045017 120
53 3300005340 Ga0070689_101117630 Ga0070689_1011176302 120
54 3300005341 Ga0070691_10000379 Ga0070691_1000037910 120
55 3300005354 Ga0070675_101583876 Ga0070675_1015838761 120
56 3300005356 Ga0070674_100000090 Ga0070674_10000009023 120
57 3300005356 Ga0070674_100000683 Ga0070674_1000006834 120
58 3300005364 Ga0070673_100005169 Ga0070673_10000516910 120
59 3300005366 Ga0070659_100013281 Ga0070659_1000132817 120
60 3300005406 Ga0070703_10038768 Ga0070703_100387683 120
61 3300005438 Ga0070701_10592547 Ga0070701_105925472 120
62 3300005439 Ga0070711_100000734 Ga0070711_1000007347 120
63 3300005441 Ga0070700_100097331 Ga0070700_1000973312 120
64 3300005456 Ga0070678_100128638 Ga0070678_1001286382 120
65 3300005456 Ga0070678_100338615 Ga0070678_1003386153 120
66 3300005459 Ga0068867_100000796 Ga0068867_1000007968 120
67 3300005466 Ga0070685_10739997 Ga0070685_107399971 120
68 3300005530 Ga0070679_100000243 Ga0070679_1000002434 120
69 3300005535 Ga0070684_100055354 Ga0070684_1000553544 120
70 3300005535 Ga0070684_100108294 Ga0070684_1001082943 120
71 3300005535 Ga0070684_100631284 Ga0070684_1006312843 120
72 3300005539 Ga0068853_100042402 Ga0068853_1000424023 120
73 3300005539 Ga0068853_100212198 Ga0068853_1002121981 120
74 3300005545 Ga0070695_100076867 Ga0070695_1000768672 120
75 3300005548 Ga0070665_100000106 Ga0070665_10000010614 120
76 3300005548 Ga0070665_100513584 Ga0070665_1005135842 120
77 3300005548 Ga0070665_100532510 Ga0070665_1005325103 120
78 3300005548 Ga0070665_100646222 Ga0070665_1006462222 120
79 3300005549 Ga0070704_100098991 Ga0070704_1000989912 120
80 3300005563 Ga0068855_100220175 Ga0068855_1002201752 120
81 3300005578 Ga0068854_100040165 Ga0068854_1000401654 120
82 3300005614 Ga0068856_100009431 Ga0068856_1000094313 120
83 3300005614 Ga0068856_100529929 Ga0068856_1005299292 120
84 3300005615 Ga0070702_100061922 Ga0070702_1000619223 120
85 3300005616 Ga0068852_101880785 Ga0068852_1018807852 120
86 3300005617 Ga0068859_102252646 Ga0068859_1022526462 120
87 3300005618 Ga0068864_100000053 Ga0068864_100000053104 120
88 3300005718 Ga0068866_10000001 Ga0068866_10000001423 120
89 3300005718 Ga0068866_10000685 Ga0068866_100006854 120
90 3300005719 Ga0068861_100185142 Ga0068861_1001851422 120
91 3300005719 Ga0068861_100863997 Ga0068861_1008639972 120
92 3300005841 Ga0068863_100000342 Ga0068863_10000034241 120
93 3300005841 Ga0068863_100010993 Ga0068863_10001099310 120
94 3300005841 Ga0068863_100024630 Ga0068863_1000246307 120
95 3300005842 Ga0068858_100000009 Ga0068858_100000009169 120
96 3300005842 Ga0068858_100000065 Ga0068858_10000006543 120
97 3300005843 Ga0068860_100015414 Ga0068860_1000154148 120
98 3300005843 Ga0068860_100045535 Ga0068860_1000455352 120
99 3300005937 Ga0081455_10079300 Ga0081455_100793002 120
100 3300005937 Ga0081455_10134122 Ga0081455_101341222 120
101 3300005981 Ga0081538_10000224 Ga0081538_1000022462 120
102 3300005981 Ga0081538_10000292 Ga0081538_1000029228 120
103 3300005981 Ga0081538_10038874 Ga0081538_100388742 120
104 3300005983 Ga0081540_1000163 Ga0081540_100016358 120
105 3300005985 Ga0081539_10009804 Ga0081539_100098049 120
106 3300005985 Ga0081539_10036425 Ga0081539_100364252 120
107 3300006051 Ga0075364_10301570 Ga0075364_103015702 120
108 3300006163 Ga0070715_10000001 Ga0070715_10000001390 120
109 3300006175 Ga0070712_101414369 Ga0070712_1014143691 120
110 3300006846 Ga0075430_100251755 Ga0075430_1002517552 120
111 3300006846 Ga0075430_100474680 Ga0075430_1004746802 120
112 3300006852 Ga0075433_10000900 Ga0075433_1000090013 120
113 3300006881 Ga0068865_100123957 Ga0068865_1001239573 120
114 3300006931 Ga0097620_102253579 Ga0097620_1022535791 120
115 3300009093 Ga0105240_10484914 Ga0105240_104849143 120
116 3300009098 Ga0105245_10000020 Ga0105245_1000002017 120
117 3300009098 Ga0105245_10005635 Ga0105245_100056353 120
118 3300009098 Ga0105245_10733841 Ga0105245_107338412 120
119 3300009101 Ga0105247_10000316 Ga0105247_1000031627 120
120 3300009101 Ga0105247_10091080 Ga0105247_100910802 120
121 3300009147 Ga0114129_11055251 Ga0114129_110552512 120
122 3300009148 Ga0105243_10203452 Ga0105243_102034522 120
123 3300009176 Ga0105242_10000032 Ga0105242_1000003226 120
124 3300009176 Ga0105242_10000454 Ga0105242_100004545 120
125 3300009176 Ga0105242_10034640 Ga0105242_100346404 120
126 3300009177 Ga0105248_10952990 Ga0105248_109529902 120
127 3300009551 Ga0105238_10000011 Ga0105238_10000011219 120
128 3300009553 Ga0105249_10000080 Ga0105249_1000008040 120
129 3300009553 Ga0105249_10236597 Ga0105249_102365972 120
130 3300009553 Ga0105249_10278023 Ga0105249_102780233 120
131 3300009553 Ga0105249_13559026 Ga0105249_135590261 120
132 3300011119 Ga0105246_10086734 Ga0105246_100867342 120
133 3300013297 Ga0157378_10066419 Ga0157378_100664193 120
134 3300013307 Ga0157372_13462531 Ga0157372_134625311 120
135 3300013308 Ga0157375_10001213 Ga0157375_100012138 120
136 3300013308 Ga0157375_10623423 Ga0157375_106234233 120
