F474083
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 321 | 670 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_11613329|Ga0163163_116133291 |
| Length | 139 |
| Sequence | MCLEEVTRPLLYASSFMPLAADFQQILDSLPPDWTDLEVDVRIEDESQYVDSAVAVSQVNAQVYQHPHQEGWHWRLLIAKSFGHAAAPESVRGVLEKLDADDVAGELRVAEVREGRSEVVQMWGRPESVREEFRERRSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 175 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 318 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 319 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 10.6 |
| Rhizosphere | 84.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1036030 | 3300000546 | Unclassified | 535 |
| 2 | JGI24746J21847_1000470 | 3300001977 | Bacteria | 6029 |
| 3 | JGI24740J21852_10003186 | 3300001979 | Bacteria | 7243 |
| 4 | JGI24750J21931_1084678 | 3300002070 | Bacteria | 531 |
| 5 | JGI24748J21848_1000663 | 3300002074 | Bacteria | 3705 |
| 6 | JGI24034J26672_10000455 | 3300002239 | Bacteria | 5287 |
| 7 | JGI24742J22300_10033543 | 3300002244 | Bacteria | 902 |
| 8 | JGI24751J29686_10100313 | 3300002459 | Unclassified | 604 |
| 9 | JGI25406J46586_10045753 | 3300003203 | Bacteria | 1504 |
| 10 | JGI25404J52841_10010894 | 3300003659 | Bacteria | 1956 |
| 11 | Ga0070658_10017126 | 3300005327 | Bacteria | 5799 |
| 12 | Ga0070683_100003109 | 3300005329 | Bacteria | 13374 |
| 13 | Ga0070683_100012149 | 3300005329 | Bacteria | 7473 |
| 14 | Ga0070683_100012949 | 3300005329 | Bacteria | 7260 |
| 15 | Ga0070683_100085314 | 3300005329 | Bacteria | 2960 |
| 16 | Ga0070683_100453654 | 3300005329 | Bacteria | 1223 |
| 17 | Ga0070670_100193620 | 3300005331 | Bacteria | 1766 |
| 18 | Ga0070677_10000022 | 3300005333 | Bacteria | 45355 |
| 19 | Ga0070666_10028671 | 3300005335 | Bacteria | 3654 |
| 20 | Ga0070680_100149554 | 3300005336 | Bacteria | 1960 |
| 21 | Ga0070680_100271909 | 3300005336 | Bacteria | 1435 |
| 22 | Ga0070682_100000099 | 3300005337 | Bacteria | 77574 |
| 23 | Ga0070682_100308430 | 3300005337 | Unclassified | 1164 |
| 24 | Ga0070682_100431138 | 3300005337 | Bacteria | 1005 |
| 25 | Ga0070682_102086806 | 3300005337 | Bacteria | 500 |
| 26 | Ga0068868_100000450 | 3300005338 | Bacteria | 27515 |
| 27 | Ga0070689_101117630 | 3300005340 | Unclassified | 705 |
| 28 | Ga0070691_10000379 | 3300005341 | Bacteria | 16112 |
| 29 | Ga0070661_100000102 | 3300005344 | Bacteria | 69941 |
| 30 | Ga0070668_100316507 | 3300005347 | Bacteria | 1313 |
| 31 | Ga0070668_101449615 | 3300005347 | Bacteria | 627 |
| 32 | Ga0070675_100000027 | 3300005354 | Bacteria | 106172 |
| 33 | Ga0070675_101583876 | 3300005354 | Bacteria | 604 |
| 34 | Ga0070674_100000090 | 3300005356 | Bacteria | 42115 |
| 35 | Ga0070674_100000683 | 3300005356 | Bacteria | 17159 |
| 36 | Ga0070673_100005169 | 3300005364 | Bacteria | 8331 |
| 37 | Ga0070688_100000738 | 3300005365 | Bacteria | 16106 |
| 38 | Ga0070688_100003810 | 3300005365 | Bacteria | 7820 |
| 39 | Ga0070659_100013281 | 3300005366 | Bacteria | 6126 |
| 40 | Ga0070667_100140750 | 3300005367 | Bacteria | 2113 |
| 41 | Ga0070667_100253940 | 3300005367 | Bacteria | 1572 |
| 42 | Ga0070667_100400187 | 3300005367 | Bacteria | 1250 |
| 43 | Ga0070703_10038768 | 3300005406 | Bacteria | 1474 |
| 44 | Ga0070714_100029758 | 3300005435 | Bacteria | 4542 |
| 45 | Ga0070713_100000085 | 3300005436 | Bacteria | 58902 |
| 46 | Ga0070713_100094192 | 3300005436 | Bacteria | 2581 |
| 47 | Ga0070701_10592547 | 3300005438 | Unclassified | 733 |
| 48 | Ga0070711_100000734 | 3300005439 | Bacteria | 17090 |
| 49 | Ga0070711_100856043 | 3300005439 | Bacteria | 774 |
| 50 | Ga0070700_100097331 | 3300005441 | Bacteria | 1932 |
| 51 | Ga0070663_100024055 | 3300005455 | Bacteria | 4092 |
| 52 | Ga0070663_100078648 | 3300005455 | Bacteria | 2418 |
| 53 | Ga0070678_100052362 | 3300005456 | Bacteria | 2964 |
| 54 | Ga0070678_100128638 | 3300005456 | Bacteria | 2009 |
| 55 | Ga0070678_100338615 | 3300005456 | Unclassified | 1290 |
| 56 | Ga0070678_101218876 | 3300005456 | Unclassified | 698 |
| 57 | Ga0068867_100000796 | 3300005459 | Bacteria | 21356 |
| 58 | Ga0070685_10000141 | 3300005466 | Bacteria | 46333 |
| 59 | Ga0070685_10000616 | 3300005466 | Bacteria | 19644 |
| 60 | Ga0070685_10690849 | 3300005466 | Bacteria | 743 |
| 61 | Ga0070685_10739997 | 3300005466 | Bacteria | 720 |
| 62 | Ga0070679_100000243 | 3300005530 | Bacteria | 45435 |
| 63 | Ga0070684_100055354 | 3300005535 | Bacteria | 3458 |
| 64 | Ga0070684_100078721 | 3300005535 | Bacteria | 2913 |
| 65 | Ga0070684_100108294 | 3300005535 | Bacteria | 2489 |
| 66 | Ga0070684_100172790 | 3300005535 | Bacteria | 1963 |
| 67 | Ga0070684_100631284 | 3300005535 | Bacteria | 997 |
| 68 | Ga0068853_100042402 | 3300005539 | Bacteria | 3891 |
| 69 | Ga0068853_100212198 | 3300005539 | Bacteria | 1765 |
| 70 | Ga0068853_100346137 | 3300005539 | Unclassified | 1382 |
| 71 | Ga0068853_101225435 | 3300005539 | Bacteria | 725 |
| 72 | Ga0070672_100001367 | 3300005543 | Bacteria | 15049 |
| 73 | Ga0070686_100326268 | 3300005544 | Bacteria | 1146 |
| 74 | Ga0070695_100076867 | 3300005545 | Bacteria | 2199 |
| 75 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 76 | Ga0070665_100000950 | 3300005548 | Bacteria | 36935 |
| 77 | Ga0070665_100076910 | 3300005548 | Bacteria | 3344 |
| 78 | Ga0070665_100102705 | 3300005548 | Bacteria | 2862 |
| 79 | Ga0070665_100513584 | 3300005548 | Bacteria | 1210 |
| 80 | Ga0070665_100532510 | 3300005548 | Bacteria | 1187 |
| 81 | Ga0070665_100646222 | 3300005548 | Unclassified | 1071 |
| 82 | Ga0070665_101702637 | 3300005548 | Bacteria | 638 |
| 83 | Ga0070704_100098991 | 3300005549 | Bacteria | 2192 |
| 84 | Ga0068855_100220175 | 3300005563 | Bacteria | 2129 |
| 85 | Ga0068855_100456315 | 3300005563 | Bacteria | 1394 |
| 86 | Ga0068855_101875267 | 3300005563 | Bacteria | 608 |
| 87 | Ga0070664_100168855 | 3300005564 | Bacteria | 1940 |
| 88 | Ga0068857_100504968 | 3300005577 | Bacteria | 1135 |
| 89 | Ga0068854_100040165 | 3300005578 | Bacteria | 3300 |
| 90 | Ga0068856_100000629 | 3300005614 | Bacteria | 38394 |
| 91 | Ga0068856_100009027 | 3300005614 | Bacteria | 9700 |
| 92 | Ga0068856_100009431 | 3300005614 | Bacteria | 9476 |
| 93 | Ga0068856_100251724 | 3300005614 | Bacteria | 1781 |
| 94 | Ga0068856_100529929 | 3300005614 | Bacteria | 1199 |
| 95 | Ga0070702_100061922 | 3300005615 | Archaea | 2180 |
| 96 | Ga0068852_100000006 | 3300005616 | Bacteria | 159569 |
| 97 | Ga0068852_101880785 | 3300005616 | Bacteria | 621 |
| 98 | Ga0068859_102252646 | 3300005617 | Unclassified | 601 |
| 99 | Ga0068864_100000053 | 3300005618 | Bacteria | 133049 |
| 100 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 101 | Ga0068866_10000685 | 3300005718 | Bacteria | 15430 |
| 102 | Ga0068861_100185142 | 3300005719 | Unclassified | 1736 |
| 103 | Ga0068861_100863997 | 3300005719 | Unclassified | 854 |
| 104 | Ga0068863_100000342 | 3300005841 | Bacteria | 47536 |
| 105 | Ga0068863_100010993 | 3300005841 | Bacteria | 8778 |
| 106 | Ga0068863_100024630 | 3300005841 | Bacteria | 5739 |
| 107 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 108 | Ga0068858_100000065 | 3300005842 | Bacteria | 108233 |
| 109 | Ga0068858_100701468 | 3300005842 | Bacteria | 985 |
| 110 | Ga0068860_100015414 | 3300005843 | Bacteria | 7468 |
| 111 | Ga0068860_100045535 | 3300005843 | Bacteria | 4184 |
| 112 | Ga0068860_100073002 | 3300005843 | Bacteria | 3262 |
| 113 | Ga0068862_100004868 | 3300005844 | Bacteria | 11306 |
| 114 | Ga0081455_10030774 | 3300005937 | Bacteria | 4870 |
| 115 | Ga0081455_10079300 | 3300005937 | Bacteria | 2696 |
| 116 | Ga0081455_10134122 | 3300005937 | Bacteria | 1932 |
| 117 | Ga0081538_10000224 | 3300005981 | Bacteria | 63610 |
| 118 | Ga0081538_10000292 | 3300005981 | Bacteria | 57471 |
| 119 | Ga0081538_10038874 | 3300005981 | Bacteria | 3060 |
| 120 | Ga0081540_1000163 | 3300005983 | Bacteria | 68955 |
| 121 | Ga0081539_10009804 | 3300005985 | Bacteria | 7915 |
| 122 | Ga0081539_10036425 | 3300005985 | Bacteria | 2945 |
| 123 | Ga0075364_10301570 | 3300006051 | Unclassified | 1090 |
| 124 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 125 | Ga0070712_100003543 | 3300006175 | Bacteria | 9611 |
| 126 | Ga0070712_101414369 | 3300006175 | Bacteria | 607 |
| 127 | Ga0075430_100251755 | 3300006846 | Bacteria | 1463 |
| 128 | Ga0075430_100474680 | 3300006846 | Bacteria | 1032 |
| 129 | Ga0075430_101640040 | 3300006846 | Unclassified | 528 |
| 130 | Ga0075433_10000900 | 3300006852 | Bacteria | 20958 |
| 131 | Ga0068865_100123957 | 3300006881 | Bacteria | 1926 |
| 132 | Ga0097620_102253579 | 3300006931 | Unclassified | 601 |
| 133 | Ga0105240_10341878 | 3300009093 | Bacteria | 1700 |
| 134 | Ga0105240_10484914 | 3300009093 | Unclassified | 1377 |
| 135 | Ga0105245_10000020 | 3300009098 | Bacteria | 181774 |
| 136 | Ga0105245_10000254 | 3300009098 | Bacteria | 50918 |
| 137 | Ga0105245_10005635 | 3300009098 | Bacteria | 11007 |
| 138 | Ga0105245_10733841 | 3300009098 | Bacteria | 1023 |
| 139 | Ga0105247_10000316 | 3300009101 | Bacteria | 43374 |
| 140 | Ga0105247_10046632 | 3300009101 | Bacteria | 2660 |
| 141 | Ga0105247_10057391 | 3300009101 | Bacteria | 2407 |
| 142 | Ga0105247_10091080 | 3300009101 | Bacteria | 1936 |
| 143 | Ga0105247_10793144 | 3300009101 | Bacteria | 722 |
| 144 | Ga0114129_11055251 | 3300009147 | Bacteria | 1020 |
| 145 | Ga0105243_10203452 | 3300009148 | Bacteria | 1738 |
| 146 | Ga0105243_10461670 | 3300009148 | Bacteria | 1194 |
| 147 | Ga0105241_10493297 | 3300009174 | Bacteria | 1091 |
| 148 | Ga0105242_10000032 | 3300009176 | Bacteria | 98198 |
| 149 | Ga0105242_10000454 | 3300009176 | Bacteria | 32662 |
| 150 | Ga0105242_10034640 | 3300009176 | Bacteria | 4048 |
| 151 | Ga0105242_11007705 | 3300009176 | Bacteria | 841 |
| 152 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 153 | Ga0105248_10464002 | 3300009177 | Unclassified | 1428 |
| 154 | Ga0105248_10952990 | 3300009177 | Bacteria | 969 |
| 155 | Ga0105237_10854796 | 3300009545 | Bacteria | 917 |
| 156 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 157 | Ga0105249_10000080 | 3300009553 | Bacteria | 138080 |
| 158 | Ga0105249_10122790 | 3300009553 | Bacteria | 2470 |
| 159 | Ga0105249_10236597 | 3300009553 | Bacteria | 1804 |
| 160 | Ga0105249_10278023 | 3300009553 | Bacteria | 1671 |
| 161 | Ga0105249_13559026 | 3300009553 | Bacteria | 502 |
| 162 | Ga0105239_10198120 | 3300010375 | Bacteria | 2249 |
| 163 | Ga0105239_10513843 | 3300010375 | Bacteria | 1362 |
| 164 | Ga0105239_11372476 | 3300010375 | Bacteria | 816 |
| 165 | Ga0105246_10086734 | 3300011119 | Bacteria | 2245 |
| 166 | Ga0157370_11273517 | 3300013104 | Bacteria | 663 |
| 167 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 168 | Ga0157369_11180353 | 3300013105 | Bacteria | 781 |
| 169 | Ga0157374_10001772 | 3300013296 | Bacteria | 18163 |
| 170 | Ga0157374_10140331 | 3300013296 | Bacteria | 2345 |
| 171 | Ga0157378_10011377 | 3300013297 | Bacteria | 7788 |
| 172 | Ga0157378_10066419 | 3300013297 | Bacteria | 3231 |
| 173 | Ga0157378_10262517 | 3300013297 | Bacteria | 1657 |
| 174 | Ga0163162_10900834 | 3300013306 | Bacteria | 998 |
| 175 | Ga0157372_13462531 | 3300013307 | Unclassified | 502 |
| 176 | Ga0157375_10001213 | 3300013308 | Bacteria | 22205 |
| 177 | Ga0157375_10001538 | 3300013308 | Bacteria | 19849 |
| 178 | Ga0157375_10037053 | 3300013308 | Bacteria | 4670 |
| 179 | Ga0157375_10064237 | 3300013308 | Bacteria | 3654 |