137 3300013308 Ga0157375_11231945 Ga0157375_112319451 120
138 3300014325 Ga0163163_10333782 Ga0163163_103337823 120
139 3300014325 Ga0163163_10834815 Ga0163163_108348153 120
140 3300014325 Ga0163163_11084014 Ga0163163_110840142 120
141 3300014326 Ga0157380_11167437 Ga0157380_111674372 120
142 3300014968 Ga0157379_10215488 Ga0157379_102154881 120
143 3300014968 Ga0157379_10436563 Ga0157379_104365631 120
144 3300014969 Ga0157376_10025483 Ga0157376_100254835 120
145 3300017792 Ga0163161_10303339 Ga0163161_103033392 120
146 3300025885 Ga0207653_10052614 Ga0207653_100526142 120
147 3300025893 Ga0207682_10000005 Ga0207682_1000000546 120
148 3300025899 Ga0207642_10000002 Ga0207642_10000002142 120
149 3300025899 Ga0207642_10000281 Ga0207642_1000028116 120
150 3300025900 Ga0207710_10000458 Ga0207710_100004588 120
151 3300025900 Ga0207710_10047351 Ga0207710_100473511 120
152 3300025905 Ga0207685_10000027 Ga0207685_1000002783 120
153 3300025916 Ga0207663_10000498 Ga0207663_100004987 120
154 3300025917 Ga0207660_10117921 Ga0207660_101179213 120
155 3300025921 Ga0207652_10002027 Ga0207652_1000202715 120
156 3300025923 Ga0207681_10059820 Ga0207681_100598203 120
157 3300025924 Ga0207694_10000004 Ga0207694_10000004403 120
158 3300025927 Ga0207687_10000013 Ga0207687_1000001359 120
159 3300025927 Ga0207687_10002226 Ga0207687_100022265 120
160 3300025929 Ga0207664_10333168 Ga0207664_103331682 120
161 3300025932 Ga0207690_10012815 Ga0207690_100128156 120
162 3300025933 Ga0207706_10000012 Ga0207706_1000001258 120
163 3300025934 Ga0207686_10000048 Ga0207686_1000004826 120
164 3300025934 Ga0207686_10000447 Ga0207686_1000044716 120
165 3300025934 Ga0207686_10017927 Ga0207686_100179274 120
166 3300025934 Ga0207686_10021013 Ga0207686_100210133 120
167 3300025935 Ga0207709_10116622 Ga0207709_101166223 120
168 3300025937 Ga0207669_10000018 Ga0207669_100000184 120
169 3300025937 Ga0207669_10000096 Ga0207669_1000009624 120
170 3300025938 Ga0207704_10215492 Ga0207704_102154922 120
171 3300025941 Ga0207711_11317632 Ga0207711_113176322 120
172 3300025944 Ga0207661_10007582 Ga0207661_100075825 120
173 3300025944 Ga0207661_10011874 Ga0207661_100118746 120
174 3300025944 Ga0207661_10237798 Ga0207661_102377983 120
175 3300025945 Ga0207679_11714745 Ga0207679_117147451 120
176 3300025949 Ga0207667_10184223 Ga0207667_101842232 120
177 3300025960 Ga0207651_10033652 Ga0207651_100336524 120
178 3300025961 Ga0207712_10000007 Ga0207712_10000007433 120
179 3300025961 Ga0207712_10084764 Ga0207712_100847642 120
180 3300025961 Ga0207712_10168968 Ga0207712_101689682 120
181 3300025981 Ga0207640_10003186 Ga0207640_100031868 120
182 3300026023 Ga0207677_10000200 Ga0207677_1000020035 120
183 3300026035 Ga0207703_10000018 Ga0207703_1000001843 120
184 3300026035 Ga0207703_10000023 Ga0207703_1000002376 120
185 3300026041 Ga0207639_10070507 Ga0207639_100705073 120
186 3300026041 Ga0207639_10108827 Ga0207639_101088273 120
187 3300026075 Ga0207708_10146463 Ga0207708_101464632 120
188 3300026078 Ga0207702_10004125 Ga0207702_1000412512 120
189 3300026078 Ga0207702_10485326 Ga0207702_104853262 120
190 3300026078 Ga0207702_11458704 Ga0207702_114587042 120
191 3300026088 Ga0207641_10000238 Ga0207641_1000023875 120
192 3300026088 Ga0207641_10004805 Ga0207641_100048053 120
193 3300026089 Ga0207648_10008647 Ga0207648_100086474 120
194 3300026095 Ga0207676_10000195 Ga0207676_1000019534 120
195 3300026118 Ga0207675_100129425 Ga0207675_1001294252 120
196 3300026118 Ga0207675_100955456 Ga0207675_1009554562 120
197 3300026121 Ga0207683_10012162 Ga0207683_100121622 120
198 3300026121 Ga0207683_10507001 Ga0207683_105070012 120
199 3300028379 Ga0268266_10000047 Ga0268266_10000047166 120
200 3300028379 Ga0268266_10617569 Ga0268266_106175692 120
201 3300028379 Ga0268266_11037507 Ga0268266_110375071 120
202 3300028381 Ga0268264_10029949 Ga0268264_100299493 120
203 3300028381 Ga0268264_10404945 Ga0268264_104049452 120
204 3300028556 Ga0265337_1000807 Ga0265337_10008079 120
205 3300028573 Ga0265334_10072019 Ga0265334_100720193 120
206 3300028654 Ga0265322_10000001 Ga0265322_10000001380 120
207 3300029957 Ga0265324_10000755 Ga0265324_100007558 120
208 3300031238 Ga0265332_10089355 Ga0265332_100893553 120
209 3300031240 Ga0265320_10000002 Ga0265320_10000002379 120
210 3300031242 Ga0265329_10010994 Ga0265329_100109945 120
211 3300031249 Ga0265339_10040002 Ga0265339_100400023 120
212 3300031250 Ga0265331_10009837 Ga0265331_100098374 120
213 3300031251 Ga0265327_10000011 Ga0265327_10000011379 120
214 3300031456 Ga0307513_10422210 Ga0307513_104222103 120
215 3300031711 Ga0265314_10000062 Ga0265314_10000062113 120
216 3300031712 Ga0265342_10130167 Ga0265342_101301673 120
217 3300031727 Ga0316576_10002655 Ga0316576_100026559 120
218 3300031727 Ga0316576_10766085 Ga0316576_107660851 120
219 3300031728 Ga0316578_10272663 Ga0316578_102726632 120
220 3300032133 Ga0316583_10075817 Ga0316583_100758172 120
221 3300035117 Ga0373953_0537388 Ga0373953_0537388_147_509 120
222 3300035120 Ga0373957_0169454 Ga0373957_0169454_213_575 120
223 3300035172 Ga0373955_0131489 Ga0373955_0131489_970_1332 120
224 3300035398 Ga0316574_0007038 Ga0316574_0007038_131_493 120
225 3300035398 Ga0316574_0020608 Ga0316574_0020608_569_931 120
226 3300035398 Ga0316574_0769129 Ga0316574_0769129_192_554 120
227 3300035724 Ga0373933_0514565 Ga0373933_0514565_325_687 120
228 3300036401 Ga0373937_0065492 Ga0373937_0065492_1414_1776 120
229 3300036712 Ga0316584_0005290 Ga0316584_0005290_3615_3977 120
230 3300036712 Ga0316584_0361150 Ga0316584_0361150_277_639 120
231 3300041463 Ga0451804_1065570 Ga0451804_1065570_91_453 120
232 3300041505 Ga0451849_0214338 Ga0451849_0214338_103_465 120
233 3300041512 Ga0451853_2765288 Ga0451853_2765288_1112_1474 120
234 3300044694 Ga0466963_0000153 Ga0466963_0000153_6267_6629 120
235 3300044694 Ga0466963_0108599 Ga0466963_0108599_1514_1876 120
236 3300045976 Ga0466967_0006679 Ga0466967_0006679_7116_7478 120
237 3300045976 Ga0466967_0800594 Ga0466967_0800594_151_513 120
238 3300045976 Ga0466967_1069266 Ga0466967_1069266_392_754 120
239 3300046454 Ga0495592_0389916 Ga0495592_0389916_69_431 120
240 3300046455 Ga0495603_0001462 Ga0495603_0001462_3801_4163 120
241 3300046455 Ga0495603_0806219 Ga0495603_0806219_107_469 120
242 3300046459 Ga0495629_0000509 Ga0495629_0000509_853_1215 120
243 3300046459 Ga0495629_0045971 Ga0495629_0045971_2294_2656 120
244 3300046459 Ga0495629_0308837 Ga0495629_0308837_563_925 120
245 3300046460 Ga0495638_0016284 Ga0495638_0016284_4543_4905 120
246 3300046461 Ga0495641_0000228 Ga0495641_0000228_14510_14872 120
247 3300046461 Ga0495641_0542231 Ga0495641_0542231_54_416 120
248 3300046463 Ga0495653_0233765 Ga0495653_0233765_704_1066 120
249 3300046463 Ga0495653_0240081 Ga0495653_0240081_144_506 120
250 3300046463 Ga0495653_0417681 Ga0495653_0417681_175_537 120
251 3300046463 Ga0495653_0572655 Ga0495653_0572655_183_545 120
252 3300046463 Ga0495653_0592416 Ga0495653_0592416_202_564 120
253 3300046473 Ga0495582_0000726 Ga0495582_0000726_381_743 120
254 3300046476 Ga0495662_0028052 Ga0495662_0028052_2290_2658 120
255 3300046477 Ga0495664_0427419 Ga0495664_0427419_38_400 120
256 3300046511 Ga0495608_0000529 Ga0495608_0000529_24031_24393 120
257 3300046511 Ga0495608_0036783 Ga0495608_0036783_1848_2210 120
258 3300046514 Ga0495618_0204870 Ga0495618_0204870_749_1111 120
259 3300046514 Ga0495618_0378611 Ga0495618_0378611_254_616 120
260 3300046515 Ga0495620_0000824 Ga0495620_0000824_17478_17840 120
261 3300046516 Ga0495628_0009655 Ga0495628_0009655_4954_5316 120
262 3300046516 Ga0495628_0041865 Ga0495628_0041865_1441_1803 120
263 3300046516 Ga0495628_0080155 Ga0495628_0080155_385_804 120
264 3300046516 Ga0495628_0139014 Ga0495628_0139014_375_737 120
265 3300046516 Ga0495628_0376004 Ga0495628_0376004_125_487 120
266 3300046516 Ga0495628_0498713 Ga0495628_0498713_476_838 120
267 3300046517 Ga0495630_0009440 Ga0495630_0009440_2045_2407 120
268 3300046517 Ga0495630_0085507 Ga0495630_0085507_554_916 120
269 3300046517 Ga0495630_0544007 Ga0495630_0544007_366_728 120
270 3300046523 Ga0495644_0014524 Ga0495644_0014524_1373_1735 120
271 3300046523 Ga0495644_0244209 Ga0495644_0244209_261_623 120
272 3300046529 Ga0495652_0000407 Ga0495652_0000407_24663_25025 120
273 3300046529 Ga0495652_0045375 Ga0495652_0045375_1573_1935 120
274 3300046529 Ga0495652_0254272 Ga0495652_0254272_912_1274 120
275 3300046533 Ga0495640_0036783 Ga0495640_0036783_2644_3006 120
276 3300046533 Ga0495640_0091005 Ga0495640_0091005_434_802 120
277 3300046535 Ga0495586_0021614 Ga0495586_0021614_2624_2986 120
278 3300046535 Ga0495586_0305432 Ga0495586_0305432_413_781 120
279 3300046536 Ga0495587_0047777 Ga0495587_0047777_1962_2369 120
280 3300046536 Ga0495587_0532161 Ga0495587_0532161_57_419 120
281 3300046537 Ga0495598_0002610 Ga0495598_0002610_2600_2962 120
282 3300046539 Ga0495621_0006858 Ga0495621_0006858_1564_1926 120
283 3300046539 Ga0495621_0066218 Ga0495621_0066218_536_898 120
284 3300046543 Ga0495645_0006445 Ga0495645_0006445_6192_6554 120
285 3300046543 Ga0495645_0019986 Ga0495645_0019986_2035_2397 120
286 3300046559 Ga0495667_0074568 Ga0495667_0074568_1361_1723 120
287 3300046642 Ga0495634_0000059 Ga0495634_0000059_51759_52121 120
288 3300046642 Ga0495634_0015499 Ga0495634_0015499_2696_3058 120
289 3300046642 Ga0495634_0253327 Ga0495634_0253327_418_780 120
290 3300046642 Ga0495634_0349180 Ga0495634_0349180_72_440 120
291 3300046642 Ga0495634_0552366 Ga0495634_0552366_199_561 120
292 3300046660 Ga0495625_0000756 Ga0495625_0000756_3327_3689 120
293 3300046663 Ga0495635_0124963 Ga0495635_0124963_899_1261 120
294 3300046663 Ga0495635_0220008 Ga0495635_0220008_45_407 120
295 3300046663 Ga0495635_0312271 Ga0495635_0312271_57_419 120
296 3300046663 Ga0495635_0587810 Ga0495635_0587810_159_521 120
297 3300046663 Ga0495635_0944979 Ga0495635_0944979_117_479 120
298 3300046675 Ga0495657_0051214 Ga0495657_0051214_2359_2721 120