| 180 | Ga0157375_10623423 | 3300013308 | Unclassified | 1236 |
| 181 | Ga0157375_11231945 | 3300013308 | Unclassified | 878 |
| 182 | Ga0163163_10333782 | 3300014325 | Bacteria | 1571 |
| 183 | Ga0163163_10457811 | 3300014325 | Bacteria | 1336 |
| 184 | Ga0163163_10834815 | 3300014325 | Unclassified | 985 |
| 185 | Ga0163163_11084014 | 3300014325 | Bacteria | 864 |
| 186 | Ga0163163_11613329 | 3300014325 | Bacteria | 710 |
| 187 | Ga0163163_11971430 | 3300014325 | Bacteria | 644 |
| 188 | Ga0157380_11167437 | 3300014326 | Unclassified | 812 |
| 189 | Ga0157379_10072798 | 3300014968 | Bacteria | 3075 |
| 190 | Ga0157379_10215488 | 3300014968 | Bacteria | 1739 |
| 191 | Ga0157379_10436563 | 3300014968 | Bacteria | 1207 |
| 192 | Ga0157379_11103525 | 3300014968 | Bacteria | 760 |
| 193 | Ga0157376_10025483 | 3300014969 | Bacteria | 4658 |
| 194 | Ga0157376_10302501 | 3300014969 | Bacteria | 1515 |
| 195 | Ga0163161_10129034 | 3300017792 | Bacteria | 1906 |
| 196 | Ga0163161_10303339 | 3300017792 | Bacteria | 1258 |
| 197 | Ga0207656_10059181 | 3300025321 | Bacteria | 1676 |
| 198 | Ga0207653_10052614 | 3300025885 | Bacteria | 1358 |
| 199 | Ga0207682_10000005 | 3300025893 | Bacteria | 95617 |
| 200 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 201 | Ga0207642_10000281 | 3300025899 | Bacteria | 15233 |
| 202 | Ga0207710_10000458 | 3300025900 | Bacteria | 26155 |
| 203 | Ga0207710_10047351 | 3300025900 | Bacteria | 1921 |
| 204 | Ga0207710_10247242 | 3300025900 | Bacteria | 891 |
| 205 | Ga0207680_10006139 | 3300025903 | Bacteria | 5792 |
| 206 | Ga0207680_10143700 | 3300025903 | Bacteria | 1584 |
| 207 | Ga0207685_10000027 | 3300025905 | Bacteria | 102101 |
| 208 | Ga0207699_10709332 | 3300025906 | Bacteria | 737 |
| 209 | Ga0207705_10032908 | 3300025909 | Bacteria | 3705 |
| 210 | Ga0207654_10600706 | 3300025911 | Bacteria | 785 |
| 211 | Ga0207707_10255808 | 3300025912 | Bacteria | 1520 |
| 212 | Ga0207695_10280162 | 3300025913 | Bacteria | 1561 |
| 213 | Ga0207693_10015289 | 3300025915 | Bacteria | 6159 |
| 214 | Ga0207663_10000498 | 3300025916 | Bacteria | 17164 |
| 215 | Ga0207663_10380579 | 3300025916 | Bacteria | 1075 |
| 216 | Ga0207660_10117921 | 3300025917 | Bacteria | 2007 |
| 217 | Ga0207660_11023398 | 3300025917 | Unclassified | 673 |
| 218 | Ga0207662_11314574 | 3300025918 | Unclassified | 514 |
| 219 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 220 | Ga0207652_10002027 | 3300025921 | Bacteria | 17455 |
| 221 | Ga0207652_10009957 | 3300025921 | Bacteria | 7653 |
| 222 | Ga0207681_10059820 | 3300025923 | Bacteria | 2613 |
| 223 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 224 | Ga0207650_10134897 | 3300025925 | Bacteria | 1935 |
| 225 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 226 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 227 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 228 | Ga0207687_10002226 | 3300025927 | Bacteria | 13218 |
| 229 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 230 | Ga0207700_10018207 | 3300025928 | Bacteria | 4714 |
| 231 | Ga0207664_10333168 | 3300025929 | Bacteria | 1341 |
| 232 | Ga0207664_10568183 | 3300025929 | Unclassified | 1018 |
| 233 | Ga0207690_10012815 | 3300025932 | Bacteria | 5023 |
| 234 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 235 | Ga0207686_10000048 | 3300025934 | Bacteria | 115595 |
| 236 | Ga0207686_10000447 | 3300025934 | Bacteria | 27400 |
| 237 | Ga0207686_10017927 | 3300025934 | Bacteria | 4000 |
| 238 | Ga0207686_10021013 | 3300025934 | Bacteria | 3739 |
| 239 | Ga0207709_10116622 | 3300025935 | Bacteria | 1795 |
| 240 | Ga0207709_10387917 | 3300025935 | Bacteria | 1064 |
| 241 | Ga0207669_10000018 | 3300025937 | Bacteria | 114254 |
| 242 | Ga0207669_10000096 | 3300025937 | Bacteria | 44213 |
| 243 | Ga0207704_10215492 | 3300025938 | Bacteria | 1417 |
| 244 | Ga0207691_10003586 | 3300025940 | Bacteria | 15090 |
| 245 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 246 | Ga0207711_10321951 | 3300025941 | Unclassified | 1429 |
| 247 | Ga0207711_10503612 | 3300025941 | Bacteria | 1129 |
| 248 | Ga0207711_11317632 | 3300025941 | Bacteria | 664 |
| 249 | Ga0207661_10000253 | 3300025944 | Bacteria | 34627 |
| 250 | Ga0207661_10000347 | 3300025944 | Bacteria | 29715 |
| 251 | Ga0207661_10007582 | 3300025944 | Bacteria | 7717 |
| 252 | Ga0207661_10011874 | 3300025944 | Bacteria | 6327 |
| 253 | Ga0207661_10019993 | 3300025944 | Bacteria | 4999 |
| 254 | Ga0207661_10147525 | 3300025944 | Bacteria | 2031 |
| 255 | Ga0207661_10237798 | 3300025944 | Bacteria | 1615 |
| 256 | Ga0207679_10254057 | 3300025945 | Bacteria | 1496 |
| 257 | Ga0207679_11714745 | 3300025945 | Bacteria | 575 |
| 258 | Ga0207667_10184223 | 3300025949 | Bacteria | 2144 |
| 259 | Ga0207667_10412911 | 3300025949 | Bacteria | 1374 |
| 260 | Ga0207667_11020873 | 3300025949 | Bacteria | 813 |
| 261 | Ga0207651_10033652 | 3300025960 | Bacteria | 3308 |
| 262 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 263 | Ga0207712_10084764 | 3300025961 | Bacteria | 2316 |
| 264 | Ga0207712_10096858 | 3300025961 | Bacteria | 2185 |
| 265 | Ga0207712_10168968 | 3300025961 | Bacteria | 1707 |
| 266 | Ga0207668_10026773 | 3300025972 | Bacteria | 3749 |
| 267 | Ga0207668_11136590 | 3300025972 | Bacteria | 701 |
| 268 | Ga0207640_10003186 | 3300025981 | Bacteria | 8830 |
| 269 | Ga0207658_10002826 | 3300025986 | Bacteria | 12451 |
| 270 | Ga0207658_10105875 | 3300025986 | Bacteria | 2213 |
| 271 | Ga0207677_10000200 | 3300026023 | Bacteria | 48320 |
| 272 | Ga0207677_10018605 | 3300026023 | Bacteria | 4173 |
| 273 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 274 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 275 | Ga0207703_11268719 | 3300026035 | Unclassified | 708 |
| 276 | Ga0207639_10070507 | 3300026041 | Bacteria | 2730 |
| 277 | Ga0207639_10108827 | 3300026041 | Bacteria | 2254 |
| 278 | Ga0207639_10318358 | 3300026041 | Unclassified | 1381 |
| 279 | Ga0207639_11157892 | 3300026041 | Bacteria | 726 |
| 280 | Ga0207678_10006053 | 3300026067 | Bacteria | 10761 |
| 281 | Ga0207678_10100948 | 3300026067 | Bacteria | 2465 |
| 282 | Ga0207708_10146463 | 3300026075 | Bacteria | 1856 |
| 283 | Ga0207702_10000158 | 3300026078 | Bacteria | 79984 |
| 284 | Ga0207702_10004125 | 3300026078 | Bacteria | 13025 |
| 285 | Ga0207702_10300350 | 3300026078 | Bacteria | 1524 |
| 286 | Ga0207702_10485326 | 3300026078 | Bacteria | 1203 |
| 287 | Ga0207702_11458704 | 3300026078 | Bacteria | 678 |
| 288 | Ga0207641_10000238 | 3300026088 | Bacteria | 71152 |
| 289 | Ga0207641_10004805 | 3300026088 | Bacteria | 11642 |
| 290 | Ga0207648_10008647 | 3300026089 | Bacteria | 9832 |
| 291 | Ga0207676_10000195 | 3300026095 | Bacteria | 52951 |
| 292 | Ga0207674_10255185 | 3300026116 | Bacteria | 1700 |
| 293 | Ga0207674_11165993 | 3300026116 | Unclassified | 740 |
| 294 | Ga0207675_100129425 | 3300026118 | Bacteria | 2393 |
| 295 | Ga0207675_100955456 | 3300026118 | Unclassified | 874 |
| 296 | Ga0207683_10004283 | 3300026121 | Bacteria | 12324 |
| 297 | Ga0207683_10012162 | 3300026121 | Bacteria | 7348 |
| 298 | Ga0207683_10507001 | 3300026121 | Bacteria | 1114 |
| 299 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 300 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 301 | Ga0268266_10000595 | 3300028379 | Bacteria | 49517 |
| 302 | Ga0268266_10006385 | 3300028379 | Bacteria | 10799 |
| 303 | Ga0268266_10129548 | 3300028379 | Bacteria | 2255 |
| 304 | Ga0268266_10413967 | 3300028379 | Bacteria | 1276 |
| 305 | Ga0268266_10617569 | 3300028379 | Bacteria | 1042 |
| 306 | Ga0268266_11037507 | 3300028379 | Bacteria | 793 |
| 307 | Ga0268265_10069595 | 3300028380 | Bacteria | 2733 |
| 308 | Ga0268264_10029949 | 3300028381 | Bacteria | 4462 |
| 309 | Ga0268264_10282597 | 3300028381 | Bacteria | 1555 |
| 310 | Ga0268264_10404945 | 3300028381 | Bacteria | 1312 |
| 311 | Ga0265337_1000807 | 3300028556 | Bacteria | 16498 |
| 312 | Ga0265319_1000020 | 3300028563 | Bacteria | 153921 |
| 313 | Ga0265334_10072019 | 3300028573 | Bacteria | 1286 |
| 314 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 315 | Ga0265336_10021063 | 3300028666 | Bacteria | 2086 |
| 316 | Ga0265338_10001248 | 3300028800 | Bacteria | 41926 |
| 317 | Ga0265324_10000755 | 3300029957 | Bacteria | 21443 |
| 318 | Ga0265332_10089355 | 3300031238 | Bacteria | 1303 |
| 319 | Ga0265328_10001094 | 3300031239 | Bacteria | 12441 |
| 320 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 321 | Ga0265325_10027972 | 3300031241 | Bacteria | 3044 |
| 322 | Ga0265329_10010994 | 3300031242 | Bacteria | 3303 |
| 323 | Ga0265339_10040002 | 3300031249 | Bacteria | 2607 |
| 324 | Ga0265331_10009837 | 3300031250 | Bacteria | 5330 |
| 325 | Ga0265331_10039701 | 3300031250 | Bacteria | 2294 |
| 326 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 327 | Ga0265316_10035392 | 3300031344 | Bacteria | 4047 |
| 328 | Ga0307513_10422210 | 3300031456 | Bacteria | 1063 |
| 329 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 330 | Ga0265342_10130167 | 3300031712 | Bacteria | 1411 |
| 331 | Ga0316576_10002655 | 3300031727 | Bacteria | 10215 |
| 332 | Ga0316576_10766085 | 3300031727 | Bacteria | 696 |
| 333 | Ga0316578_10272663 | 3300031728 | Bacteria | 1014 |
| 334 | Ga0307415_100025696 | 3300032126 | Bacteria | 3701 |
| 335 | Ga0316583_10075817 | 3300032133 | Bacteria | 1176 |
| 336 | Ga0373953_0537388 | 3300035117 | Unclassified | 519 |
| 337 | Ga0373957_0169454 | 3300035120 | Unclassified | 902 |
| 338 | Ga0373955_0131489 | 3300035172 | Unclassified | 1461 |
| 339 | Ga0316574_0007038 | 3300035398 | Bacteria | 6132 |
| 340 | Ga0316574_0020608 | 3300035398 | Bacteria | 3904 |
| 341 | Ga0316574_0769129 | 3300035398 | Unclassified | 588 |
| 342 | Ga0373933_0514565 | 3300035724 | Unclassified | 784 |
| 343 | Ga0373947_1233701 | 3300035725 | Unclassified | 509 |
| 344 | Ga0373937_0065492 | 3300036401 | Bacteria | 3345 |
| 345 | Ga0316584_0005290 | 3300036712 | Bacteria | 8643 |
| 346 | Ga0316584_0361150 | 3300036712 | Bacteria | 1041 |
| 347 | Ga0451804_1065570 | 3300041463 | Unclassified | 548 |
| 348 | Ga0451807_2677790 | 3300041486 | Unclassified | 552 |
| 349 | Ga0451849_0214338 | 3300041505 | Bacteria | 509 |
| 350 | Ga0451853_2765288 | 3300041512 | Bacteria | 3303 |
| 351 | Ga0466963_0000153 | 3300044694 | Bacteria | 27553 |
| 352 | Ga0466963_0108599 | 3300044694 | Bacteria | 1903 |
| 353 | Ga0466963_0111154 | 3300044694 | Bacteria | 1881 |
| 354 | Ga0466963_1096648 | 3300044694 | Bacteria | 560 |
| 355 | Ga0466967_0000009 | 3300045976 | Bacteria | 122610 |
| 356 | Ga0466967_0006679 | 3300045976 | Bacteria | 8202 |
| 357 | Ga0466967_0800594 | 3300045976 | Unclassified | 936 |
| 358 | Ga0466967_1069266 | 3300045976 | Bacteria | 804 |
| 359 | Ga0466967_1166160 | 3300045976 | Bacteria | 768 |
| 360 | Ga0495592_0166417 | 3300046454 | Bacteria | 1513 |
| 361 | Ga0495592_0389916 | 3300046454 | Bacteria | 884 |
| 362 | Ga0495603_0001389 | 3300046455 | Bacteria | 14063 |
| 363 | Ga0495603_0001462 | 3300046455 | Bacteria | 13743 |
| 364 | Ga0495603_0806219 | 3300046455 | Unclassified | 535 |
| 365 | Ga0495629_0000509 | 3300046459 | Bacteria | 32652 |
| 366 | Ga0495629_0003113 | 3300046459 | Bacteria | 12579 |
| 367 | Ga0495629_0045971 | 3300046459 | Bacteria | 3063 |
| 368 | Ga0495629_0308837 | 3300046459 | Unclassified | 1082 |
| 369 | Ga0495638_0016284 | 3300046460 | Bacteria | 4982 |
| 370 | Ga0495641_0000228 | 3300046461 | Bacteria | 43671 |