299 3300046678 Ga0495599_0018403 Ga0495599_0018403_2140_2502 120
300 3300046678 Ga0495599_0074998 Ga0495599_0074998_1156_1518 120
301 3300046679 Ga0495623_0383476 Ga0495623_0383476_348_710 120
302 3300046679 Ga0495623_0723111 Ga0495623_0723111_96_458 120
303 3300046680 Ga0495646_0174008 Ga0495646_0174008_485_847 120
304 3300046680 Ga0495646_0381400 Ga0495646_0381400_161_523 120
305 3300046681 Ga0495647_0009525 Ga0495647_0009525_354_716 120
306 3300046683 Ga0495658_0000034 Ga0495658_0000034_51404_51766 120
307 3300046683 Ga0495658_1079639 Ga0495658_1079639_107_469 120
308 3300046684 Ga0495669_0000310 Ga0495669_0000310_284_646 120
309 3300046689 Ga0495613_0004320 Ga0495613_0004320_7550_7918 120
310 3300046689 Ga0495613_0071867 Ga0495613_0071867_264_626 120
311 3300046689 Ga0495613_0123022 Ga0495613_0123022_711_1073 120
312 3300046690 Ga0495624_0002509 Ga0495624_0002509_6184_6600 120
313 3300046691 Ga0495670_0019959 Ga0495670_0019959_389_751 120
314 3300046694 Ga0495649_0008541 Ga0495649_0008541_1711_2073 120
315 3300046809 Ga0495600_0457452 Ga0495600_0457452_14_433 120
316 3300047315 Ga0495581_0036815 Ga0495581_0036815_2418_2780 120
317 3300047317 Ga0495604_0000055 Ga0495604_0000055_62309_62671 120
318 3300047319 Ga0495674_0000064 Ga0495674_0000064_44010_44372 120
319 3300047319 Ga0495674_0112482 Ga0495674_0112482_365_727 120
320 3300047319 Ga0495674_0295826 Ga0495674_0295826_891_1253 120
321 3300047320 Ga0495672_0215233 Ga0495672_0215233_52_414 120
322 3300047321 Ga0495676_0000130 Ga0495676_0000130_21422_21784 120
323 3300047321 Ga0495676_0011318 Ga0495676_0011318_7319_7681 120
324 3300047322 Ga0495680_0000550 Ga0495680_0000550_30589_30957 120
325 3300047322 Ga0495680_0029878 Ga0495680_0029878_2649_3011 120
326 3300047322 Ga0495680_0143515 Ga0495680_0143515_1005_1367 120
327 3300047446 Ga0495679_010145 Ga0495679_010145_2343_2705 120
328 3300047469 Ga0495673_0020669 Ga0495673_0020669_373_735 120
329 3300047472 Ga0495686_0034255 Ga0495686_0034255_2188_2550 120
330 3300047472 Ga0495686_0082686 Ga0495686_0082686_548_910 120
331 3300048088 Ga0495602_0013815 Ga0495602_0013815_1935_2297 120
332 3300048088 Ga0495602_0215823 Ga0495602_0215823_35_397 120
333 3300048903 Ga0496100_0000002 Ga0496100_0000002_438002_438364 120
334 3300048903 Ga0496100_0000005 Ga0496100_0000005_270555_270917 120
335 3300048904 Ga0496101_0000001 Ga0496101_0000001_438002_438364 120
336 3300048904 Ga0496101_0000101 Ga0496101_0000101_60137_60499 120
337 3300048905 Ga0496102_0000115 Ga0496102_0000115_99275_99637 120
338 3300048905 Ga0496102_0117114 Ga0496102_0117114_311_673 120
339 3300048906 Ga0496103_0000008 Ga0496103_0000008_106300_106662 120
340 3300048906 Ga0496103_0072055 Ga0496103_0072055_149_511 120
341 3300048907 Ga0496104_0000004 Ga0496104_0000004_357029_357391 120
342 3300048907 Ga0496104_0000009 Ga0496104_0000009_296327_296689 120
343 3300048907 Ga0496104_0006952 Ga0496104_0006952_1971_2333 120
344 3300048907 Ga0496104_1628535 Ga0496104_1628535_122_484 120
345 3300048908 Ga0496105_0000001 Ga0496105_0000001_284440_284802 120
346 3300048908 Ga0496105_0000007 Ga0496105_0000007_191367_191729 120
347 3300048908 Ga0496105_0000650 Ga0496105_0000650_1413_1775 120
348 3300048908 Ga0496105_0440104 Ga0496105_0440104_346_708 120
349 3300048909 Ga0496106_0000084 Ga0496106_0000084_50666_51028 120
350 3300048909 Ga0496106_0000151 Ga0496106_0000151_11366_11728 120
351 3300048909 Ga0496106_0000682 Ga0496106_0000682_8748_9110 120
352 3300048909 Ga0496106_0685917 Ga0496106_0685917_177_539 120
353 3300048910 Ga0496107_0000003 Ga0496107_0000003_86745_87107 120
354 3300048910 Ga0496107_0000011 Ga0496107_0000011_40966_41328 120
355 3300048910 Ga0496107_0761173 Ga0496107_0761173_282_644 120
356 3300048910 Ga0496107_1153170 Ga0496107_1153170_184_546 120
357 3300048911 Ga0496108_0000001 Ga0496108_0000001_733498_733860 120
358 3300048911 Ga0496108_0029134 Ga0496108_0029134_1718_2080 120
359 3300048912 Ga0496109_0000003 Ga0496109_0000003_408044_408406 120
360 3300048912 Ga0496109_0071967 Ga0496109_0071967_2438_2800 120
361 3300048912 Ga0496109_0405406 Ga0496109_0405406_454_816 120
362 3300048913 Ga0496110_0004679 Ga0496110_0004679_8730_9092 120
363 3300048913 Ga0496110_0023867 Ga0496110_0023867_4192_4554 120
364 3300048913 Ga0496110_0804744 Ga0496110_0804744_321_722 120
365 3300048914 Ga0496111_0148570 Ga0496111_0148570_1359_1721 120
366 3300048915 Ga0496112_0000006 Ga0496112_0000006_277302_277664 120
367 3300048915 Ga0496112_0115785 Ga0496112_0115785_1167_1529 120
368 3300048916 Ga0496113_0062416 Ga0496113_0062416_2084_2446 120
369 3300048916 Ga0496113_0130971 Ga0496113_0130971_1558_1920 120
370 3300048916 Ga0496113_0162284 Ga0496113_0162284_1141_1503 120
371 3300048916 Ga0496113_0232221 Ga0496113_0232221_1052_1414 120
372 3300048916 Ga0496113_0475892 Ga0496113_0475892_621_983 120
373 3300048916 Ga0496113_0761794 Ga0496113_0761794_295_657 120
374 3300048917 Ga0496114_0000101 Ga0496114_0000101_25838_26200 120
375 3300048917 Ga0496114_0012931 Ga0496114_0012931_1707_2069 120
376 3300048918 Ga0496115_0000200 Ga0496115_0000200_29556_29918 120
377 3300048919 Ga0496116_0000735 Ga0496116_0000735_14182_14544 120
378 3300048920 Ga0496117_0004253 Ga0496117_0004253_10809_11171 120
379 3300048921 Ga0496118_0000833 Ga0496118_0000833_5706_6068 120
380 3300048921 Ga0496118_0093077 Ga0496118_0093077_148_510 120
381 3300048922 Ga0496119_0001290 Ga0496119_0001290_3405_3767 120
382 3300048922 Ga0496119_0029762 Ga0496119_0029762_1950_2312 120
383 3300048922 Ga0496119_0045975 Ga0496119_0045975_737_1099 120
384 3300048923 Ga0496120_0018289 Ga0496120_0018289_1749_2111 120
385 3300048928 Ga0496125_0096337 Ga0496125_0096337_101_463 120
386 3300048928 Ga0496125_0226274 Ga0496125_0226274_463_825 120
387 3300049460 Ga0495682_0135854 Ga0495682_0135854_427_789 120
388 3300049578 Ga0501042_0010369 Ga0501042_0010369_978_1340 120
389 3300049583 Ga0501067_0401802 Ga0501067_0401802_18_380 120
390 3300049585 Ga0501069_0575485 Ga0501069_0575485_81_443 120
391 3300049586 Ga0501070_0017909 Ga0501070_0017909_3541_3903 120
392 3300049590 Ga0501074_0432959 Ga0501074_0432959_20_382 120
393 3300049591 Ga0501075_0407095 Ga0501075_0407095_291_653 120
394 3300049592 Ga0501076_0076196 Ga0501076_0076196_322_684 120
395 3300049744 Ga0501083_0723119 Ga0501083_0723119_35_397 120
396 3300049823 Ga0501044_0545721 Ga0501044_0545721_133_495 120
397 3300050491 nmdc:mga00v17_78423_c1 nmdc:mga00v17_78423_c1_1359_1721 120
398 3300050491 nmdc:mga00v17_99393_c1 nmdc:mga00v17_99393_c1_264_626 120
399 3300050509 nmdc:mga0qj67_158633_c1 nmdc:mga0qj67_158633_c1_1362_1724 120
400 3300053077 Ga0495601_0000855 Ga0495601_0000855_15544_15906 120
401 3300053077 Ga0495601_0039086 Ga0495601_0039086_1791_2153 120
402 3300053077 Ga0495601_0085532 Ga0495601_0085532_671_1033 120
403 3300053077 Ga0495601_0198319 Ga0495601_0198319_508_870 120
404 3300053077 Ga0495601_0203682 Ga0495601_0203682_338_700 120
405 3300053077 Ga0495601_0334959 Ga0495601_0334959_82_444 120
406 3300053077 Ga0495601_0643775 Ga0495601_0643775_70_432 120
407 3300053078 Ga0495612_0000164 Ga0495612_0000164_21526_21888 120
408 3300053078 Ga0495612_0012980 Ga0495612_0012980_1344_1706 120
409 3300053078 Ga0495612_0084713 Ga0495612_0084713_700_1062 120
410 3300053078 Ga0495612_0250617 Ga0495612_0250617_208_570 120
411 3300053078 Ga0495612_0412231 Ga0495612_0412231_182_544 120
412 3300053083 Ga0495655_0000001 Ga0495655_0000001_295263_295625 120
413 3300053084 Ga0495595_0156854 Ga0495595_0156854_637_999 120
414 3300053085 Ga0495619_0000025 Ga0495619_0000025_128838_129200 120
415 3300053085 Ga0495619_0000157 Ga0495619_0000157_31945_32307 120
416 3300053085 Ga0495619_0001204 Ga0495619_0001204_12355_12717 120
417 3300053085 Ga0495619_0003131 Ga0495619_0003131_6402_6764 120
418 3300053085 Ga0495619_0044114 Ga0495619_0044114_1049_1411 120
419 3300053085 Ga0495619_0268201 Ga0495619_0268201_112_474 120
420 3300053094 Ga0500566_0022439 Ga0500566_0022439_2975_3337 120
421 3300053094 Ga0500566_0075425 Ga0500566_0075425_160_522 120
422 3300053096 Ga0500641_0208742 Ga0500641_0208742_389_751 120
423 3300053111 Ga0500572_076874 Ga0500572_076874_491_853 120
424 3300053119 Ga0500595_054701 Ga0500595_054701_161_523 120
425 3300053119 Ga0500595_057063 Ga0500595_057063_96_458 120
426 3300053123 Ga0500614_001338 Ga0500614_001338_986_1348 120
427 3300053129 Ga0500628_000033 Ga0500628_000033_47294_47656 120
428 3300053139 Ga0500568_0060755 Ga0500568_0060755_233_595 120
429 3300054114 Ga0501084_1534596 Ga0501084_1534596_32_394 120
430 3300060353 Ga0501082_0302140 Ga0501082_0302140_996_1358 120
431 3300060353 Ga0501082_1720997 Ga0501082_1720997_139_501 120
432 3300000546 LJNas_1036030 LJNas_10360302 121
433 3300002070 JGI24750J21931_1084678 JGI24750J21931_10846781 121
434 3300005327 Ga0070658_10017126 Ga0070658_100171264 121
435 3300005329 Ga0070683_100012149 Ga0070683_1000121497 121
436 3300005329 Ga0070683_100012949 Ga0070683_1000129496 121
437 3300005329 Ga0070683_100453654 Ga0070683_1004536542 121
438 3300005331 Ga0070670_100193620 Ga0070670_1001936202 121
439 3300005335 Ga0070666_10028671 Ga0070666_100286714 121
440 3300005336 Ga0070680_100271909 Ga0070680_1002719092 121
441 3300005337 Ga0070682_102086806 Ga0070682_1020868061 121
442 3300005344 Ga0070661_100000102 Ga0070661_10000010222 121
443 3300005347 Ga0070668_100316507 Ga0070668_1003165072 121
444 3300005347 Ga0070668_101449615 Ga0070668_1014496151 121
445 3300005354 Ga0070675_100000027 Ga0070675_10000002742 121
446 3300005365 Ga0070688_100000738 Ga0070688_10000073812 121
447 3300005365 Ga0070688_100003810 Ga0070688_1000038108 121
448 3300005367 Ga0070667_100140750 Ga0070667_1001407503 121
449 3300005367 Ga0070667_100253940 Ga0070667_1002539402 121
450 3300005367 Ga0070667_100400187 Ga0070667_1004001872 121
451 3300005435 Ga0070714_100029758 Ga0070714_1000297585 121
452 3300005436 Ga0070713_100000085 Ga0070713_10000008519 121