| 371 | Ga0495641_0542231 | 3300046461 | Unclassified | 531 |
| 372 | Ga0495653_0048856 | 3300046463 | Bacteria | 3263 |
| 373 | Ga0495653_0233765 | 3300046463 | Unclassified | 1229 |
| 374 | Ga0495653_0240081 | 3300046463 | Bacteria | 1208 |
| 375 | Ga0495653_0417681 | 3300046463 | Bacteria | 849 |
| 376 | Ga0495653_0572655 | 3300046463 | Bacteria | 697 |
| 377 | Ga0495653_0592416 | 3300046463 | Bacteria | 682 |
| 378 | Ga0495582_0000726 | 3300046473 | Bacteria | 18153 |
| 379 | Ga0495662_0028052 | 3300046476 | Unclassified | 2718 |
| 380 | Ga0495664_0427419 | 3300046477 | Bacteria | 794 |
| 381 | Ga0495594_0000029 | 3300046499 | Bacteria | 66789 |
| 382 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 383 | Ga0495608_0000060 | 3300046511 | Bacteria | 88189 |
| 384 | Ga0495608_0000529 | 3300046511 | Bacteria | 26174 |
| 385 | Ga0495608_0036783 | 3300046511 | Bacteria | 3294 |
| 386 | Ga0495618_0204870 | 3300046514 | Bacteria | 1248 |
| 387 | Ga0495618_0378611 | 3300046514 | Bacteria | 869 |
| 388 | Ga0495620_0000824 | 3300046515 | Bacteria | 19119 |
| 389 | Ga0495628_0009655 | 3300046516 | Bacteria | 8232 |
| 390 | Ga0495628_0041865 | 3300046516 | Bacteria | 3655 |
| 391 | Ga0495628_0080155 | 3300046516 | Bacteria | 2538 |
| 392 | Ga0495628_0117946 | 3300046516 | Bacteria | 2038 |
| 393 | Ga0495628_0139014 | 3300046516 | Bacteria | 1854 |
| 394 | Ga0495628_0376004 | 3300046516 | Bacteria | 1041 |
| 395 | Ga0495628_0498713 | 3300046516 | Bacteria | 879 |
| 396 | Ga0495628_0880669 | 3300046516 | Bacteria | 622 |
| 397 | Ga0495630_0000020 | 3300046517 | Bacteria | 176389 |
| 398 | Ga0495630_0009440 | 3300046517 | Bacteria | 7015 |
| 399 | Ga0495630_0085507 | 3300046517 | Bacteria | 2381 |
| 400 | Ga0495630_0149936 | 3300046517 | Bacteria | 1774 |
| 401 | Ga0495630_0544007 | 3300046517 | Bacteria | 890 |
| 402 | Ga0495644_0014524 | 3300046523 | Bacteria | 3016 |
| 403 | Ga0495644_0244209 | 3300046523 | Bacteria | 697 |
| 404 | Ga0495652_0000407 | 3300046529 | Bacteria | 50232 |
| 405 | Ga0495652_0045375 | 3300046529 | Bacteria | 3779 |
| 406 | Ga0495652_0254272 | 3300046529 | Bacteria | 1300 |
| 407 | Ga0495640_0036783 | 3300046533 | Bacteria | 3457 |
| 408 | Ga0495640_0091005 | 3300046533 | Bacteria | 2013 |
| 409 | Ga0495586_0021614 | 3300046535 | Bacteria | 3431 |
| 410 | Ga0495586_0305432 | 3300046535 | Unclassified | 912 |
| 411 | Ga0495587_0019281 | 3300046536 | Bacteria | 4224 |
| 412 | Ga0495587_0047777 | 3300046536 | Bacteria | 2537 |
| 413 | Ga0495587_0532161 | 3300046536 | Bacteria | 649 |
| 414 | Ga0495598_0002610 | 3300046537 | Bacteria | 3731 |
| 415 | Ga0495621_0006858 | 3300046539 | Bacteria | 3350 |
| 416 | Ga0495621_0066218 | 3300046539 | Bacteria | 1321 |
| 417 | Ga0495645_0006445 | 3300046543 | Bacteria | 8142 |
| 418 | Ga0495645_0019986 | 3300046543 | Bacteria | 4828 |
| 419 | Ga0495622_0000550 | 3300046557 | Bacteria | 22511 |
| 420 | Ga0495667_0000018 | 3300046559 | Bacteria | 188610 |
| 421 | Ga0495667_0074568 | 3300046559 | Bacteria | 2209 |
| 422 | Ga0495656_0001090 | 3300046615 | Bacteria | 8799 |
| 423 | Ga0495668_0720470 | 3300046616 | Unclassified | 552 |
| 424 | Ga0495634_0000059 | 3300046642 | Bacteria | 88314 |
| 425 | Ga0495634_0015499 | 3300046642 | Bacteria | 5475 |
| 426 | Ga0495634_0253327 | 3300046642 | Unclassified | 1076 |
| 427 | Ga0495634_0349180 | 3300046642 | Bacteria | 886 |
| 428 | Ga0495634_0552366 | 3300046642 | Unclassified | 671 |
| 429 | Ga0495625_0000756 | 3300046660 | Bacteria | 45145 |
| 430 | Ga0495625_0253451 | 3300046660 | Bacteria | 1142 |
| 431 | Ga0495625_0367777 | 3300046660 | Bacteria | 905 |
| 432 | Ga0495635_0124963 | 3300046663 | Bacteria | 1754 |
| 433 | Ga0495635_0220008 | 3300046663 | Bacteria | 1284 |
| 434 | Ga0495635_0312271 | 3300046663 | Bacteria | 1053 |
| 435 | Ga0495635_0587810 | 3300046663 | Bacteria | 728 |
| 436 | Ga0495635_0944979 | 3300046663 | Bacteria | 550 |
| 437 | Ga0495588_0000134 | 3300046674 | Bacteria | 117581 |
| 438 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 439 | Ga0495657_0051214 | 3300046675 | Bacteria | 2773 |
| 440 | Ga0495599_0018403 | 3300046678 | Bacteria | 4352 |
| 441 | Ga0495599_0074998 | 3300046678 | Bacteria | 2112 |
| 442 | Ga0495623_0383476 | 3300046679 | Unclassified | 759 |
| 443 | Ga0495623_0723111 | 3300046679 | Unclassified | 508 |
| 444 | Ga0495646_0174008 | 3300046680 | Bacteria | 1185 |
| 445 | Ga0495646_0381400 | 3300046680 | Bacteria | 735 |
| 446 | Ga0495647_0000156 | 3300046681 | Bacteria | 17539 |
| 447 | Ga0495647_0009525 | 3300046681 | Bacteria | 3293 |
| 448 | Ga0495658_0000034 | 3300046683 | Bacteria | 69176 |
| 449 | Ga0495658_0509780 | 3300046683 | Unclassified | 770 |
| 450 | Ga0495658_1079639 | 3300046683 | Archaea | 512 |
| 451 | Ga0495669_0000310 | 3300046684 | Bacteria | 26921 |
| 452 | Ga0495613_0000801 | 3300046689 | Bacteria | 24391 |
| 453 | Ga0495613_0004320 | 3300046689 | Bacteria | 10639 |
| 454 | Ga0495613_0071867 | 3300046689 | Bacteria | 2522 |
| 455 | Ga0495613_0123022 | 3300046689 | Bacteria | 1862 |
| 456 | Ga0495624_0002509 | 3300046690 | Bacteria | 13903 |
| 457 | Ga0495670_0019959 | 3300046691 | Bacteria | 3303 |
| 458 | Ga0495649_0008541 | 3300046694 | Bacteria | 6154 |
| 459 | Ga0495600_0056445 | 3300046809 | Bacteria | 2565 |
| 460 | Ga0495600_0457452 | 3300046809 | Bacteria | 788 |
| 461 | Ga0495660_0238943 | 3300046810 | Bacteria | 848 |
| 462 | Ga0495581_0036815 | 3300047315 | Bacteria | 2831 |
| 463 | Ga0495604_0000055 | 3300047317 | Bacteria | 100430 |
| 464 | Ga0495604_0000137 | 3300047317 | Bacteria | 62542 |
| 465 | Ga0495604_0046921 | 3300047317 | Bacteria | 3367 |
| 466 | Ga0495674_0000064 | 3300047319 | Bacteria | 71275 |
| 467 | Ga0495674_0112482 | 3300047319 | Bacteria | 2307 |
| 468 | Ga0495674_0295826 | 3300047319 | Bacteria | 1323 |
| 469 | Ga0495672_0063979 | 3300047320 | Bacteria | 2108 |
| 470 | Ga0495672_0157717 | 3300047320 | Bacteria | 1170 |
| 471 | Ga0495672_0215233 | 3300047320 | Unclassified | 952 |
| 472 | Ga0495676_0000130 | 3300047321 | Bacteria | 56693 |
| 473 | Ga0495676_0011318 | 3300047321 | Bacteria | 8057 |
| 474 | Ga0495680_0000550 | 3300047322 | Bacteria | 42291 |
| 475 | Ga0495680_0004286 | 3300047322 | Bacteria | 13686 |
| 476 | Ga0495680_0029878 | 3300047322 | Bacteria | 4457 |
| 477 | Ga0495680_0143515 | 3300047322 | Bacteria | 1745 |
| 478 | Ga0495675_0000040 | 3300047444 | Bacteria | 86266 |
| 479 | Ga0495679_010145 | 3300047446 | Bacteria | 3718 |
| 480 | Ga0495673_0020669 | 3300047469 | Bacteria | 3274 |
| 481 | Ga0495686_0034255 | 3300047472 | Bacteria | 3272 |
| 482 | Ga0495686_0082686 | 3300047472 | Unclassified | 1959 |
| 483 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 484 | Ga0495602_0013815 | 3300048088 | Bacteria | 8231 |
| 485 | Ga0495602_0215823 | 3300048088 | Bacteria | 1452 |
| 486 | Ga0495602_0231405 | 3300048088 | Bacteria | 1388 |
| 487 | Ga0495602_0608090 | 3300048088 | Bacteria | 751 |
| 488 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 489 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 490 | Ga0496100_0182269 | 3300048903 | Bacteria | 1519 |
| 491 | Ga0496100_1454953 | 3300048903 | Unclassified | 541 |
| 492 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 493 | Ga0496101_0000101 | 3300048904 | Bacteria | 89424 |
| 494 | Ga0496101_0281939 | 3300048904 | Bacteria | 1299 |
| 495 | Ga0496101_0556121 | 3300048904 | Bacteria | 907 |
| 496 | Ga0496102_0000115 | 3300048905 | Bacteria | 114224 |
| 497 | Ga0496102_0117114 | 3300048905 | Bacteria | 2486 |
| 498 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 499 | Ga0496103_0072055 | 3300048906 | Bacteria | 2163 |
| 500 | Ga0496103_0224914 | 3300048906 | Bacteria | 1207 |
| 501 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 502 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 503 | Ga0496104_0006952 | 3300048907 | Bacteria | 9977 |
| 504 | Ga0496104_0008811 | 3300048907 | Bacteria | 8969 |
| 505 | Ga0496104_1293504 | 3300048907 | Bacteria | 632 |
| 506 | Ga0496104_1628535 | 3300048907 | Unclassified | 548 |
| 507 | Ga0496104_1663565 | 3300048907 | Bacteria | 541 |
| 508 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 509 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 510 | Ga0496105_0000650 | 3300048908 | Bacteria | 23286 |
| 511 | Ga0496105_0142503 | 3300048908 | Bacteria | 1972 |
| 512 | Ga0496105_0440104 | 3300048908 | Bacteria | 1030 |
| 513 | Ga0496106_0000084 | 3300048909 | Bacteria | 74135 |
| 514 | Ga0496106_0000151 | 3300048909 | Bacteria | 51430 |
| 515 | Ga0496106_0000682 | 3300048909 | Bacteria | 24335 |
| 516 | Ga0496106_0685917 | 3300048909 | Bacteria | 817 |
| 517 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 518 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 519 | Ga0496107_0761173 | 3300048910 | Bacteria | 710 |
| 520 | Ga0496107_1153170 | 3300048910 | Bacteria | 558 |
| 521 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 522 | Ga0496108_0000175 | 3300048911 | Bacteria | 59373 |
| 523 | Ga0496108_0000587 | 3300048911 | Bacteria | 28462 |
| 524 | Ga0496108_0029134 | 3300048911 | Bacteria | 4570 |
| 525 | Ga0496108_0068044 | 3300048911 | Bacteria | 3004 |
| 526 | Ga0496108_0603839 | 3300048911 | Bacteria | 956 |
| 527 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 528 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 529 | Ga0496109_0000249 | 3300048912 | Bacteria | 51718 |
| 530 | Ga0496109_0001118 | 3300048912 | Bacteria | 22284 |
| 531 | Ga0496109_0071967 | 3300048912 | Bacteria | 3175 |
| 532 | Ga0496109_0405406 | 3300048912 | Bacteria | 1288 |
| 533 | Ga0496110_0004679 | 3300048913 | Bacteria | 10644 |
| 534 | Ga0496110_0007407 | 3300048913 | Bacteria | 8762 |
| 535 | Ga0496110_0023867 | 3300048913 | Bacteria | 5207 |
| 536 | Ga0496110_0804744 | 3300048913 | Bacteria | 844 |
| 537 | Ga0496110_0897091 | 3300048913 | Unclassified | 792 |
| 538 | Ga0496111_0019839 | 3300048914 | Bacteria | 4675 |
| 539 | Ga0496111_0148570 | 3300048914 | Bacteria | 1738 |
| 540 | Ga0496111_0349392 | 3300048914 | Bacteria | 1095 |
| 541 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 542 | Ga0496112_0115785 | 3300048915 | Bacteria | 2651 |
| 543 | Ga0496113_0062416 | 3300048916 | Bacteria | 2814 |
| 544 | Ga0496113_0130971 | 3300048916 | Bacteria | 1968 |
| 545 | Ga0496113_0162284 | 3300048916 | Bacteria | 1767 |
| 546 | Ga0496113_0232221 | 3300048916 | Bacteria | 1471 |
| 547 | Ga0496113_0475892 | 3300048916 | Bacteria | 1003 |
| 548 | Ga0496113_0761794 | 3300048916 | Bacteria | 770 |
| 549 | Ga0496114_0000101 | 3300048917 | Bacteria | 61589 |
| 550 | Ga0496114_0012931 | 3300048917 | Bacteria | 6686 |
| 551 | Ga0496114_0150349 | 3300048917 | Bacteria | 2020 |
| 552 | Ga0496114_0287856 | 3300048917 | Bacteria | 1449 |
| 553 | Ga0496114_0349469 | 3300048917 | Bacteria | 1308 |
| 554 | Ga0496114_0903270 | 3300048917 | Bacteria | 764 |
| 555 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 556 | Ga0496115_0000200 | 3300048918 | Bacteria | 55755 |
| 557 | Ga0496116_0000735 | 3300048919 | Bacteria | 41771 |
| 558 | Ga0496117_0004253 | 3300048920 | Bacteria | 15981 |
| 559 | Ga0496118_0000833 | 3300048921 | Bacteria | 49030 |
| 560 | Ga0496118_0093077 | 3300048921 | Bacteria | 2066 |
| 561 | Ga0496118_0350948 | 3300048921 | Bacteria | 786 |
| 562 | Ga0496119_0001290 | 3300048922 | Bacteria | 30949 |
| 563 | Ga0496119_0006046 | 3300048922 | Bacteria | 11353 |
| 564 | Ga0496119_0029762 | 3300048922 | Bacteria | 3693 |