453 3300005436 Ga0070713_100094192 Ga0070713_1000941922 121
454 3300005439 Ga0070711_100856043 Ga0070711_1008560431 121
455 3300005455 Ga0070663_100024055 Ga0070663_1000240554 121
456 3300005456 Ga0070678_100052362 Ga0070678_1000523623 121
457 3300005456 Ga0070678_101218876 Ga0070678_1012188762 121
458 3300005466 Ga0070685_10000141 Ga0070685_1000014147 121
459 3300005466 Ga0070685_10000616 Ga0070685_1000061618 121
460 3300005466 Ga0070685_10690849 Ga0070685_106908492 121
461 3300005535 Ga0070684_100078721 Ga0070684_1000787214 121
462 3300005535 Ga0070684_100172790 Ga0070684_1001727902 121
463 3300005539 Ga0068853_100346137 Ga0068853_1003461373 121
464 3300005539 Ga0068853_101225435 Ga0068853_1012254351 121
465 3300005543 Ga0070672_100001367 Ga0070672_1000013678 121
466 3300005544 Ga0070686_100326268 Ga0070686_1003262681 121
467 3300005548 Ga0070665_100000950 Ga0070665_10000095029 121
468 3300005548 Ga0070665_100076910 Ga0070665_1000769103 121
469 3300005548 Ga0070665_100102705 Ga0070665_1001027052 121
470 3300005548 Ga0070665_101702637 Ga0070665_1017026372 121
471 3300005563 Ga0068855_100456315 Ga0068855_1004563153 121
472 3300005563 Ga0068855_101875267 Ga0068855_1018752672 121
473 3300005564 Ga0070664_100168855 Ga0070664_1001688551 121
474 3300005577 Ga0068857_100504968 Ga0068857_1005049682 121
475 3300005614 Ga0068856_100000629 Ga0068856_1000006298 121
476 3300005614 Ga0068856_100009027 Ga0068856_1000090277 121
477 3300005614 Ga0068856_100251724 Ga0068856_1002517242 121
478 3300005616 Ga0068852_100000006 Ga0068852_100000006141 121
479 3300005842 Ga0068858_100701468 Ga0068858_1007014682 121
480 3300005843 Ga0068860_100073002 Ga0068860_1000730024 121
481 3300005844 Ga0068862_100004868 Ga0068862_1000048685 121
482 3300005937 Ga0081455_10030774 Ga0081455_100307745 121
483 3300006175 Ga0070712_100003543 Ga0070712_1000035432 121
484 3300006846 Ga0075430_101640040 Ga0075430_1016400402 121
485 3300009093 Ga0105240_10341878 Ga0105240_103418782 121
486 3300009098 Ga0105245_10000254 Ga0105245_1000025413 121
487 3300009101 Ga0105247_10046632 Ga0105247_100466324 121
488 3300009101 Ga0105247_10057391 Ga0105247_100573912 121
489 3300009101 Ga0105247_10793144 Ga0105247_107931442 121
490 3300009148 Ga0105243_10461670 Ga0105243_104616703 121
491 3300009174 Ga0105241_10493297 Ga0105241_104932973 121
492 3300009176 Ga0105242_11007705 Ga0105242_110077051 121
493 3300009177 Ga0105248_10000008 Ga0105248_10000008301 121
494 3300009177 Ga0105248_10464002 Ga0105248_104640023 121
495 3300009545 Ga0105237_10854796 Ga0105237_108547962 121
496 3300009553 Ga0105249_10122790 Ga0105249_101227904 121
497 3300010375 Ga0105239_10513843 Ga0105239_105138432 121
498 3300010375 Ga0105239_11372476 Ga0105239_113724762 121
499 3300013104 Ga0157370_11273517 Ga0157370_112735172 121
500 3300013105 Ga0157369_10000020 Ga0157369_10000020182 121
501 3300013105 Ga0157369_11180353 Ga0157369_111803532 121
502 3300013297 Ga0157378_10011377 Ga0157378_100113779 121
503 3300013297 Ga0157378_10262517 Ga0157378_102625173 121
504 3300013306 Ga0163162_10900834 Ga0163162_109008342 121
505 3300013308 Ga0157375_10064237 Ga0157375_100642374 121
506 3300014325 Ga0163163_10457811 Ga0163163_104578112 121
507 3300014325 Ga0163163_11613329 Ga0163163_116133291 121
508 3300014325 Ga0163163_11971430 Ga0163163_119714301 121
509 3300014968 Ga0157379_10072798 Ga0157379_100727982 121
510 3300014968 Ga0157379_11103525 Ga0157379_111035252 121
511 3300014969 Ga0157376_10302501 Ga0157376_103025013 121
512 3300017792 Ga0163161_10129034 Ga0163161_101290343 121
513 3300025321 Ga0207656_10059181 Ga0207656_100591813 121
514 3300025900 Ga0207710_10247242 Ga0207710_102472421 121
515 3300025903 Ga0207680_10006139 Ga0207680_100061395 121
516 3300025903 Ga0207680_10143700 Ga0207680_101437002 121
517 3300025906 Ga0207699_10709332 Ga0207699_107093322 121
518 3300025909 Ga0207705_10032908 Ga0207705_100329083 121
519 3300025911 Ga0207654_10600706 Ga0207654_106007062 121
520 3300025912 Ga0207707_10255808 Ga0207707_102558082 121
521 3300025913 Ga0207695_10280162 Ga0207695_102801623 121
522 3300025915 Ga0207693_10015289 Ga0207693_100152896 121
523 3300025916 Ga0207663_10380579 Ga0207663_103805791 121
524 3300025917 Ga0207660_11023398 Ga0207660_110233982 121
525 3300025918 Ga0207662_11314574 Ga0207662_113145742 121
526 3300025920 Ga0207649_10000009 Ga0207649_10000009230 121
527 3300025921 Ga0207652_10009957 Ga0207652_100099572 121
528 3300025925 Ga0207650_10134897 Ga0207650_101348973 121
529 3300025926 Ga0207659_10000010 Ga0207659_1000001057 121
530 3300025927 Ga0207687_10000007 Ga0207687_10000007439 121
531 3300025928 Ga0207700_10000027 Ga0207700_1000002747 121
532 3300025928 Ga0207700_10018207 Ga0207700_100182072 121
533 3300025929 Ga0207664_10568183 Ga0207664_105681832 121
534 3300025935 Ga0207709_10387917 Ga0207709_103879171 121
535 3300025940 Ga0207691_10003586 Ga0207691_1000358611 121
536 3300025941 Ga0207711_10000006 Ga0207711_10000006695 121