| 565 | Ga0496119_0045975 | 3300048922 | Bacteria | 2731 |
| 566 | Ga0496120_0018289 | 3300048923 | Bacteria | 4523 |
| 567 | Ga0496121_0151636 | 3300048924 | Bacteria | 1705 |
| 568 | Ga0496124_0030661 | 3300048927 | Bacteria | 4769 |
| 569 | Ga0496125_0064038 | 3300048928 | Bacteria | 2926 |
| 570 | Ga0496125_0096337 | 3300048928 | Bacteria | 2197 |
| 571 | Ga0496125_0226274 | 3300048928 | Bacteria | 1200 |
| 572 | Ga0496126_0087237 | 3300048929 | Bacteria | 2749 |
| 573 | Ga0496126_0090832 | 3300048929 | Bacteria | 2686 |
| 574 | Ga0496126_0129957 | 3300048929 | Bacteria | 2177 |
| 575 | Ga0495682_0135854 | 3300049460 | Bacteria | 879 |
| 576 | Ga0501031_0003265 | 3300049568 | Bacteria | 10420 |
| 577 | Ga0501032_0004103 | 3300049569 | Bacteria | 11037 |
| 578 | Ga0501033_0000900 | 3300049570 | Bacteria | 27183 |
| 579 | Ga0501034_0202876 | 3300049571 | Bacteria | 1940 |
| 580 | Ga0501034_0628349 | 3300049571 | Bacteria | 977 |
| 581 | Ga0501036_0044867 | 3300049572 | Bacteria | 3745 |
| 582 | Ga0501037_0004199 | 3300049573 | Bacteria | 10445 |
| 583 | Ga0501038_0007149 | 3300049574 | Bacteria | 10316 |
| 584 | Ga0501039_0011339 | 3300049575 | Bacteria | 6788 |
| 585 | Ga0501040_0300169 | 3300049576 | Bacteria | 1148 |
| 586 | Ga0501042_0010369 | 3300049578 | Bacteria | 6244 |
| 587 | Ga0501042_0208861 | 3300049578 | Bacteria | 1408 |
| 588 | Ga0501042_0396399 | 3300049578 | Bacteria | 1000 |
| 589 | Ga0501043_0010751 | 3300049579 | Bacteria | 7167 |
| 590 | Ga0501043_0376583 | 3300049579 | Bacteria | 1075 |
| 591 | Ga0501046_0006462 | 3300049580 | Bacteria | 10370 |
| 592 | Ga0501047_0058444 | 3300049581 | Bacteria | 3725 |
| 593 | Ga0501047_0330649 | 3300049581 | Bacteria | 1362 |
| 594 | Ga0501048_0004528 | 3300049582 | Bacteria | 10586 |
| 595 | Ga0501048_0188340 | 3300049582 | Bacteria | 1462 |
| 596 | Ga0501067_0143109 | 3300049583 | Bacteria | 1332 |
| 597 | Ga0501067_0401802 | 3300049583 | Unclassified | 764 |
| 598 | Ga0501068_0218015 | 3300049584 | Bacteria | 1212 |
| 599 | Ga0501069_0005540 | 3300049585 | Bacteria | 6571 |
| 600 | Ga0501069_0301684 | 3300049585 | Bacteria | 939 |
| 601 | Ga0501069_0575485 | 3300049585 | Bacteria | 675 |
| 602 | Ga0501070_0000680 | 3300049586 | Bacteria | 31108 |
| 603 | Ga0501070_0017909 | 3300049586 | Bacteria | 5947 |
| 604 | Ga0501070_0446943 | 3300049586 | Bacteria | 1042 |
| 605 | Ga0501071_0029507 | 3300049587 | Bacteria | 3872 |
| 606 | Ga0501072_1207496 | 3300049588 | Bacteria | 587 |
| 607 | Ga0501073_0004593 | 3300049589 | Bacteria | 10377 |
| 608 | Ga0501074_0043778 | 3300049590 | Bacteria | 3240 |
| 609 | Ga0501074_0432959 | 3300049590 | Unclassified | 933 |
| 610 | Ga0501074_0587874 | 3300049590 | Bacteria | 787 |
| 611 | Ga0501075_0407095 | 3300049591 | Bacteria | 1037 |
| 612 | Ga0501076_0076196 | 3300049592 | Bacteria | 2689 |
| 613 | Ga0501079_0004743 | 3300049741 | Bacteria | 10072 |
| 614 | Ga0501079_0012155 | 3300049741 | Bacteria | 6572 |
| 615 | Ga0501080_0298518 | 3300049742 | Bacteria | 1461 |
| 616 | Ga0501080_0684506 | 3300049742 | Bacteria | 905 |
| 617 | Ga0501083_0031048 | 3300049744 | Bacteria | 3666 |
| 618 | Ga0501083_0040357 | 3300049744 | Bacteria | 3168 |
| 619 | Ga0501083_0723119 | 3300049744 | Unclassified | 647 |
| 620 | Ga0501035_0000887 | 3300049822 | Bacteria | 31755 |
| 621 | Ga0501044_0009237 | 3300049823 | Bacteria | 10767 |
| 622 | Ga0501044_0067858 | 3300049823 | Bacteria | 3633 |
| 623 | Ga0501044_0545721 | 3300049823 | Bacteria | 1057 |
| 624 | Ga0501045_0080074 | 3300049824 | Bacteria | 2408 |
| 625 | nmdc:mga00v17_78423_c1 | 3300050491 | Unclassified | 2058 |
| 626 | nmdc:mga00v17_99393_c1 | 3300050491 | Bacteria | 1835 |
| 627 | nmdc:mga0qj67_158633_c1 | 3300050509 | Bacteria | 1836 |
| 628 | nmdc:mga0a205_1483_c1 | 3300050515 | Bacteria | 11129 |
| 629 | nmdc:mga0a205_6_c1 | 3300050515 | Bacteria | 129758 |
| 630 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 631 | Ga0495601_0000855 | 3300053077 | Bacteria | 16586 |
| 632 | Ga0495601_0039086 | 3300053077 | Bacteria | 2970 |
| 633 | Ga0495601_0085532 | 3300053077 | Bacteria | 2026 |
| 634 | Ga0495601_0198319 | 3300053077 | Bacteria | 1312 |
| 635 | Ga0495601_0203682 | 3300053077 | Bacteria | 1293 |
| 636 | Ga0495601_0210744 | 3300053077 | Bacteria | 1269 |
| 637 | Ga0495601_0230207 | 3300053077 | Bacteria | 1210 |
| 638 | Ga0495601_0334959 | 3300053077 | Bacteria | 985 |
| 639 | Ga0495601_0643775 | 3300053077 | Bacteria | 678 |
| 640 | Ga0495612_0000164 | 3300053078 | Bacteria | 27579 |
| 641 | Ga0495612_0006025 | 3300053078 | Bacteria | 4995 |
| 642 | Ga0495612_0012980 | 3300053078 | Bacteria | 3356 |
| 643 | Ga0495612_0084713 | 3300053078 | Bacteria | 1335 |
| 644 | Ga0495612_0250617 | 3300053078 | Bacteria | 788 |
| 645 | Ga0495612_0412231 | 3300053078 | Unclassified | 615 |
| 646 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 647 | Ga0495655_0011759 | 3300053083 | Unclassified | 1766 |
| 648 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 649 | Ga0495595_0156854 | 3300053084 | Bacteria | 1122 |
| 650 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 651 | Ga0495619_0000116 | 3300053085 | Bacteria | 58748 |
| 652 | Ga0495619_0000157 | 3300053085 | Bacteria | 49848 |
| 653 | Ga0495619_0001204 | 3300053085 | Bacteria | 16989 |
| 654 | Ga0495619_0003131 | 3300053085 | Bacteria | 10732 |
| 655 | Ga0495619_0044114 | 3300053085 | Bacteria | 2925 |
| 656 | Ga0495619_0268201 | 3300053085 | Bacteria | 1183 |
| 657 | Ga0500643_213611 | 3300053087 | Bacteria | 518 |
| 658 | Ga0500566_0022439 | 3300053094 | Bacteria | 3708 |
| 659 | Ga0500566_0075425 | 3300053094 | Bacteria | 1887 |
| 660 | Ga0500641_0208742 | 3300053096 | Bacteria | 832 |
| 661 | Ga0500572_076874 | 3300053111 | Bacteria | 1040 |
| 662 | Ga0500595_054701 | 3300053119 | Bacteria | 1224 |
| 663 | Ga0500595_057063 | 3300053119 | Bacteria | 1191 |
| 664 | Ga0500614_001338 | 3300053123 | Bacteria | 5937 |
| 665 | Ga0500628_000033 | 3300053129 | Bacteria | 52431 |
| 666 | Ga0500568_0060755 | 3300053139 | Bacteria | 1463 |
| 667 | Ga0501084_1534596 | 3300054114 | Unclassified | 557 |
| 668 | Ga0501082_0302140 | 3300060353 | Bacteria | 1394 |
| 669 | Ga0501082_0517109 | 3300060353 | Bacteria | 1043 |
| 670 | Ga0501082_1720997 | 3300060353 | Unclassified | 547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053077 | Ga0495601_0230207 | Ga0495601_0230207_893_1195 | 100 |
| 2 | 3300005455 | Ga0070663_100078648 | Ga0070663_1000786483 | 107 |
| 3 | 3300026067 | Ga0207678_10100948 | Ga0207678_101009483 | 107 |
| 4 | 3300028666 | Ga0265336_10021063 | Ga0265336_100210632 | 107 |
| 5 | 3300031239 | Ga0265328_10001094 | Ga0265328_1000109410 | 107 |
| 6 | 3300031344 | Ga0265316_10035392 | Ga0265316_100353924 | 107 |
| 7 | 3300026116 | Ga0207674_11165993 | Ga0207674_111659932 | 110 |
| 8 | 3300046499 | Ga0495594_0000029 | Ga0495594_0000029_31535_31870 | 111 |
| 9 | 3300046557 | Ga0495622_0000550 | Ga0495622_0000550_21678_22013 | 111 |
| 10 | 3300010375 | Ga0105239_10198120 | Ga0105239_101981203 | 118 |
| 11 | 3300013296 | Ga0157374_10001772 | Ga0157374_100017729 | 118 |
| 12 | 3300013296 | Ga0157374_10140331 | Ga0157374_101403313 | 118 |
| 13 | 3300013308 | Ga0157375_10001538 | Ga0157375_100015387 | 118 |
| 14 | 3300013308 | Ga0157375_10037053 | Ga0157375_100370533 | 118 |
| 15 | 3300035725 | Ga0373947_1233701 | Ga0373947_1233701_91_447 | 118 |
| 16 | 3300046454 | Ga0495592_0166417 | Ga0495592_0166417_110_466 | 118 |
| 17 | 3300046455 | Ga0495603_0001389 | Ga0495603_0001389_12817_13173 | 118 |
| 18 | 3300046463 | Ga0495653_0048856 | Ga0495653_0048856_2712_3068 | 118 |
| 19 | 3300046516 | Ga0495628_0117946 | Ga0495628_0117946_1633_1989 | 118 |
| 20 | 3300046517 | Ga0495630_0149936 | Ga0495630_0149936_219_575 | 118 |
| 21 | 3300046536 | Ga0495587_0019281 | Ga0495587_0019281_2719_3075 | 118 |
| 22 | 3300046559 | Ga0495667_0000018 | Ga0495667_0000018_66032_66388 | 118 |
| 23 | 3300046615 | Ga0495656_0001090 | Ga0495656_0001090_1429_1785 | 118 |
| 24 | 3300046616 | Ga0495668_0720470 | Ga0495668_0720470_122_478 | 118 |
| 25 | 3300046683 | Ga0495658_0509780 | Ga0495658_0509780_239_595 | 118 |
| 26 | 3300047317 | Ga0495604_0046921 | Ga0495604_0046921_819_1175 | 118 |
| 27 | 3300047322 | Ga0495680_0004286 | Ga0495680_0004286_2606_2962 | 118 |
| 28 | 3300048903 | Ga0496100_1454953 | Ga0496100_1454953_12_368 | 118 |
| 29 | 3300048904 | Ga0496101_0556121 | Ga0496101_0556121_421_777 | 118 |
| 30 | 3300048911 | Ga0496108_0000587 | Ga0496108_0000587_1574_1930 | 118 |
| 31 | 3300048912 | Ga0496109_0001118 | Ga0496109_0001118_12159_12515 | 118 |
| 32 | 3300048917 | Ga0496114_0287856 | Ga0496114_0287856_530_886 | 118 |
| 33 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_110420_110776 | 118 |
| 34 | 3300050515 | nmdc:mga0a205_1483_c1 | nmdc:mga0a205_1483_c1_9275_9631 | 118 |
| 35 | 3300050515 | nmdc:mga0a205_6_c1 | nmdc:mga0a205_6_c1_113249_113605 | 118 |
| 36 | 3300046516 | Ga0495628_0880669 | Ga0495628_0880669_70_435 | 119 |
| 37 | 3300001977 | JGI24746J21847_1000470 | JGI24746J21847_10004704 | 120 |
| 38 | 3300001979 | JGI24740J21852_10003186 | JGI24740J21852_100031866 | 120 |
| 39 | 3300002074 | JGI24748J21848_1000663 | JGI24748J21848_10006633 | 120 |
| 40 | 3300002239 | JGI24034J26672_10000455 | JGI24034J26672_100004555 | 120 |
| 41 | 3300002244 | JGI24742J22300_10033543 | JGI24742J22300_100335432 | 120 |
| 42 | 3300002459 | JGI24751J29686_10100313 | JGI24751J29686_101003131 | 120 |
| 43 | 3300003203 | JGI25406J46586_10045753 | JGI25406J46586_100457533 | 120 |
| 44 | 3300003659 | JGI25404J52841_10010894 | JGI25404J52841_100108942 | 120 |
| 45 | 3300005329 | Ga0070683_100003109 | Ga0070683_1000031096 | 120 |
| 46 | 3300005329 | Ga0070683_100085314 | Ga0070683_1000853142 | 120 |
| 47 | 3300005333 | Ga0070677_10000022 | Ga0070677_1000002237 | 120 |
| 48 | 3300005336 | Ga0070680_100149554 | Ga0070680_1001495543 | 120 |
| 49 | 3300005337 | Ga0070682_100000099 | Ga0070682_10000009986 | 120 |
| 50 | 3300005337 | Ga0070682_100308430 | Ga0070682_1003084303 | 120 |
| 51 | 3300005337 | Ga0070682_100431138 | Ga0070682_1004311383 | 120 |
| 52 | 3300005338 | Ga0068868_100000450 | Ga0068868_10000045017 | 120 |
| 53 | 3300005340 | Ga0070689_101117630 | Ga0070689_1011176302 | 120 |
| 54 | 3300005341 | Ga0070691_10000379 | Ga0070691_1000037910 | 120 |
| 55 | 3300005354 | Ga0070675_101583876 | Ga0070675_1015838761 | 120 |
| 56 | 3300005356 | Ga0070674_100000090 | Ga0070674_10000009023 | 120 |
| 57 | 3300005356 | Ga0070674_100000683 | Ga0070674_1000006834 | 120 |
| 58 | 3300005364 | Ga0070673_100005169 | Ga0070673_10000516910 | 120 |
| 59 | 3300005366 | Ga0070659_100013281 | Ga0070659_1000132817 | 120 |
| 60 | 3300005406 | Ga0070703_10038768 | Ga0070703_100387683 | 120 |
| 61 | 3300005438 | Ga0070701_10592547 | Ga0070701_105925472 | 120 |
| 62 | 3300005439 | Ga0070711_100000734 | Ga0070711_1000007347 | 120 |
| 63 | 3300005441 | Ga0070700_100097331 | Ga0070700_1000973312 | 120 |
| 64 | 3300005456 | Ga0070678_100128638 | Ga0070678_1001286382 | 120 |
| 65 | 3300005456 | Ga0070678_100338615 | Ga0070678_1003386153 | 120 |
| 66 | 3300005459 | Ga0068867_100000796 | Ga0068867_1000007968 | 120 |
| 67 | 3300005466 | Ga0070685_10739997 | Ga0070685_107399971 | 120 |
| 68 | 3300005530 | Ga0070679_100000243 | Ga0070679_1000002434 | 120 |
| 69 | 3300005535 | Ga0070684_100055354 | Ga0070684_1000553544 | 120 |
| 70 | 3300005535 | Ga0070684_100108294 | Ga0070684_1001082943 | 120 |
| 71 | 3300005535 | Ga0070684_100631284 | Ga0070684_1006312843 | 120 |
| 72 | 3300005539 | Ga0068853_100042402 | Ga0068853_1000424023 | 120 |
| 73 | 3300005539 | Ga0068853_100212198 | Ga0068853_1002121981 | 120 |
| 74 | 3300005545 | Ga0070695_100076867 | Ga0070695_1000768672 | 120 |
| 75 | 3300005548 | Ga0070665_100000106 | Ga0070665_10000010614 | 120 |
| 76 | 3300005548 | Ga0070665_100513584 | Ga0070665_1005135842 | 120 |
| 77 | 3300005548 | Ga0070665_100532510 | Ga0070665_1005325103 | 120 |
| 78 | 3300005548 | Ga0070665_100646222 | Ga0070665_1006462222 | 120 |
| 79 | 3300005549 | Ga0070704_100098991 | Ga0070704_1000989912 | 120 |
| 80 | 3300005563 | Ga0068855_100220175 | Ga0068855_1002201752 | 120 |
| 81 | 3300005578 | Ga0068854_100040165 | Ga0068854_1000401654 | 120 |
| 82 | 3300005614 | Ga0068856_100009431 | Ga0068856_1000094313 | 120 |
| 83 | 3300005614 | Ga0068856_100529929 | Ga0068856_1005299292 | 120 |
| 84 | 3300005615 | Ga0070702_100061922 | Ga0070702_1000619223 | 120 |
| 85 | 3300005616 | Ga0068852_101880785 | Ga0068852_1018807852 | 120 |
| 86 | 3300005617 | Ga0068859_102252646 | Ga0068859_1022526462 | 120 |
| 87 | 3300005618 | Ga0068864_100000053 | Ga0068864_100000053104 | 120 |
| 88 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001423 | 120 |
| 89 | 3300005718 | Ga0068866_10000685 | Ga0068866_100006854 | 120 |
| 90 | 3300005719 | Ga0068861_100185142 | Ga0068861_1001851422 | 120 |
| 91 | 3300005719 | Ga0068861_100863997 | Ga0068861_1008639972 | 120 |
| 92 | 3300005841 | Ga0068863_100000342 | Ga0068863_10000034241 | 120 |
| 93 | 3300005841 | Ga0068863_100010993 | Ga0068863_10001099310 | 120 |
| 94 | 3300005841 | Ga0068863_100024630 | Ga0068863_1000246307 | 120 |
| 95 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009169 | 120 |
| 96 | 3300005842 | Ga0068858_100000065 | Ga0068858_10000006543 | 120 |
| 97 | 3300005843 | Ga0068860_100015414 | Ga0068860_1000154148 | 120 |
| 98 | 3300005843 | Ga0068860_100045535 | Ga0068860_1000455352 | 120 |
| 99 | 3300005937 | Ga0081455_10079300 | Ga0081455_100793002 | 120 |
| 100 | 3300005937 | Ga0081455_10134122 | Ga0081455_101341222 | 120 |
| 101 | 3300005981 | Ga0081538_10000224 | Ga0081538_1000022462 | 120 |
| 102 | 3300005981 | Ga0081538_10000292 | Ga0081538_1000029228 | 120 |
| 103 | 3300005981 | Ga0081538_10038874 | Ga0081538_100388742 | 120 |
| 104 | 3300005983 | Ga0081540_1000163 | Ga0081540_100016358 | 120 |
| 105 | 3300005985 | Ga0081539_10009804 | Ga0081539_100098049 | 120 |
| 106 | 3300005985 | Ga0081539_10036425 | Ga0081539_100364252 | 120 |
| 107 | 3300006051 | Ga0075364_10301570 | Ga0075364_103015702 | 120 |
| 108 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001390 | 120 |
| 109 | 3300006175 | Ga0070712_101414369 | Ga0070712_1014143691 | 120 |
| 110 | 3300006846 | Ga0075430_100251755 | Ga0075430_1002517552 | 120 |
| 111 | 3300006846 | Ga0075430_100474680 | Ga0075430_1004746802 | 120 |
| 112 | 3300006852 | Ga0075433_10000900 | Ga0075433_1000090013 | 120 |
| 113 | 3300006881 | Ga0068865_100123957 | Ga0068865_1001239573 | 120 |
| 114 | 3300006931 | Ga0097620_102253579 | Ga0097620_1022535791 | 120 |
| 115 | 3300009093 | Ga0105240_10484914 | Ga0105240_104849143 | 120 |
| 116 | 3300009098 | Ga0105245_10000020 | Ga0105245_1000002017 | 120 |
| 117 | 3300009098 | Ga0105245_10005635 | Ga0105245_100056353 | 120 |
| 118 | 3300009098 | Ga0105245_10733841 | Ga0105245_107338412 | 120 |
| 119 | 3300009101 | Ga0105247_10000316 | Ga0105247_1000031627 | 120 |
| 120 | 3300009101 | Ga0105247_10091080 | Ga0105247_100910802 | 120 |
| 121 | 3300009147 | Ga0114129_11055251 | Ga0114129_110552512 | 120 |
| 122 | 3300009148 | Ga0105243_10203452 | Ga0105243_102034522 | 120 |
| 123 | 3300009176 | Ga0105242_10000032 | Ga0105242_1000003226 | 120 |
| 124 | 3300009176 | Ga0105242_10000454 | Ga0105242_100004545 | 120 |
| 125 | 3300009176 | Ga0105242_10034640 | Ga0105242_100346404 | 120 |
| 126 | 3300009177 | Ga0105248_10952990 | Ga0105248_109529902 | 120 |
| 127 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011219 | 120 |
| 128 | 3300009553 | Ga0105249_10000080 | Ga0105249_1000008040 | 120 |
| 129 | 3300009553 | Ga0105249_10236597 | Ga0105249_102365972 | 120 |
| 130 | 3300009553 | Ga0105249_10278023 | Ga0105249_102780233 | 120 |
| 131 | 3300009553 | Ga0105249_13559026 | Ga0105249_135590261 | 120 |
| 132 | 3300011119 | Ga0105246_10086734 | Ga0105246_100867342 | 120 |
| 133 | 3300013297 | Ga0157378_10066419 | Ga0157378_100664193 | 120 |
| 134 | 3300013307 | Ga0157372_13462531 | Ga0157372_134625311 | 120 |
| 135 | 3300013308 | Ga0157375_10001213 | Ga0157375_100012138 | 120 |
| 136 | 3300013308 | Ga0157375_10623423 | Ga0157375_106234233 | 120 |
| 137 | 3300013308 | Ga0157375_11231945 | Ga0157375_112319451 | 120 |
| 138 | 3300014325 | Ga0163163_10333782 | Ga0163163_103337823 | 120 |
| 139 | 3300014325 | Ga0163163_10834815 | Ga0163163_108348153 | 120 |
| 140 | 3300014325 | Ga0163163_11084014 | Ga0163163_110840142 | 120 |
| 141 | 3300014326 | Ga0157380_11167437 | Ga0157380_111674372 | 120 |
| 142 | 3300014968 | Ga0157379_10215488 | Ga0157379_102154881 | 120 |
| 143 | 3300014968 | Ga0157379_10436563 | Ga0157379_104365631 | 120 |
| 144 | 3300014969 | Ga0157376_10025483 | Ga0157376_100254835 | 120 |
| 145 | 3300017792 | Ga0163161_10303339 | Ga0163161_103033392 | 120 |
| 146 | 3300025885 | Ga0207653_10052614 | Ga0207653_100526142 | 120 |
| 147 | 3300025893 | Ga0207682_10000005 | Ga0207682_1000000546 | 120 |
| 148 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002142 | 120 |
| 149 | 3300025899 | Ga0207642_10000281 | Ga0207642_1000028116 | 120 |
| 150 | 3300025900 | Ga0207710_10000458 | Ga0207710_100004588 | 120 |
| 151 | 3300025900 | Ga0207710_10047351 | Ga0207710_100473511 | 120 |
| 152 | 3300025905 | Ga0207685_10000027 | Ga0207685_1000002783 | 120 |
| 153 | 3300025916 | Ga0207663_10000498 | Ga0207663_100004987 | 120 |
| 154 | 3300025917 | Ga0207660_10117921 | Ga0207660_101179213 | 120 |
| 155 | 3300025921 | Ga0207652_10002027 | Ga0207652_1000202715 | 120 |
| 156 | 3300025923 | Ga0207681_10059820 | Ga0207681_100598203 | 120 |
| 157 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004403 | 120 |
| 158 | 3300025927 | Ga0207687_10000013 | Ga0207687_1000001359 | 120 |
| 159 | 3300025927 | Ga0207687_10002226 | Ga0207687_100022265 | 120 |
| 160 | 3300025929 | Ga0207664_10333168 | Ga0207664_103331682 | 120 |
| 161 | 3300025932 | Ga0207690_10012815 | Ga0207690_100128156 | 120 |
| 162 | 3300025933 | Ga0207706_10000012 | Ga0207706_1000001258 | 120 |
| 163 | 3300025934 | Ga0207686_10000048 | Ga0207686_1000004826 | 120 |
| 164 | 3300025934 | Ga0207686_10000447 | Ga0207686_1000044716 | 120 |
| 165 | 3300025934 | Ga0207686_10017927 | Ga0207686_100179274 | 120 |
| 166 | 3300025934 | Ga0207686_10021013 | Ga0207686_100210133 | 120 |
| 167 | 3300025935 | Ga0207709_10116622 | Ga0207709_101166223 | 120 |
| 168 | 3300025937 | Ga0207669_10000018 | Ga0207669_100000184 | 120 |
| 169 | 3300025937 | Ga0207669_10000096 | Ga0207669_1000009624 | 120 |
| 170 | 3300025938 | Ga0207704_10215492 | Ga0207704_102154922 | 120 |
| 171 | 3300025941 | Ga0207711_11317632 | Ga0207711_113176322 | 120 |
| 172 | 3300025944 | Ga0207661_10007582 | Ga0207661_100075825 | 120 |
| 173 | 3300025944 | Ga0207661_10011874 | Ga0207661_100118746 | 120 |
| 174 | 3300025944 | Ga0207661_10237798 | Ga0207661_102377983 | 120 |
| 175 | 3300025945 | Ga0207679_11714745 | Ga0207679_117147451 | 120 |
| 176 | 3300025949 | Ga0207667_10184223 | Ga0207667_101842232 | 120 |
| 177 | 3300025960 | Ga0207651_10033652 | Ga0207651_100336524 | 120 |
| 178 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007433 | 120 |
| 179 | 3300025961 | Ga0207712_10084764 | Ga0207712_100847642 | 120 |
| 180 | 3300025961 | Ga0207712_10168968 | Ga0207712_101689682 | 120 |
| 181 | 3300025981 | Ga0207640_10003186 | Ga0207640_100031868 | 120 |
| 182 | 3300026023 | Ga0207677_10000200 | Ga0207677_1000020035 | 120 |
| 183 | 3300026035 | Ga0207703_10000018 | Ga0207703_1000001843 | 120 |
| 184 | 3300026035 | Ga0207703_10000023 | Ga0207703_1000002376 | 120 |
| 185 | 3300026041 | Ga0207639_10070507 | Ga0207639_100705073 | 120 |
| 186 | 3300026041 | Ga0207639_10108827 | Ga0207639_101088273 | 120 |
| 187 | 3300026075 | Ga0207708_10146463 | Ga0207708_101464632 | 120 |
| 188 | 3300026078 | Ga0207702_10004125 | Ga0207702_1000412512 | 120 |
| 189 | 3300026078 | Ga0207702_10485326 | Ga0207702_104853262 | 120 |
| 190 | 3300026078 | Ga0207702_11458704 | Ga0207702_114587042 | 120 |
| 191 | 3300026088 | Ga0207641_10000238 | Ga0207641_1000023875 | 120 |
| 192 | 3300026088 | Ga0207641_10004805 | Ga0207641_100048053 | 120 |
| 193 | 3300026089 | Ga0207648_10008647 | Ga0207648_100086474 | 120 |
| 194 | 3300026095 | Ga0207676_10000195 | Ga0207676_1000019534 | 120 |
| 195 | 3300026118 | Ga0207675_100129425 | Ga0207675_1001294252 | 120 |
| 196 | 3300026118 | Ga0207675_100955456 | Ga0207675_1009554562 | 120 |
| 197 | 3300026121 | Ga0207683_10012162 | Ga0207683_100121622 | 120 |
| 198 | 3300026121 | Ga0207683_10507001 | Ga0207683_105070012 | 120 |
| 199 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047166 | 120 |
| 200 | 3300028379 | Ga0268266_10617569 | Ga0268266_106175692 | 120 |
| 201 | 3300028379 | Ga0268266_11037507 | Ga0268266_110375071 | 120 |
| 202 | 3300028381 | Ga0268264_10029949 | Ga0268264_100299493 | 120 |
| 203 | 3300028381 | Ga0268264_10404945 | Ga0268264_104049452 | 120 |
| 204 | 3300028556 | Ga0265337_1000807 | Ga0265337_10008079 | 120 |
| 205 | 3300028573 | Ga0265334_10072019 | Ga0265334_100720193 | 120 |
| 206 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001380 | 120 |
| 207 | 3300029957 | Ga0265324_10000755 | Ga0265324_100007558 | 120 |
| 208 | 3300031238 | Ga0265332_10089355 | Ga0265332_100893553 | 120 |
| 209 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002379 | 120 |
| 210 | 3300031242 | Ga0265329_10010994 | Ga0265329_100109945 | 120 |
| 211 | 3300031249 | Ga0265339_10040002 | Ga0265339_100400023 | 120 |
| 212 | 3300031250 | Ga0265331_10009837 | Ga0265331_100098374 | 120 |
| 213 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011379 | 120 |
| 214 | 3300031456 | Ga0307513_10422210 | Ga0307513_104222103 | 120 |
| 215 | 3300031711 | Ga0265314_10000062 | Ga0265314_10000062113 | 120 |
| 216 | 3300031712 | Ga0265342_10130167 | Ga0265342_101301673 | 120 |
| 217 | 3300031727 | Ga0316576_10002655 | Ga0316576_100026559 | 120 |
| 218 | 3300031727 | Ga0316576_10766085 | Ga0316576_107660851 | 120 |
| 219 | 3300031728 | Ga0316578_10272663 | Ga0316578_102726632 | 120 |
| 220 | 3300032133 | Ga0316583_10075817 | Ga0316583_100758172 | 120 |
| 221 | 3300035117 | Ga0373953_0537388 | Ga0373953_0537388_147_509 | 120 |
| 222 | 3300035120 | Ga0373957_0169454 | Ga0373957_0169454_213_575 | 120 |
| 223 | 3300035172 | Ga0373955_0131489 | Ga0373955_0131489_970_1332 | 120 |
| 224 | 3300035398 | Ga0316574_0007038 | Ga0316574_0007038_131_493 | 120 |
| 225 | 3300035398 | Ga0316574_0020608 | Ga0316574_0020608_569_931 | 120 |
| 226 | 3300035398 | Ga0316574_0769129 | Ga0316574_0769129_192_554 | 120 |
| 227 | 3300035724 | Ga0373933_0514565 | Ga0373933_0514565_325_687 | 120 |
| 228 | 3300036401 | Ga0373937_0065492 | Ga0373937_0065492_1414_1776 | 120 |
| 229 | 3300036712 | Ga0316584_0005290 | Ga0316584_0005290_3615_3977 | 120 |
| 230 | 3300036712 | Ga0316584_0361150 | Ga0316584_0361150_277_639 | 120 |
| 231 | 3300041463 | Ga0451804_1065570 | Ga0451804_1065570_91_453 | 120 |