537 3300025941 Ga0207711_10321951 Ga0207711_103219511 121
538 3300025941 Ga0207711_10503612 Ga0207711_105036122 121
539 3300025944 Ga0207661_10000253 Ga0207661_1000025332 121
540 3300025944 Ga0207661_10000347 Ga0207661_1000034731 121
541 3300025944 Ga0207661_10019993 Ga0207661_100199935 121
542 3300025944 Ga0207661_10147525 Ga0207661_101475252 121
543 3300025945 Ga0207679_10254057 Ga0207679_102540571 121
544 3300025949 Ga0207667_10412911 Ga0207667_104129113 121
545 3300025949 Ga0207667_11020873 Ga0207667_110208732 121
546 3300025961 Ga0207712_10096858 Ga0207712_100968582 121
547 3300025972 Ga0207668_10026773 Ga0207668_100267734 121
548 3300025972 Ga0207668_11136590 Ga0207668_111365902 121
549 3300025986 Ga0207658_10002826 Ga0207658_100028265 121
550 3300025986 Ga0207658_10105875 Ga0207658_101058753 121
551 3300026023 Ga0207677_10018605 Ga0207677_100186055 121
552 3300026035 Ga0207703_11268719 Ga0207703_112687191 121
553 3300026041 Ga0207639_10318358 Ga0207639_103183583 121
554 3300026041 Ga0207639_11157892 Ga0207639_111578922 121
555 3300026067 Ga0207678_10006053 Ga0207678_1000605311 121
556 3300026078 Ga0207702_10000158 Ga0207702_1000015870 121
557 3300026078 Ga0207702_10300350 Ga0207702_103003502 121
558 3300026116 Ga0207674_10255185 Ga0207674_102551853 121
559 3300026121 Ga0207683_10004283 Ga0207683_100042836 121
560 3300026142 Ga0207698_10000013 Ga0207698_1000001348 121
561 3300028379 Ga0268266_10000595 Ga0268266_1000059542 121
562 3300028379 Ga0268266_10006385 Ga0268266_100063857 121
563 3300028379 Ga0268266_10129548 Ga0268266_101295482 121
564 3300028379 Ga0268266_10413967 Ga0268266_104139673 121
565 3300028380 Ga0268265_10069595 Ga0268265_100695951 121
566 3300028381 Ga0268264_10282597 Ga0268264_102825972 121
567 3300028563 Ga0265319_1000020 Ga0265319_1000020139 121
568 3300028800 Ga0265338_10001248 Ga0265338_100012482 121
569 3300031241 Ga0265325_10027972 Ga0265325_100279723 121
570 3300031250 Ga0265331_10039701 Ga0265331_100397012 121
571 3300032126 Ga0307415_100025696 Ga0307415_1000256962 121
572 3300041486 Ga0451807_2677790 Ga0451807_2677790_157_522 121
573 3300044694 Ga0466963_0111154 Ga0466963_0111154_1315_1683 121
574 3300044694 Ga0466963_1096648 Ga0466963_1096648_85_453 121
575 3300045976 Ga0466967_0000009 Ga0466967_0000009_119332_119703 121
576 3300045976 Ga0466967_1166160 Ga0466967_1166160_334_699 121
577 3300046459 Ga0495629_0003113 Ga0495629_0003113_6022_6393 121
578 3300046507 Ga0495606_0000072 Ga0495606_0000072_21149_21520 121
579 3300046511 Ga0495608_0000060 Ga0495608_0000060_1944_2315 121
580 3300046517 Ga0495630_0000020 Ga0495630_0000020_92289_92660 121
581 3300046660 Ga0495625_0253451 Ga0495625_0253451_475_846 121
582 3300046660 Ga0495625_0367777 Ga0495625_0367777_171_536 121
583 3300046674 Ga0495588_0000134 Ga0495588_0000134_24051_24422 121
584 3300046675 Ga0495657_0000004 Ga0495657_0000004_180220_180591 121
585 3300046681 Ga0495647_0000156 Ga0495647_0000156_14322_14693 121
586 3300046689 Ga0495613_0000801 Ga0495613_0000801_21077_21448 121
587 3300046809 Ga0495600_0056445 Ga0495600_0056445_1875_2246 121
588 3300046810 Ga0495660_0238943 Ga0495660_0238943_145_516 121
589 3300047317 Ga0495604_0000137 Ga0495604_0000137_57962_58333 121
590 3300047320 Ga0495672_0063979 Ga0495672_0063979_291_662 121
591 3300047320 Ga0495672_0157717 Ga0495672_0157717_745_1116 121
592 3300047444 Ga0495675_0000040 Ga0495675_0000040_60_431 121
593 3300048088 Ga0495602_0000041 Ga0495602_0000041_69680_70051 121
594 3300048088 Ga0495602_0231405 Ga0495602_0231405_981_1352 121
595 3300048088 Ga0495602_0608090 Ga0495602_0608090_250_621 121
596 3300048903 Ga0496100_0182269 Ga0496100_0182269_838_1203 121
597 3300048904 Ga0496101_0281939 Ga0496101_0281939_267_632 121
598 3300048906 Ga0496103_0224914 Ga0496103_0224914_580_945 121
599 3300048907 Ga0496104_0008811 Ga0496104_0008811_5619_5984 121
600 3300048907 Ga0496104_1293504 Ga0496104_1293504_236_607 121
601 3300048907 Ga0496104_1663565 Ga0496104_1663565_149_517 121
602 3300048908 Ga0496105_0142503 Ga0496105_0142503_678_1043 121
603 3300048911 Ga0496108_0000175 Ga0496108_0000175_3058_3426 121
604 3300048911 Ga0496108_0068044 Ga0496108_0068044_1227_1598 121
605 3300048911 Ga0496108_0603839 Ga0496108_0603839_468_833 121
606 3300048912 Ga0496109_0000121 Ga0496109_0000121_3050_3418 121
607 3300048912 Ga0496109_0000249 Ga0496109_0000249_36387_36758 121
608 3300048913 Ga0496110_0007407 Ga0496110_0007407_5563_5934 121
609 3300048913 Ga0496110_0897091 Ga0496110_0897091_317_688 121
610 3300048914 Ga0496111_0019839 Ga0496111_0019839_3442_3813 121
611 3300048914 Ga0496111_0349392 Ga0496111_0349392_53_418 121
612 3300048917 Ga0496114_0150349 Ga0496114_0150349_1146_1511 121
613 3300048917 Ga0496114_0349469 Ga0496114_0349469_48_419 121
614 3300048917 Ga0496114_0903270 Ga0496114_0903270_320_691 121
615 3300048921 Ga0496118_0350948 Ga0496118_0350948_368_739 121
616 3300048922 Ga0496119_0006046 Ga0496119_0006046_6052_6417 121
617 3300048924 Ga0496121_0151636 Ga0496121_0151636_1200_1565 121
618 3300048927 Ga0496124_0030661 Ga0496124_0030661_502_867 121
619 3300048928 Ga0496125_0064038 Ga0496125_0064038_1922_2287 121
620 3300048929 Ga0496126_0087237 Ga0496126_0087237_1124_1489 121
621 3300048929 Ga0496126_0090832 Ga0496126_0090832_1043_1408 121
622 3300048929 Ga0496126_0129957 Ga0496126_0129957_340_705 121
623 3300049568 Ga0501031_0003265 Ga0501031_0003265_574_939 121
624 3300049569 Ga0501032_0004103 Ga0501032_0004103_505_870 121
625 3300049570 Ga0501033_0000900 Ga0501033_0000900_17279_17644 121
626 3300049571 Ga0501034_0202876 Ga0501034_0202876_491_856 121
627 3300049571 Ga0501034_0628349 Ga0501034_0628349_395_760 121
628 3300049572 Ga0501036_0044867 Ga0501036_0044867_476_841 121
629 3300049573 Ga0501037_0004199 Ga0501037_0004199_9446_9811 121
630 3300049574 Ga0501038_0007149 Ga0501038_0007149_474_839 121
631 3300049575 Ga0501039_0011339 Ga0501039_0011339_5952_6317 121
632 3300049576 Ga0501040_0300169 Ga0501040_0300169_427_792 121
633 3300049578 Ga0501042_0208861 Ga0501042_0208861_830_1201 121
634 3300049578 Ga0501042_0396399 Ga0501042_0396399_158_523 121
635 3300049579 Ga0501043_0010751 Ga0501043_0010751_6302_6667 121
636 3300049579 Ga0501043_0376583 Ga0501043_0376583_667_1032 121
637 3300049580 Ga0501046_0006462 Ga0501046_0006462_469_834 121
638 3300049581 Ga0501047_0058444 Ga0501047_0058444_497_862 121
639 3300049581 Ga0501047_0330649 Ga0501047_0330649_658_1023 121
640 3300049582 Ga0501048_0004528 Ga0501048_0004528_9740_10105 121
641 3300049582 Ga0501048_0188340 Ga0501048_0188340_489_854 121
642 3300049583 Ga0501067_0143109 Ga0501067_0143109_119_484 121
643 3300049584 Ga0501068_0218015 Ga0501068_0218015_410_775 121
644 3300049585 Ga0501069_0005540 Ga0501069_0005540_300_665 121
645 3300049585 Ga0501069_0301684 Ga0501069_0301684_485_850 121
646 3300049586 Ga0501070_0000680 Ga0501070_0000680_9500_9865 121
647 3300049586 Ga0501070_0446943 Ga0501070_0446943_191_556 121
648 3300049587 Ga0501071_0029507 Ga0501071_0029507_3072_3437 121
649 3300049588 Ga0501072_1207496 Ga0501072_1207496_82_447 121
650 3300049589 Ga0501073_0004593 Ga0501073_0004593_9512_9877 121
651 3300049590 Ga0501074_0043778 Ga0501074_0043778_2515_2880 121
652 3300049590 Ga0501074_0587874 Ga0501074_0587874_408_773 121
653 3300049741 Ga0501079_0004743 Ga0501079_0004743_419_784 121
654 3300049741 Ga0501079_0012155 Ga0501079_0012155_4593_4958 121
655 3300049742 Ga0501080_0298518 Ga0501080_0298518_616_981 121
656 3300049742 Ga0501080_0684506 Ga0501080_0684506_256_621 121
657 3300049744 Ga0501083_0031048 Ga0501083_0031048_1615_1980 121
658 3300049744 Ga0501083_0040357 Ga0501083_0040357_2346_2711 121
659 3300049822 Ga0501035_0000887 Ga0501035_0000887_21228_21593 121
660 3300049823 Ga0501044_0009237 Ga0501044_0009237_617_982 121
661 3300049823 Ga0501044_0067858 Ga0501044_0067858_2113_2478 121
662 3300049824 Ga0501045_0080074 Ga0501045_0080074_1516_1881 121
663 3300053077 Ga0495601_0000013 Ga0495601_0000013_21665_22036 121
664 3300053077 Ga0495601_0210744 Ga0495601_0210744_77_445 121
665 3300053078 Ga0495612_0006025 Ga0495612_0006025_1775_2146 121
666 3300053083 Ga0495655_0011759 Ga0495655_0011759_107_475 121
667 3300053084 Ga0495595_0000003 Ga0495595_0000003_180220_180591 121
668 3300053085 Ga0495619_0000116 Ga0495619_0000116_26987_27358 121
669 3300053087 Ga0500643_213611 Ga0500643_213611_100_465 121
670 3300060353 Ga0501082_0517109 Ga0501082_0517109_570_935 121

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u2d-assembly2.cif.gz_C pmtcd peptide exporter basket domain 0.6708 22 92
6u2d-assembly2.cif.gz_C pmtcd peptide exporter basket domain 0.6534 22 92
4zoq-assembly1.cif.gz_A crystal structure of a lanthipeptide protease 0.6389 23 89
6xfu-assembly1.cif.gz_B pmtcd peptide exporter basket domain 0.6211 22 93
7r2y-assembly1.cif.gz_C carbon regulatory pii-like protein sbtb from synechocystis sp. 6803 in complex with atp resulting from short atp soak, conflicting t-loop and c-loop with partial occupancy 0.6147 19 92
ID Description Score Start End Superfamily
4oloB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.633 23 84 3.30.70.1710
2fgcA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6305 21 101 3.30.70.1150
af_O13869_338_419_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.6204 22 90 3.30.70.870
2fgcA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6176 21 101 3.30.70.1150
af_O14179_173_246_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.617 21 99 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A7W0NIP1-F1-model_v4 Uncharacterized protein 0.9268 1 96
AF-A0A7W0Q0U9-F1-model_v4 Uncharacterized protein 0.9203 3 99
AF-A0A7V9CRW9-F1-model_v4 Uncharacterized protein 0.9182 1 101
AF-A0A7W1BRJ4-F1-model_v4 Uncharacterized protein 0.9003 1 96
AF-A0A7V9KXI2-F1-model_v4 Uncharacterized protein 0.8982 1 102

Feature Viewer

pLDDT pTM Quality
85.71 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map