| 232 | 3300041505 | Ga0451849_0214338 | Ga0451849_0214338_103_465 | 120 |
| 233 | 3300041512 | Ga0451853_2765288 | Ga0451853_2765288_1112_1474 | 120 |
| 234 | 3300044694 | Ga0466963_0000153 | Ga0466963_0000153_6267_6629 | 120 |
| 235 | 3300044694 | Ga0466963_0108599 | Ga0466963_0108599_1514_1876 | 120 |
| 236 | 3300045976 | Ga0466967_0006679 | Ga0466967_0006679_7116_7478 | 120 |
| 237 | 3300045976 | Ga0466967_0800594 | Ga0466967_0800594_151_513 | 120 |
| 238 | 3300045976 | Ga0466967_1069266 | Ga0466967_1069266_392_754 | 120 |
| 239 | 3300046454 | Ga0495592_0389916 | Ga0495592_0389916_69_431 | 120 |
| 240 | 3300046455 | Ga0495603_0001462 | Ga0495603_0001462_3801_4163 | 120 |
| 241 | 3300046455 | Ga0495603_0806219 | Ga0495603_0806219_107_469 | 120 |
| 242 | 3300046459 | Ga0495629_0000509 | Ga0495629_0000509_853_1215 | 120 |
| 243 | 3300046459 | Ga0495629_0045971 | Ga0495629_0045971_2294_2656 | 120 |
| 244 | 3300046459 | Ga0495629_0308837 | Ga0495629_0308837_563_925 | 120 |
| 245 | 3300046460 | Ga0495638_0016284 | Ga0495638_0016284_4543_4905 | 120 |
| 246 | 3300046461 | Ga0495641_0000228 | Ga0495641_0000228_14510_14872 | 120 |
| 247 | 3300046461 | Ga0495641_0542231 | Ga0495641_0542231_54_416 | 120 |
| 248 | 3300046463 | Ga0495653_0233765 | Ga0495653_0233765_704_1066 | 120 |
| 249 | 3300046463 | Ga0495653_0240081 | Ga0495653_0240081_144_506 | 120 |
| 250 | 3300046463 | Ga0495653_0417681 | Ga0495653_0417681_175_537 | 120 |
| 251 | 3300046463 | Ga0495653_0572655 | Ga0495653_0572655_183_545 | 120 |
| 252 | 3300046463 | Ga0495653_0592416 | Ga0495653_0592416_202_564 | 120 |
| 253 | 3300046473 | Ga0495582_0000726 | Ga0495582_0000726_381_743 | 120 |
| 254 | 3300046476 | Ga0495662_0028052 | Ga0495662_0028052_2290_2658 | 120 |
| 255 | 3300046477 | Ga0495664_0427419 | Ga0495664_0427419_38_400 | 120 |
| 256 | 3300046511 | Ga0495608_0000529 | Ga0495608_0000529_24031_24393 | 120 |
| 257 | 3300046511 | Ga0495608_0036783 | Ga0495608_0036783_1848_2210 | 120 |
| 258 | 3300046514 | Ga0495618_0204870 | Ga0495618_0204870_749_1111 | 120 |
| 259 | 3300046514 | Ga0495618_0378611 | Ga0495618_0378611_254_616 | 120 |
| 260 | 3300046515 | Ga0495620_0000824 | Ga0495620_0000824_17478_17840 | 120 |
| 261 | 3300046516 | Ga0495628_0009655 | Ga0495628_0009655_4954_5316 | 120 |
| 262 | 3300046516 | Ga0495628_0041865 | Ga0495628_0041865_1441_1803 | 120 |
| 263 | 3300046516 | Ga0495628_0080155 | Ga0495628_0080155_385_804 | 120 |
| 264 | 3300046516 | Ga0495628_0139014 | Ga0495628_0139014_375_737 | 120 |
| 265 | 3300046516 | Ga0495628_0376004 | Ga0495628_0376004_125_487 | 120 |
| 266 | 3300046516 | Ga0495628_0498713 | Ga0495628_0498713_476_838 | 120 |
| 267 | 3300046517 | Ga0495630_0009440 | Ga0495630_0009440_2045_2407 | 120 |
| 268 | 3300046517 | Ga0495630_0085507 | Ga0495630_0085507_554_916 | 120 |
| 269 | 3300046517 | Ga0495630_0544007 | Ga0495630_0544007_366_728 | 120 |
| 270 | 3300046523 | Ga0495644_0014524 | Ga0495644_0014524_1373_1735 | 120 |
| 271 | 3300046523 | Ga0495644_0244209 | Ga0495644_0244209_261_623 | 120 |
| 272 | 3300046529 | Ga0495652_0000407 | Ga0495652_0000407_24663_25025 | 120 |
| 273 | 3300046529 | Ga0495652_0045375 | Ga0495652_0045375_1573_1935 | 120 |
| 274 | 3300046529 | Ga0495652_0254272 | Ga0495652_0254272_912_1274 | 120 |
| 275 | 3300046533 | Ga0495640_0036783 | Ga0495640_0036783_2644_3006 | 120 |
| 276 | 3300046533 | Ga0495640_0091005 | Ga0495640_0091005_434_802 | 120 |
| 277 | 3300046535 | Ga0495586_0021614 | Ga0495586_0021614_2624_2986 | 120 |
| 278 | 3300046535 | Ga0495586_0305432 | Ga0495586_0305432_413_781 | 120 |
| 279 | 3300046536 | Ga0495587_0047777 | Ga0495587_0047777_1962_2369 | 120 |
| 280 | 3300046536 | Ga0495587_0532161 | Ga0495587_0532161_57_419 | 120 |
| 281 | 3300046537 | Ga0495598_0002610 | Ga0495598_0002610_2600_2962 | 120 |
| 282 | 3300046539 | Ga0495621_0006858 | Ga0495621_0006858_1564_1926 | 120 |
| 283 | 3300046539 | Ga0495621_0066218 | Ga0495621_0066218_536_898 | 120 |
| 284 | 3300046543 | Ga0495645_0006445 | Ga0495645_0006445_6192_6554 | 120 |
| 285 | 3300046543 | Ga0495645_0019986 | Ga0495645_0019986_2035_2397 | 120 |
| 286 | 3300046559 | Ga0495667_0074568 | Ga0495667_0074568_1361_1723 | 120 |
| 287 | 3300046642 | Ga0495634_0000059 | Ga0495634_0000059_51759_52121 | 120 |
| 288 | 3300046642 | Ga0495634_0015499 | Ga0495634_0015499_2696_3058 | 120 |
| 289 | 3300046642 | Ga0495634_0253327 | Ga0495634_0253327_418_780 | 120 |
| 290 | 3300046642 | Ga0495634_0349180 | Ga0495634_0349180_72_440 | 120 |
| 291 | 3300046642 | Ga0495634_0552366 | Ga0495634_0552366_199_561 | 120 |
| 292 | 3300046660 | Ga0495625_0000756 | Ga0495625_0000756_3327_3689 | 120 |
| 293 | 3300046663 | Ga0495635_0124963 | Ga0495635_0124963_899_1261 | 120 |
| 294 | 3300046663 | Ga0495635_0220008 | Ga0495635_0220008_45_407 | 120 |
| 295 | 3300046663 | Ga0495635_0312271 | Ga0495635_0312271_57_419 | 120 |
| 296 | 3300046663 | Ga0495635_0587810 | Ga0495635_0587810_159_521 | 120 |
| 297 | 3300046663 | Ga0495635_0944979 | Ga0495635_0944979_117_479 | 120 |
| 298 | 3300046675 | Ga0495657_0051214 | Ga0495657_0051214_2359_2721 | 120 |
| 299 | 3300046678 | Ga0495599_0018403 | Ga0495599_0018403_2140_2502 | 120 |
| 300 | 3300046678 | Ga0495599_0074998 | Ga0495599_0074998_1156_1518 | 120 |
| 301 | 3300046679 | Ga0495623_0383476 | Ga0495623_0383476_348_710 | 120 |
| 302 | 3300046679 | Ga0495623_0723111 | Ga0495623_0723111_96_458 | 120 |
| 303 | 3300046680 | Ga0495646_0174008 | Ga0495646_0174008_485_847 | 120 |
| 304 | 3300046680 | Ga0495646_0381400 | Ga0495646_0381400_161_523 | 120 |
| 305 | 3300046681 | Ga0495647_0009525 | Ga0495647_0009525_354_716 | 120 |
| 306 | 3300046683 | Ga0495658_0000034 | Ga0495658_0000034_51404_51766 | 120 |
| 307 | 3300046683 | Ga0495658_1079639 | Ga0495658_1079639_107_469 | 120 |
| 308 | 3300046684 | Ga0495669_0000310 | Ga0495669_0000310_284_646 | 120 |
| 309 | 3300046689 | Ga0495613_0004320 | Ga0495613_0004320_7550_7918 | 120 |
| 310 | 3300046689 | Ga0495613_0071867 | Ga0495613_0071867_264_626 | 120 |
| 311 | 3300046689 | Ga0495613_0123022 | Ga0495613_0123022_711_1073 | 120 |
| 312 | 3300046690 | Ga0495624_0002509 | Ga0495624_0002509_6184_6600 | 120 |
| 313 | 3300046691 | Ga0495670_0019959 | Ga0495670_0019959_389_751 | 120 |
| 314 | 3300046694 | Ga0495649_0008541 | Ga0495649_0008541_1711_2073 | 120 |
| 315 | 3300046809 | Ga0495600_0457452 | Ga0495600_0457452_14_433 | 120 |
| 316 | 3300047315 | Ga0495581_0036815 | Ga0495581_0036815_2418_2780 | 120 |
| 317 | 3300047317 | Ga0495604_0000055 | Ga0495604_0000055_62309_62671 | 120 |
| 318 | 3300047319 | Ga0495674_0000064 | Ga0495674_0000064_44010_44372 | 120 |
| 319 | 3300047319 | Ga0495674_0112482 | Ga0495674_0112482_365_727 | 120 |
| 320 | 3300047319 | Ga0495674_0295826 | Ga0495674_0295826_891_1253 | 120 |
| 321 | 3300047320 | Ga0495672_0215233 | Ga0495672_0215233_52_414 | 120 |
| 322 | 3300047321 | Ga0495676_0000130 | Ga0495676_0000130_21422_21784 | 120 |
| 323 | 3300047321 | Ga0495676_0011318 | Ga0495676_0011318_7319_7681 | 120 |
| 324 | 3300047322 | Ga0495680_0000550 | Ga0495680_0000550_30589_30957 | 120 |
| 325 | 3300047322 | Ga0495680_0029878 | Ga0495680_0029878_2649_3011 | 120 |
| 326 | 3300047322 | Ga0495680_0143515 | Ga0495680_0143515_1005_1367 | 120 |
| 327 | 3300047446 | Ga0495679_010145 | Ga0495679_010145_2343_2705 | 120 |
| 328 | 3300047469 | Ga0495673_0020669 | Ga0495673_0020669_373_735 | 120 |
| 329 | 3300047472 | Ga0495686_0034255 | Ga0495686_0034255_2188_2550 | 120 |
| 330 | 3300047472 | Ga0495686_0082686 | Ga0495686_0082686_548_910 | 120 |
| 331 | 3300048088 | Ga0495602_0013815 | Ga0495602_0013815_1935_2297 | 120 |
| 332 | 3300048088 | Ga0495602_0215823 | Ga0495602_0215823_35_397 | 120 |
| 333 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_438002_438364 | 120 |
| 334 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_270555_270917 | 120 |
| 335 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_438002_438364 | 120 |
| 336 | 3300048904 | Ga0496101_0000101 | Ga0496101_0000101_60137_60499 | 120 |
| 337 | 3300048905 | Ga0496102_0000115 | Ga0496102_0000115_99275_99637 | 120 |
| 338 | 3300048905 | Ga0496102_0117114 | Ga0496102_0117114_311_673 | 120 |
| 339 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_106300_106662 | 120 |
| 340 | 3300048906 | Ga0496103_0072055 | Ga0496103_0072055_149_511 | 120 |
| 341 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_357029_357391 | 120 |
| 342 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_296327_296689 | 120 |
| 343 | 3300048907 | Ga0496104_0006952 | Ga0496104_0006952_1971_2333 | 120 |
| 344 | 3300048907 | Ga0496104_1628535 | Ga0496104_1628535_122_484 | 120 |
| 345 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_284440_284802 | 120 |
| 346 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_191367_191729 | 120 |
| 347 | 3300048908 | Ga0496105_0000650 | Ga0496105_0000650_1413_1775 | 120 |
| 348 | 3300048908 | Ga0496105_0440104 | Ga0496105_0440104_346_708 | 120 |
| 349 | 3300048909 | Ga0496106_0000084 | Ga0496106_0000084_50666_51028 | 120 |
| 350 | 3300048909 | Ga0496106_0000151 | Ga0496106_0000151_11366_11728 | 120 |
| 351 | 3300048909 | Ga0496106_0000682 | Ga0496106_0000682_8748_9110 | 120 |
| 352 | 3300048909 | Ga0496106_0685917 | Ga0496106_0685917_177_539 | 120 |
| 353 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_86745_87107 | 120 |
| 354 | 3300048910 | Ga0496107_0000011 | Ga0496107_0000011_40966_41328 | 120 |
| 355 | 3300048910 | Ga0496107_0761173 | Ga0496107_0761173_282_644 | 120 |
| 356 | 3300048910 | Ga0496107_1153170 | Ga0496107_1153170_184_546 | 120 |
| 357 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_733498_733860 | 120 |
| 358 | 3300048911 | Ga0496108_0029134 | Ga0496108_0029134_1718_2080 | 120 |
| 359 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_408044_408406 | 120 |
| 360 | 3300048912 | Ga0496109_0071967 | Ga0496109_0071967_2438_2800 | 120 |
| 361 | 3300048912 | Ga0496109_0405406 | Ga0496109_0405406_454_816 | 120 |
| 362 | 3300048913 | Ga0496110_0004679 | Ga0496110_0004679_8730_9092 | 120 |
| 363 | 3300048913 | Ga0496110_0023867 | Ga0496110_0023867_4192_4554 | 120 |
| 364 | 3300048913 | Ga0496110_0804744 | Ga0496110_0804744_321_722 | 120 |
| 365 | 3300048914 | Ga0496111_0148570 | Ga0496111_0148570_1359_1721 | 120 |
| 366 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_277302_277664 | 120 |
| 367 | 3300048915 | Ga0496112_0115785 | Ga0496112_0115785_1167_1529 | 120 |
| 368 | 3300048916 | Ga0496113_0062416 | Ga0496113_0062416_2084_2446 | 120 |
| 369 | 3300048916 | Ga0496113_0130971 | Ga0496113_0130971_1558_1920 | 120 |
| 370 | 3300048916 | Ga0496113_0162284 | Ga0496113_0162284_1141_1503 | 120 |
| 371 | 3300048916 | Ga0496113_0232221 | Ga0496113_0232221_1052_1414 | 120 |
| 372 | 3300048916 | Ga0496113_0475892 | Ga0496113_0475892_621_983 | 120 |
| 373 | 3300048916 | Ga0496113_0761794 | Ga0496113_0761794_295_657 | 120 |
| 374 | 3300048917 | Ga0496114_0000101 | Ga0496114_0000101_25838_26200 | 120 |
| 375 | 3300048917 | Ga0496114_0012931 | Ga0496114_0012931_1707_2069 | 120 |
| 376 | 3300048918 | Ga0496115_0000200 | Ga0496115_0000200_29556_29918 | 120 |
| 377 | 3300048919 | Ga0496116_0000735 | Ga0496116_0000735_14182_14544 | 120 |
| 378 | 3300048920 | Ga0496117_0004253 | Ga0496117_0004253_10809_11171 | 120 |
| 379 | 3300048921 | Ga0496118_0000833 | Ga0496118_0000833_5706_6068 | 120 |
| 380 | 3300048921 | Ga0496118_0093077 | Ga0496118_0093077_148_510 | 120 |
| 381 | 3300048922 | Ga0496119_0001290 | Ga0496119_0001290_3405_3767 | 120 |
| 382 | 3300048922 | Ga0496119_0029762 | Ga0496119_0029762_1950_2312 | 120 |
| 383 | 3300048922 | Ga0496119_0045975 | Ga0496119_0045975_737_1099 | 120 |
| 384 | 3300048923 | Ga0496120_0018289 | Ga0496120_0018289_1749_2111 | 120 |
| 385 | 3300048928 | Ga0496125_0096337 | Ga0496125_0096337_101_463 | 120 |
| 386 | 3300048928 | Ga0496125_0226274 | Ga0496125_0226274_463_825 | 120 |
| 387 | 3300049460 | Ga0495682_0135854 | Ga0495682_0135854_427_789 | 120 |
| 388 | 3300049578 | Ga0501042_0010369 | Ga0501042_0010369_978_1340 | 120 |
| 389 | 3300049583 | Ga0501067_0401802 | Ga0501067_0401802_18_380 | 120 |
| 390 | 3300049585 | Ga0501069_0575485 | Ga0501069_0575485_81_443 | 120 |
| 391 | 3300049586 | Ga0501070_0017909 | Ga0501070_0017909_3541_3903 | 120 |
| 392 | 3300049590 | Ga0501074_0432959 | Ga0501074_0432959_20_382 | 120 |
| 393 | 3300049591 | Ga0501075_0407095 | Ga0501075_0407095_291_653 | 120 |
| 394 | 3300049592 | Ga0501076_0076196 | Ga0501076_0076196_322_684 | 120 |
| 395 | 3300049744 | Ga0501083_0723119 | Ga0501083_0723119_35_397 | 120 |
| 396 | 3300049823 | Ga0501044_0545721 | Ga0501044_0545721_133_495 | 120 |
| 397 | 3300050491 | nmdc:mga00v17_78423_c1 | nmdc:mga00v17_78423_c1_1359_1721 | 120 |
| 398 | 3300050491 | nmdc:mga00v17_99393_c1 | nmdc:mga00v17_99393_c1_264_626 | 120 |
| 399 | 3300050509 | nmdc:mga0qj67_158633_c1 | nmdc:mga0qj67_158633_c1_1362_1724 | 120 |
| 400 | 3300053077 | Ga0495601_0000855 | Ga0495601_0000855_15544_15906 | 120 |
| 401 | 3300053077 | Ga0495601_0039086 | Ga0495601_0039086_1791_2153 | 120 |
| 402 | 3300053077 | Ga0495601_0085532 | Ga0495601_0085532_671_1033 | 120 |
| 403 | 3300053077 | Ga0495601_0198319 | Ga0495601_0198319_508_870 | 120 |
| 404 | 3300053077 | Ga0495601_0203682 | Ga0495601_0203682_338_700 | 120 |
| 405 | 3300053077 | Ga0495601_0334959 | Ga0495601_0334959_82_444 | 120 |
| 406 | 3300053077 | Ga0495601_0643775 | Ga0495601_0643775_70_432 | 120 |
| 407 | 3300053078 | Ga0495612_0000164 | Ga0495612_0000164_21526_21888 | 120 |
| 408 | 3300053078 | Ga0495612_0012980 | Ga0495612_0012980_1344_1706 | 120 |
| 409 | 3300053078 | Ga0495612_0084713 | Ga0495612_0084713_700_1062 | 120 |
| 410 | 3300053078 | Ga0495612_0250617 | Ga0495612_0250617_208_570 | 120 |
| 411 | 3300053078 | Ga0495612_0412231 | Ga0495612_0412231_182_544 | 120 |
| 412 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_295263_295625 | 120 |
| 413 | 3300053084 | Ga0495595_0156854 | Ga0495595_0156854_637_999 | 120 |
| 414 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_128838_129200 | 120 |
| 415 | 3300053085 | Ga0495619_0000157 | Ga0495619_0000157_31945_32307 | 120 |
| 416 | 3300053085 | Ga0495619_0001204 | Ga0495619_0001204_12355_12717 | 120 |
| 417 | 3300053085 | Ga0495619_0003131 | Ga0495619_0003131_6402_6764 | 120 |
| 418 | 3300053085 | Ga0495619_0044114 | Ga0495619_0044114_1049_1411 | 120 |
| 419 | 3300053085 | Ga0495619_0268201 | Ga0495619_0268201_112_474 | 120 |
| 420 | 3300053094 | Ga0500566_0022439 | Ga0500566_0022439_2975_3337 | 120 |
| 421 | 3300053094 | Ga0500566_0075425 | Ga0500566_0075425_160_522 | 120 |
| 422 | 3300053096 | Ga0500641_0208742 | Ga0500641_0208742_389_751 | 120 |
| 423 | 3300053111 | Ga0500572_076874 | Ga0500572_076874_491_853 | 120 |
| 424 | 3300053119 | Ga0500595_054701 | Ga0500595_054701_161_523 | 120 |
| 425 | 3300053119 | Ga0500595_057063 | Ga0500595_057063_96_458 | 120 |
| 426 | 3300053123 | Ga0500614_001338 | Ga0500614_001338_986_1348 | 120 |
| 427 | 3300053129 | Ga0500628_000033 | Ga0500628_000033_47294_47656 | 120 |
| 428 | 3300053139 | Ga0500568_0060755 | Ga0500568_0060755_233_595 | 120 |
| 429 | 3300054114 | Ga0501084_1534596 | Ga0501084_1534596_32_394 | 120 |
| 430 | 3300060353 | Ga0501082_0302140 | Ga0501082_0302140_996_1358 | 120 |
| 431 | 3300060353 | Ga0501082_1720997 | Ga0501082_1720997_139_501 | 120 |
| 432 | 3300000546 | LJNas_1036030 | LJNas_10360302 | 121 |
| 433 | 3300002070 | JGI24750J21931_1084678 | JGI24750J21931_10846781 | 121 |
| 434 | 3300005327 | Ga0070658_10017126 | Ga0070658_100171264 | 121 |
| 435 | 3300005329 | Ga0070683_100012149 | Ga0070683_1000121497 | 121 |
| 436 | 3300005329 | Ga0070683_100012949 | Ga0070683_1000129496 | 121 |
| 437 | 3300005329 | Ga0070683_100453654 | Ga0070683_1004536542 | 121 |
| 438 | 3300005331 | Ga0070670_100193620 | Ga0070670_1001936202 | 121 |
| 439 | 3300005335 | Ga0070666_10028671 | Ga0070666_100286714 | 121 |
| 440 | 3300005336 | Ga0070680_100271909 | Ga0070680_1002719092 | 121 |
| 441 | 3300005337 | Ga0070682_102086806 | Ga0070682_1020868061 | 121 |
| 442 | 3300005344 | Ga0070661_100000102 | Ga0070661_10000010222 | 121 |
| 443 | 3300005347 | Ga0070668_100316507 | Ga0070668_1003165072 | 121 |
| 444 | 3300005347 | Ga0070668_101449615 | Ga0070668_1014496151 | 121 |
| 445 | 3300005354 | Ga0070675_100000027 | Ga0070675_10000002742 | 121 |
| 446 | 3300005365 | Ga0070688_100000738 | Ga0070688_10000073812 | 121 |
| 447 | 3300005365 | Ga0070688_100003810 | Ga0070688_1000038108 | 121 |
| 448 | 3300005367 | Ga0070667_100140750 | Ga0070667_1001407503 | 121 |
| 449 | 3300005367 | Ga0070667_100253940 | Ga0070667_1002539402 | 121 |
| 450 | 3300005367 | Ga0070667_100400187 | Ga0070667_1004001872 | 121 |
| 451 | 3300005435 | Ga0070714_100029758 | Ga0070714_1000297585 | 121 |
| 452 | 3300005436 | Ga0070713_100000085 | Ga0070713_10000008519 | 121 |
| 453 | 3300005436 | Ga0070713_100094192 | Ga0070713_1000941922 | 121 |
| 454 | 3300005439 | Ga0070711_100856043 | Ga0070711_1008560431 | 121 |
| 455 | 3300005455 | Ga0070663_100024055 | Ga0070663_1000240554 | 121 |
| 456 | 3300005456 | Ga0070678_100052362 | Ga0070678_1000523623 | 121 |
| 457 | 3300005456 | Ga0070678_101218876 | Ga0070678_1012188762 | 121 |
| 458 | 3300005466 | Ga0070685_10000141 | Ga0070685_1000014147 | 121 |
| 459 | 3300005466 | Ga0070685_10000616 | Ga0070685_1000061618 | 121 |
| 460 | 3300005466 | Ga0070685_10690849 | Ga0070685_106908492 | 121 |
| 461 | 3300005535 | Ga0070684_100078721 | Ga0070684_1000787214 | 121 |
| 462 | 3300005535 | Ga0070684_100172790 | Ga0070684_1001727902 | 121 |
| 463 | 3300005539 | Ga0068853_100346137 | Ga0068853_1003461373 | 121 |
| 464 | 3300005539 | Ga0068853_101225435 | Ga0068853_1012254351 | 121 |
| 465 | 3300005543 | Ga0070672_100001367 | Ga0070672_1000013678 | 121 |
| 466 | 3300005544 | Ga0070686_100326268 | Ga0070686_1003262681 | 121 |
| 467 | 3300005548 | Ga0070665_100000950 | Ga0070665_10000095029 | 121 |
| 468 | 3300005548 | Ga0070665_100076910 | Ga0070665_1000769103 | 121 |
| 469 | 3300005548 | Ga0070665_100102705 | Ga0070665_1001027052 | 121 |
| 470 | 3300005548 | Ga0070665_101702637 | Ga0070665_1017026372 | 121 |
| 471 | 3300005563 | Ga0068855_100456315 | Ga0068855_1004563153 | 121 |
| 472 | 3300005563 | Ga0068855_101875267 | Ga0068855_1018752672 | 121 |
| 473 | 3300005564 | Ga0070664_100168855 | Ga0070664_1001688551 | 121 |
| 474 | 3300005577 | Ga0068857_100504968 | Ga0068857_1005049682 | 121 |
| 475 | 3300005614 | Ga0068856_100000629 | Ga0068856_1000006298 | 121 |
| 476 | 3300005614 | Ga0068856_100009027 | Ga0068856_1000090277 | 121 |
| 477 | 3300005614 | Ga0068856_100251724 | Ga0068856_1002517242 | 121 |
| 478 | 3300005616 | Ga0068852_100000006 | Ga0068852_100000006141 | 121 |
| 479 | 3300005842 | Ga0068858_100701468 | Ga0068858_1007014682 | 121 |
| 480 | 3300005843 | Ga0068860_100073002 | Ga0068860_1000730024 | 121 |
| 481 | 3300005844 | Ga0068862_100004868 | Ga0068862_1000048685 | 121 |
| 482 | 3300005937 | Ga0081455_10030774 | Ga0081455_100307745 | 121 |
| 483 | 3300006175 | Ga0070712_100003543 | Ga0070712_1000035432 | 121 |
| 484 | 3300006846 | Ga0075430_101640040 | Ga0075430_1016400402 | 121 |
| 485 | 3300009093 | Ga0105240_10341878 | Ga0105240_103418782 | 121 |
| 486 | 3300009098 | Ga0105245_10000254 | Ga0105245_1000025413 | 121 |
| 487 | 3300009101 | Ga0105247_10046632 | Ga0105247_100466324 | 121 |
| 488 | 3300009101 | Ga0105247_10057391 | Ga0105247_100573912 | 121 |
| 489 | 3300009101 | Ga0105247_10793144 | Ga0105247_107931442 | 121 |
| 490 | 3300009148 | Ga0105243_10461670 | Ga0105243_104616703 | 121 |
| 491 | 3300009174 | Ga0105241_10493297 | Ga0105241_104932973 | 121 |
| 492 | 3300009176 | Ga0105242_11007705 | Ga0105242_110077051 | 121 |
| 493 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008301 | 121 |
| 494 | 3300009177 | Ga0105248_10464002 | Ga0105248_104640023 | 121 |
| 495 | 3300009545 | Ga0105237_10854796 | Ga0105237_108547962 | 121 |
| 496 | 3300009553 | Ga0105249_10122790 | Ga0105249_101227904 | 121 |
| 497 | 3300010375 | Ga0105239_10513843 | Ga0105239_105138432 | 121 |
| 498 | 3300010375 | Ga0105239_11372476 | Ga0105239_113724762 | 121 |
| 499 | 3300013104 | Ga0157370_11273517 | Ga0157370_112735172 | 121 |
| 500 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020182 | 121 |
| 501 | 3300013105 | Ga0157369_11180353 | Ga0157369_111803532 | 121 |
| 502 | 3300013297 | Ga0157378_10011377 | Ga0157378_100113779 | 121 |
| 503 | 3300013297 | Ga0157378_10262517 | Ga0157378_102625173 | 121 |
| 504 | 3300013306 | Ga0163162_10900834 | Ga0163162_109008342 | 121 |
| 505 | 3300013308 | Ga0157375_10064237 | Ga0157375_100642374 | 121 |
| 506 | 3300014325 | Ga0163163_10457811 | Ga0163163_104578112 | 121 |
| 507 | 3300014325 | Ga0163163_11613329 | Ga0163163_116133291 | 121 |
| 508 | 3300014325 | Ga0163163_11971430 | Ga0163163_119714301 | 121 |
| 509 | 3300014968 | Ga0157379_10072798 | Ga0157379_100727982 | 121 |
| 510 | 3300014968 | Ga0157379_11103525 | Ga0157379_111035252 | 121 |
| 511 | 3300014969 | Ga0157376_10302501 | Ga0157376_103025013 | 121 |
| 512 | 3300017792 | Ga0163161_10129034 | Ga0163161_101290343 | 121 |
| 513 | 3300025321 | Ga0207656_10059181 | Ga0207656_100591813 | 121 |
| 514 | 3300025900 | Ga0207710_10247242 | Ga0207710_102472421 | 121 |
| 515 | 3300025903 | Ga0207680_10006139 | Ga0207680_100061395 | 121 |
| 516 | 3300025903 | Ga0207680_10143700 | Ga0207680_101437002 | 121 |
| 517 | 3300025906 | Ga0207699_10709332 | Ga0207699_107093322 | 121 |
| 518 | 3300025909 | Ga0207705_10032908 | Ga0207705_100329083 | 121 |
| 519 | 3300025911 | Ga0207654_10600706 | Ga0207654_106007062 | 121 |
| 520 | 3300025912 | Ga0207707_10255808 | Ga0207707_102558082 | 121 |
| 521 | 3300025913 | Ga0207695_10280162 | Ga0207695_102801623 | 121 |
| 522 | 3300025915 | Ga0207693_10015289 | Ga0207693_100152896 | 121 |
| 523 | 3300025916 | Ga0207663_10380579 | Ga0207663_103805791 | 121 |
| 524 | 3300025917 | Ga0207660_11023398 | Ga0207660_110233982 | 121 |
| 525 | 3300025918 | Ga0207662_11314574 | Ga0207662_113145742 | 121 |
| 526 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009230 | 121 |
| 527 | 3300025921 | Ga0207652_10009957 | Ga0207652_100099572 | 121 |
| 528 | 3300025925 | Ga0207650_10134897 | Ga0207650_101348973 | 121 |
| 529 | 3300025926 | Ga0207659_10000010 | Ga0207659_1000001057 | 121 |
| 530 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007439 | 121 |
| 531 | 3300025928 | Ga0207700_10000027 | Ga0207700_1000002747 | 121 |
| 532 | 3300025928 | Ga0207700_10018207 | Ga0207700_100182072 | 121 |
| 533 | 3300025929 | Ga0207664_10568183 | Ga0207664_105681832 | 121 |
| 534 | 3300025935 | Ga0207709_10387917 | Ga0207709_103879171 | 121 |
| 535 | 3300025940 | Ga0207691_10003586 | Ga0207691_1000358611 | 121 |
| 536 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006695 | 121 |
| 537 | 3300025941 | Ga0207711_10321951 | Ga0207711_103219511 | 121 |
| 538 | 3300025941 | Ga0207711_10503612 | Ga0207711_105036122 | 121 |
| 539 | 3300025944 | Ga0207661_10000253 | Ga0207661_1000025332 | 121 |
| 540 | 3300025944 | Ga0207661_10000347 | Ga0207661_1000034731 | 121 |
| 541 | 3300025944 | Ga0207661_10019993 | Ga0207661_100199935 | 121 |
| 542 | 3300025944 | Ga0207661_10147525 | Ga0207661_101475252 | 121 |
| 543 | 3300025945 | Ga0207679_10254057 | Ga0207679_102540571 | 121 |
| 544 | 3300025949 | Ga0207667_10412911 | Ga0207667_104129113 | 121 |
| 545 | 3300025949 | Ga0207667_11020873 | Ga0207667_110208732 | 121 |
| 546 | 3300025961 | Ga0207712_10096858 | Ga0207712_100968582 | 121 |
| 547 | 3300025972 | Ga0207668_10026773 | Ga0207668_100267734 | 121 |
| 548 | 3300025972 | Ga0207668_11136590 | Ga0207668_111365902 | 121 |
| 549 | 3300025986 | Ga0207658_10002826 | Ga0207658_100028265 | 121 |
| 550 | 3300025986 | Ga0207658_10105875 | Ga0207658_101058753 | 121 |
| 551 | 3300026023 | Ga0207677_10018605 | Ga0207677_100186055 | 121 |
| 552 | 3300026035 | Ga0207703_11268719 | Ga0207703_112687191 | 121 |
| 553 | 3300026041 | Ga0207639_10318358 | Ga0207639_103183583 | 121 |
| 554 | 3300026041 | Ga0207639_11157892 | Ga0207639_111578922 | 121 |
| 555 | 3300026067 | Ga0207678_10006053 | Ga0207678_1000605311 | 121 |
| 556 | 3300026078 | Ga0207702_10000158 | Ga0207702_1000015870 | 121 |
| 557 | 3300026078 | Ga0207702_10300350 | Ga0207702_103003502 | 121 |
| 558 | 3300026116 | Ga0207674_10255185 | Ga0207674_102551853 | 121 |
| 559 | 3300026121 | Ga0207683_10004283 | Ga0207683_100042836 | 121 |
| 560 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001348 | 121 |
| 561 | 3300028379 | Ga0268266_10000595 | Ga0268266_1000059542 | 121 |
| 562 | 3300028379 | Ga0268266_10006385 | Ga0268266_100063857 | 121 |
| 563 | 3300028379 | Ga0268266_10129548 | Ga0268266_101295482 | 121 |
| 564 | 3300028379 | Ga0268266_10413967 | Ga0268266_104139673 | 121 |
| 565 | 3300028380 | Ga0268265_10069595 | Ga0268265_100695951 | 121 |
| 566 | 3300028381 | Ga0268264_10282597 | Ga0268264_102825972 | 121 |
| 567 | 3300028563 | Ga0265319_1000020 | Ga0265319_1000020139 | 121 |
| 568 | 3300028800 | Ga0265338_10001248 | Ga0265338_100012482 | 121 |
| 569 | 3300031241 | Ga0265325_10027972 | Ga0265325_100279723 | 121 |
| 570 | 3300031250 | Ga0265331_10039701 | Ga0265331_100397012 | 121 |
| 571 | 3300032126 | Ga0307415_100025696 | Ga0307415_1000256962 | 121 |
| 572 | 3300041486 | Ga0451807_2677790 | Ga0451807_2677790_157_522 | 121 |
| 573 | 3300044694 | Ga0466963_0111154 | Ga0466963_0111154_1315_1683 | 121 |
| 574 | 3300044694 | Ga0466963_1096648 | Ga0466963_1096648_85_453 | 121 |
| 575 | 3300045976 | Ga0466967_0000009 | Ga0466967_0000009_119332_119703 | 121 |
| 576 | 3300045976 | Ga0466967_1166160 | Ga0466967_1166160_334_699 | 121 |
| 577 | 3300046459 | Ga0495629_0003113 | Ga0495629_0003113_6022_6393 | 121 |
| 578 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_21149_21520 | 121 |
| 579 | 3300046511 | Ga0495608_0000060 | Ga0495608_0000060_1944_2315 | 121 |
| 580 | 3300046517 | Ga0495630_0000020 | Ga0495630_0000020_92289_92660 | 121 |
| 581 | 3300046660 | Ga0495625_0253451 | Ga0495625_0253451_475_846 | 121 |
| 582 | 3300046660 | Ga0495625_0367777 | Ga0495625_0367777_171_536 | 121 |
| 583 | 3300046674 | Ga0495588_0000134 | Ga0495588_0000134_24051_24422 | 121 |
| 584 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_180220_180591 | 121 |
| 585 | 3300046681 | Ga0495647_0000156 | Ga0495647_0000156_14322_14693 | 121 |
| 586 | 3300046689 | Ga0495613_0000801 | Ga0495613_0000801_21077_21448 | 121 |
| 587 | 3300046809 | Ga0495600_0056445 | Ga0495600_0056445_1875_2246 | 121 |
| 588 | 3300046810 | Ga0495660_0238943 | Ga0495660_0238943_145_516 | 121 |
| 589 | 3300047317 | Ga0495604_0000137 | Ga0495604_0000137_57962_58333 | 121 |
| 590 | 3300047320 | Ga0495672_0063979 | Ga0495672_0063979_291_662 | 121 |
| 591 | 3300047320 | Ga0495672_0157717 | Ga0495672_0157717_745_1116 | 121 |
| 592 | 3300047444 | Ga0495675_0000040 | Ga0495675_0000040_60_431 | 121 |
| 593 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_69680_70051 | 121 |
| 594 | 3300048088 | Ga0495602_0231405 | Ga0495602_0231405_981_1352 | 121 |
| 595 | 3300048088 | Ga0495602_0608090 | Ga0495602_0608090_250_621 | 121 |
| 596 | 3300048903 | Ga0496100_0182269 | Ga0496100_0182269_838_1203 | 121 |
| 597 | 3300048904 | Ga0496101_0281939 | Ga0496101_0281939_267_632 | 121 |
| 598 | 3300048906 | Ga0496103_0224914 | Ga0496103_0224914_580_945 | 121 |
| 599 | 3300048907 | Ga0496104_0008811 | Ga0496104_0008811_5619_5984 | 121 |
| 600 | 3300048907 | Ga0496104_1293504 | Ga0496104_1293504_236_607 | 121 |
| 601 | 3300048907 | Ga0496104_1663565 | Ga0496104_1663565_149_517 | 121 |
| 602 | 3300048908 | Ga0496105_0142503 | Ga0496105_0142503_678_1043 | 121 |
| 603 | 3300048911 | Ga0496108_0000175 | Ga0496108_0000175_3058_3426 | 121 |
| 604 | 3300048911 | Ga0496108_0068044 | Ga0496108_0068044_1227_1598 | 121 |
| 605 | 3300048911 | Ga0496108_0603839 | Ga0496108_0603839_468_833 | 121 |
| 606 | 3300048912 | Ga0496109_0000121 | Ga0496109_0000121_3050_3418 | 121 |
| 607 | 3300048912 | Ga0496109_0000249 | Ga0496109_0000249_36387_36758 | 121 |
| 608 | 3300048913 | Ga0496110_0007407 | Ga0496110_0007407_5563_5934 | 121 |
| 609 | 3300048913 | Ga0496110_0897091 | Ga0496110_0897091_317_688 | 121 |
| 610 | 3300048914 | Ga0496111_0019839 | Ga0496111_0019839_3442_3813 | 121 |
| 611 | 3300048914 | Ga0496111_0349392 | Ga0496111_0349392_53_418 | 121 |
| 612 | 3300048917 | Ga0496114_0150349 | Ga0496114_0150349_1146_1511 | 121 |
| 613 | 3300048917 | Ga0496114_0349469 | Ga0496114_0349469_48_419 | 121 |
| 614 | 3300048917 | Ga0496114_0903270 | Ga0496114_0903270_320_691 | 121 |
| 615 | 3300048921 | Ga0496118_0350948 | Ga0496118_0350948_368_739 | 121 |
| 616 | 3300048922 | Ga0496119_0006046 | Ga0496119_0006046_6052_6417 | 121 |
| 617 | 3300048924 | Ga0496121_0151636 | Ga0496121_0151636_1200_1565 | 121 |
| 618 | 3300048927 | Ga0496124_0030661 | Ga0496124_0030661_502_867 | 121 |
| 619 | 3300048928 | Ga0496125_0064038 | Ga0496125_0064038_1922_2287 | 121 |
| 620 | 3300048929 | Ga0496126_0087237 | Ga0496126_0087237_1124_1489 | 121 |
| 621 | 3300048929 | Ga0496126_0090832 | Ga0496126_0090832_1043_1408 | 121 |
| 622 | 3300048929 | Ga0496126_0129957 | Ga0496126_0129957_340_705 | 121 |
| 623 | 3300049568 | Ga0501031_0003265 | Ga0501031_0003265_574_939 | 121 |
| 624 | 3300049569 | Ga0501032_0004103 | Ga0501032_0004103_505_870 | 121 |
| 625 | 3300049570 | Ga0501033_0000900 | Ga0501033_0000900_17279_17644 | 121 |
| 626 | 3300049571 | Ga0501034_0202876 | Ga0501034_0202876_491_856 | 121 |
| 627 | 3300049571 | Ga0501034_0628349 | Ga0501034_0628349_395_760 | 121 |
| 628 | 3300049572 | Ga0501036_0044867 | Ga0501036_0044867_476_841 | 121 |
| 629 | 3300049573 | Ga0501037_0004199 | Ga0501037_0004199_9446_9811 | 121 |
| 630 | 3300049574 | Ga0501038_0007149 | Ga0501038_0007149_474_839 | 121 |
| 631 | 3300049575 | Ga0501039_0011339 | Ga0501039_0011339_5952_6317 | 121 |
| 632 | 3300049576 | Ga0501040_0300169 | Ga0501040_0300169_427_792 | 121 |
| 633 | 3300049578 | Ga0501042_0208861 | Ga0501042_0208861_830_1201 | 121 |
| 634 | 3300049578 | Ga0501042_0396399 | Ga0501042_0396399_158_523 | 121 |
| 635 | 3300049579 | Ga0501043_0010751 | Ga0501043_0010751_6302_6667 | 121 |
| 636 | 3300049579 | Ga0501043_0376583 | Ga0501043_0376583_667_1032 | 121 |
| 637 | 3300049580 | Ga0501046_0006462 | Ga0501046_0006462_469_834 | 121 |
| 638 | 3300049581 | Ga0501047_0058444 | Ga0501047_0058444_497_862 | 121 |
| 639 | 3300049581 | Ga0501047_0330649 | Ga0501047_0330649_658_1023 | 121 |
| 640 | 3300049582 | Ga0501048_0004528 | Ga0501048_0004528_9740_10105 | 121 |
| 641 | 3300049582 | Ga0501048_0188340 | Ga0501048_0188340_489_854 | 121 |
| 642 | 3300049583 | Ga0501067_0143109 | Ga0501067_0143109_119_484 | 121 |
| 643 | 3300049584 | Ga0501068_0218015 | Ga0501068_0218015_410_775 | 121 |
| 644 | 3300049585 | Ga0501069_0005540 | Ga0501069_0005540_300_665 | 121 |
| 645 | 3300049585 | Ga0501069_0301684 | Ga0501069_0301684_485_850 | 121 |
| 646 | 3300049586 | Ga0501070_0000680 | Ga0501070_0000680_9500_9865 | 121 |
| 647 | 3300049586 | Ga0501070_0446943 | Ga0501070_0446943_191_556 | 121 |
| 648 | 3300049587 | Ga0501071_0029507 | Ga0501071_0029507_3072_3437 | 121 |
| 649 | 3300049588 | Ga0501072_1207496 | Ga0501072_1207496_82_447 | 121 |
| 650 | 3300049589 | Ga0501073_0004593 | Ga0501073_0004593_9512_9877 | 121 |
| 651 | 3300049590 | Ga0501074_0043778 | Ga0501074_0043778_2515_2880 | 121 |
| 652 | 3300049590 | Ga0501074_0587874 | Ga0501074_0587874_408_773 | 121 |
| 653 | 3300049741 | Ga0501079_0004743 | Ga0501079_0004743_419_784 | 121 |
| 654 | 3300049741 | Ga0501079_0012155 | Ga0501079_0012155_4593_4958 | 121 |
| 655 | 3300049742 | Ga0501080_0298518 | Ga0501080_0298518_616_981 | 121 |
| 656 | 3300049742 | Ga0501080_0684506 | Ga0501080_0684506_256_621 | 121 |
| 657 | 3300049744 | Ga0501083_0031048 | Ga0501083_0031048_1615_1980 | 121 |
| 658 | 3300049744 | Ga0501083_0040357 | Ga0501083_0040357_2346_2711 | 121 |
| 659 | 3300049822 | Ga0501035_0000887 | Ga0501035_0000887_21228_21593 | 121 |
| 660 | 3300049823 | Ga0501044_0009237 | Ga0501044_0009237_617_982 | 121 |
| 661 | 3300049823 | Ga0501044_0067858 | Ga0501044_0067858_2113_2478 | 121 |
| 662 | 3300049824 | Ga0501045_0080074 | Ga0501045_0080074_1516_1881 | 121 |
| 663 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_21665_22036 | 121 |
| 664 | 3300053077 | Ga0495601_0210744 | Ga0495601_0210744_77_445 | 121 |
| 665 | 3300053078 | Ga0495612_0006025 | Ga0495612_0006025_1775_2146 | 121 |
| 666 | 3300053083 | Ga0495655_0011759 | Ga0495655_0011759_107_475 | 121 |
| 667 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_180220_180591 | 121 |
| 668 | 3300053085 | Ga0495619_0000116 | Ga0495619_0000116_26987_27358 | 121 |
| 669 | 3300053087 | Ga0500643_213611 | Ga0500643_213611_100_465 | 121 |
| 670 | 3300060353 | Ga0501082_0517109 | Ga0501082_0517109_570_935 | 121 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6u2d-assembly2.cif.gz_C | pmtcd peptide exporter basket domain | 0.6708 | 22 | 92 |
| 6u2d-assembly2.cif.gz_C | pmtcd peptide exporter basket domain | 0.6534 | 22 | 92 |
| 4zoq-assembly1.cif.gz_A | crystal structure of a lanthipeptide protease | 0.6389 | 23 | 89 |
| 6xfu-assembly1.cif.gz_B | pmtcd peptide exporter basket domain | 0.6211 | 22 | 93 |
| 7r2y-assembly1.cif.gz_C | carbon regulatory pii-like protein sbtb from synechocystis sp. 6803 in complex with atp resulting from short atp soak, conflicting t-loop and c-loop with partial occupancy | 0.6147 | 19 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oloB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain | 0.633 | 23 | 84 | 3.30.70.1710 |
| 2fgcA03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.6305 | 21 | 101 | 3.30.70.1150 |
| af_O13869_338_419_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.6204 | 22 | 90 | 3.30.70.870 |
| 2fgcA03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.6176 | 21 | 101 | 3.30.70.1150 |
| af_O14179_173_246_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.617 | 21 | 99 | 3.30.70.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0NIP1-F1-model_v4 | Uncharacterized protein | 0.9268 | 1 | 96 |
|
| AF-A0A7W0Q0U9-F1-model_v4 | Uncharacterized protein | 0.9203 | 3 | 99 |
|
| AF-A0A7V9CRW9-F1-model_v4 | Uncharacterized protein | 0.9182 | 1 | 101 |
|
| AF-A0A7W1BRJ4-F1-model_v4 | Uncharacterized protein | 0.9003 | 1 | 96 |
|
| AF-A0A7V9KXI2-F1-model_v4 | Uncharacterized protein | 0.8982 | 1 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar