F474073

General Info

Members Datasets Scaffolds Average Seq Length
670 388 629 126

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_102041055|Ga0075428_1020410551
Length 145
Sequence MSMNVGGSMDGEDAQLNSTINTTPLVDVMLPVITKTVVQNLPKAVNIPTQTKPENITVEVDAKGNVYWNGKSVPNRTELLELVKTAAVKKPQPELHIRGDKETRYEAVGRVIYTIQRGGVVKVGFITEPPVGSGGGQAVAQNTAP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221658 Variovorax sp. Root411 Isolate Unclassified
9 2643221672 Variovorax sp. Root434 Isolate Unclassified
10 2643221683 Variovorax sp. Root473 Isolate Unclassified
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738541307 Variovorax sp. GV008 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2738543019 Variovorax sp. GV040 Isolate Unclassified
15 2818991446 Variovorax sp. 1180 Isolate Unclassified
16 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
17 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
18 2842677519 Variovorax sp. R-72495 Isolate Unclassified
19 2842733646 Variovorax sp. R-72446 Isolate Unclassified
20 2842747753 Variovorax sp. R-72060 Isolate Unclassified
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2885198086 Variovorax sp. 679 Isolate Unclassified
23 2885211737 Variovorax sp. 553 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
26 2904456579 Variovorax sp. 2002 Isolate Unclassified
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
29 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
30 2928037797 Variovorax sp. 1126 Isolate Unclassified
31 2928044640 Variovorax sp. 1128 Isolate Unclassified
32 2928051484 Variovorax sp. 1133 Isolate Unclassified
33 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
34 2928070936 Variovorax gossypii 1167 Isolate Unclassified
35 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
36 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
37 2929520902 Variovorax beijingensis 502 Isolate Unclassified
38 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
198 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
199 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
200 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
201 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
202 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
203 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
204 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
225 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
242 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
243 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
246 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
326 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
327 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
328 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
329 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
330 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
343 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
344 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
347 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
348 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
349 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
350 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
351 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
352 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
355 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
359 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
360 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
365 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
371 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
372 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
375 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
376 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
377 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.49
Metatranscriptomes 2.39
Isolates 6.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.06
Nodule 0.9
Rhizoplane 3.13
Rhizosphere 57.61
Stem 0
Stem Tuber 0
Unclassified 10.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_740581 2162886007 Bacteria 1466
2 JGI24740J21852_10009941 3300001979 Bacteria 3691
3 JGI24739J22299_10009105 3300001989 Bacteria 3702
4 JGI24739J22299_10009112 3300001989 Bacteria 3701
5 JGI25158J39367_1017379 3300002739 Bacteria 901
6 JGI25152J39213_1006491 3300002773 Bacteria 3173
7 JGI25150J39212_1001672 3300002774 Bacteria 6010
8 JGI25159J45721_1010981 3300002987 Bacteria 2256
9 JGI25151J46595_10035846 3300003187 Bacteria 1878
10 JGI25406J46586_10017419 3300003203 Bacteria 2971
11 JGI25153J46596_10015151 3300003215 Bacteria 3161
12 Ga0055527_1008634 3300003760 Bacteria 1211
13 Ga0055535_1000084 3300003761 Bacteria 104652
14 Ga0055542_1000033 3300003762 Bacteria 233997
15 Ga0055537_1000163 3300003773 Bacteria 49422
16 Ga0055536_1001382 3300003781 Bacteria 14722
17 Ga0055536_1010724 3300003781 Bacteria 3596
18 Ga0055536_1012623 3300003781 Bacteria 3118
19 Ga0055534_1000150 3300003784 Bacteria 51661
20 Ga0055534_1011068 3300003784 Bacteria 1852
21 Ga0055528_1015922 3300003790 Bacteria 2687
22 Ga0055530_10004105 3300003791 Bacteria 7739
23 Ga0055530_10009858 3300003791 Bacteria 3606
24 Ga0055540_1000733 3300003792 Bacteria 22290
25 Ga0055540_1002197 3300003792 Bacteria 10610
26 Ga0055540_1008745 3300003792 Bacteria 3600
27 Ga0055540_1009657 3300003792 Bacteria 3302
28 Ga0055540_1010326 3300003792 Bacteria 3118
29 Ga0055540_1031202 3300003792 Bacteria 1226
30 Ga0055531_10000254 3300003794 Bacteria 57349
31 Ga0055531_10002763 3300003794 Bacteria 11516
32 Ga0055531_10008022 3300003794 Bacteria 5645
33 Ga0055531_10016888 3300003794 Bacteria 3118
34 Ga0065714_10005035 3300005288 Bacteria 5831
35 Ga0065714_10095928 3300005288 Bacteria 1774
36 Ga0065704_10078797 3300005289 Bacteria 4330
37 Ga0065704_10104343 3300005289 Bacteria 2144
38 Ga0065704_10206224 3300005289 Bacteria 1126
39 Ga0070658_10084607 3300005327 Bacteria 2608
40 Ga0070658_10128255 3300005327 Bacteria 2113
41 Ga0070658_10475809 3300005327 Bacteria 1078
42 Ga0070676_10440814 3300005328 Bacteria 914
43 Ga0070670_100046178 3300005331 Bacteria 3745
44 Ga0070677_10087359 3300005333 Bacteria 1349
45 Ga0070677_10342302 3300005333 Bacteria 772
46 Ga0070680_100142496 3300005336 Bacteria 2010
47 Ga0070660_100009303 3300005339 Bacteria 6904
48 Ga0070661_100248879 3300005344 Bacteria 1371
49 Ga0070668_100411113 3300005347 Bacteria 1157
50 Ga0070668_101315368 3300005347 Bacteria 657
51 Ga0070669_100122085 3300005353 Bacteria 1989
52 Ga0070669_100422150 3300005353 Bacteria 1095
53 Ga0070669_101324948 3300005353 Bacteria 624
54 Ga0070675_101753794 3300005354 Bacteria 573
55 Ga0070674_100251225 3300005356 Bacteria 1389
56 Ga0070673_100066282 3300005364 Bacteria 2884
57 Ga0070673_100202065 3300005364 Bacteria 1712
58 Ga0070659_100292456 3300005366 Bacteria 1357
59 Ga0070667_100142295 3300005367 Bacteria 2102
60 Ga0070667_100357708 3300005367 Bacteria 1323
61 Ga0070700_100473375 3300005441 Bacteria 958
62 Ga0070663_101311900 3300005455 Bacteria 639
63 Ga0070678_100403844 3300005456 Bacteria 1187
64 Ga0070678_100750372 3300005456 Bacteria 883
65 Ga0068867_100068007 3300005459 Bacteria 2658
66 Ga0068867_100419898 3300005459 Bacteria 1133
67 Ga0070685_10198344 3300005466 Bacteria 1303
68 Ga0070679_100041448 3300005530 Bacteria 4582
69 Ga0070679_100320606 3300005530 Bacteria 1499
70 Ga0068853_100072832 3300005539 Bacteria 2994
71 Ga0068853_100721535 3300005539 Bacteria 952
72 Ga0070672_100822226 3300005543 Bacteria 818
73 Ga0070665_100015030 3300005548 Bacteria 7768
74 Ga0070665_100954739 3300005548 Bacteria 870
75 Ga0068855_100001070 3300005563 Bacteria 33986
76 Ga0068855_100221222 3300005563 Bacteria 2123
77 Ga0068857_100052201 3300005577 Bacteria 3628
78 Ga0068857_100118116 3300005577 Bacteria 2387
79 Ga0068852_100498156 3300005616 Bacteria 1213
80 Ga0068852_100566216 3300005616 Bacteria 1138
81 Ga0068859_100839952 3300005617 Bacteria 1005
82 Ga0068864_100398707 3300005618 Bacteria 1307
83 Ga0068861_100399966 3300005719 Bacteria 1218
84 Ga0068851_10039165 3300005834 Bacteria 2380
85 Ga0068863_100284610 3300005841 Bacteria 1602
86 Ga0068862_100920535 3300005844 Bacteria 860
87 Ga0081455_10000016 3300005937 Bacteria 176679
88 Ga0081539_10000060 3300005985 Bacteria 252799
89 Ga0075363_100004195 3300006048 Bacteria 6260
90 Ga0075363_100082873 3300006048 Bacteria 1756
91 Ga0075363_100119746 3300006048 Bacteria 1469
92 Ga0075363_100251559 3300006048 Bacteria 1017
93 Ga0075364_10090522 3300006051 Bacteria 2029
94 Ga0075364_10138987 3300006051 Bacteria 1633
95 Ga0075364_10587674 3300006051 Bacteria 761
96 Ga0075432_10011325 3300006058 Bacteria 3030
97 Ga0075362_10002959 3300006177 Bacteria 5835
98 Ga0075362_10019624 3300006177 Bacteria 2814
99 Ga0075362_10048477 3300006177 Bacteria 1895
100 Ga0075362_10394988 3300006177 Bacteria 697
101 Ga0075367_10019689 3300006178 Bacteria 3746
102 Ga0075366_10004750 3300006195 Bacteria 7321
103 Ga0075366_10014149 3300006195 Bacteria 4553
104 Ga0075366_10069303 3300006195 Bacteria 2099
105 Ga0075366_10071598 3300006195 Bacteria 2065
106 Ga0075366_10103360 3300006195 Bacteria 1711
107 Ga0075370_10006471 3300006353 Bacteria 5895
108 Ga0075370_10007064 3300006353 Bacteria 5698
109 Ga0075370_10023681 3300006353 Bacteria 3384
110 Ga0075370_10059627 3300006353 Bacteria 2172
111 Ga0075370_10092515 3300006353 Bacteria 1745
112 Ga0075370_10183479 3300006353 Bacteria 1232
113 Ga0075428_102041055 3300006844 Bacteria 594
114 Ga0068865_101198511 3300006881 Bacteria 672
115 Ga0097620_100839914 3300006931 Bacteria 1005
116 Ga0079104_1033997 3300006946 Bacteria 1242
117 Ga0099826_10000055 3300006948 Bacteria 70119
118 Ga0099826_10046013 3300006948 Bacteria 2978
119 Ga0105244_10030974 3300009036 Bacteria 2842
120 Ga0105244_10354900 3300009036 Bacteria 676
121 Ga0105240_10033861 3300009093 Bacteria 6597
122 Ga0105240_10287930 3300009093 Bacteria 1885
123 Ga0105245_10275370 3300009098 Bacteria 1643
124 Ga0105243_10002185 3300009148 Bacteria 16494
125 Ga0105243_10769394 3300009148 Bacteria 946
126 Ga0105242_10002960 3300009176 Bacteria 13295
127 Ga0105248_10103953 3300009177 Bacteria 3202
128 Ga0105237_10133427 3300009545 Bacteria 2478
129 Ga0105238_10079657 3300009551 Bacteria 3266
130 Ga0105249_10079860 3300009553 Bacteria 3037
131 Ga0105249_13257304 3300009553 Bacteria 522
132 Ga0105239_10037060 3300010375 Bacteria 5349
133 Ga0105239_10310216 3300010375 Bacteria 1778
134 Ga0105246_10024498 3300011119 Bacteria 3921
135 Ga0105246_10093008 3300011119 Bacteria 2177
136 Ga0157347_1034967 3300012502 Bacteria 644
137 Ga0157373_10008333 3300013100 Bacteria 7700
138 Ga0157371_10540285 3300013102 Bacteria 863
139 Ga0157370_10006222 3300013104 Bacteria 13222
140 Ga0157370_10257363 3300013104 Bacteria 1613
141 Ga0157369_10039882 3300013105 Bacteria 5130
142 Ga0163162_11229642 3300013306 Bacteria 850
143 Ga0157372_10059193 3300013307 Bacteria 4284
144 Ga0157375_10519795 3300013308 Bacteria 1354
145 Ga0157375_10986285 3300013308 Bacteria 983
146 Ga0163163_11165352 3300014325 Bacteria 833
147 Ga0182008_10002275 3300014497 Bacteria 12122
148 Ga0182008_10023631 3300014497 Bacteria 3136
149 Ga0182008_10024712 3300014497 Bacteria 3056
150 Ga0182008_10042054 3300014497 Bacteria 2277
151 Ga0157376_10200490 3300014969 Bacteria 1836
152 Ga0182006_1001945 3300015261 Bacteria 11727
153 Ga0182006_1066693 3300015261 Bacteria 1345
154 Ga0182006_1069001 3300015261 Bacteria 1315
155 Ga0182007_10001682 3300015262 Bacteria 11711
156 Ga0182007_10020057 3300015262 Bacteria 2395
157 Ga0182005_1019210 3300015265 Bacteria 1885
158 Ga0182005_1043555 3300015265 Bacteria 1220
159 Ga0182005_1058977 3300015265 Bacteria 1048
160 Ga0183362_10001 3300015683 Bacteria 2046624
161 Ga0183362_10002 3300015683 Bacteria 1432711
162 Ga0163161_10000128 3300017792 Bacteria 70965
163 Ga0163161_10003865 3300017792 Bacteria 10501
164 Ga0163161_10007397 3300017792 Bacteria 7585
165 Ga0163161_10043851 3300017792 Bacteria 3221
166 Ga0163161_11498852 3300017792 Bacteria 592
167 Ga0209436_112396 3300025208 Bacteria 1448
168 Ga0209672_100228 3300025228 Bacteria 42777
169 Ga0209258_100089 3300025242 Bacteria 234040
170 Ga0207425_1001684 3300025245 Bacteria 8813
171 Ga0207425_1003926 3300025245 Bacteria 4603
172 Ga0209148_1000097 3300025254 Bacteria 234049
173 Ga0209129_1000033 3300025258 Bacteria 336894
174 Ga0209129_1001977 3300025258 Bacteria 10673
175 Ga0209129_1007540 3300025258 Bacteria 3213
176 Ga0209565_1000120 3300025263 Bacteria 111458
177 Ga0209565_1000516 3300025263 Bacteria 27851
178 Ga0209565_1000980 3300025263 Bacteria 14694
179 Ga0209673_1000099 3300025273 Bacteria 193248
180 Ga0209673_1000899 3300025273 Bacteria 38238
181 Ga0209673_1001394 3300025273 Bacteria 23565
182 Ga0209673_1006035 3300025273 Bacteria 5954
183 Ga0209673_1027678 3300025273 Bacteria 1840
184 Ga0209673_1037594 3300025273 Bacteria 1420
185 Ga0209130_1000105 3300025284 Bacteria 135199
186 Ga0209130_1000615 3300025284 Bacteria 34069
187 Ga0209675_1000054 3300025291 Bacteria 193248
188 Ga0209675_1000588 3300025291 Bacteria 26180
189 Ga0209675_1001765 3300025291 Bacteria 11847
190 Ga0209675_1004983 3300025291 Bacteria 5715
191 Ga0209675_1084484 3300025291 Bacteria 583
192 Ga0209676_1000260 3300025292 Bacteria 111683
193 Ga0209676_1001304 3300025292 Bacteria 25409
194 Ga0209676_1004531 3300025292 Bacteria 7698
195 Ga0209676_1021203 3300025292 Bacteria 2187
196 Ga0209676_1033402 3300025292 Bacteria 1533
197 Ga0209025_1000221 3300025294 Bacteria 135793
198 Ga0209025_1000732 3300025294 Bacteria 55664
199 Ga0209025_1001070 3300025294 Bacteria 39701
200 Ga0209025_1009557 3300025294 Bacteria 6733
201 Ga0209025_1014260 3300025294 Bacteria 4909
202 Ga0209564_1000151 3300025295 Bacteria 168783
203 Ga0209564_1000246 3300025295 Bacteria 117096
204 Ga0209758_1000027 3300025297 Bacteria 549650
205 Ga0209050_1000977 3300025298 Bacteria 36542
206 Ga0209050_1002366 3300025298 Bacteria 16428
207 Ga0209050_1024517 3300025298 Bacteria 2083
208 Ga0209256_1000069 3300025299 Bacteria 245640
209 Ga0209256_1000506 3300025299 Bacteria 57382
210 Ga0207426_1000027 3300025302 Bacteria 513176
211 Ga0207426_1000859 3300025302 Bacteria 31835
212 Ga0209051_1000055 3300025303 Bacteria 277194
213 Ga0209051_1000319 3300025303 Bacteria 72894
214 Ga0209051_1000510 3300025303 Bacteria 49177
215 Ga0209051_1000707 3300025303 Bacteria 36542
216 Ga0209051_1000832 3300025303 Bacteria 31807
217 Ga0209051_1005253 3300025303 Bacteria 7636
218 Ga0209051_1050284 3300025303 Bacteria 1397
219 Ga0209051_1083255 3300025303 Bacteria 915
220 Ga0209257_1000101 3300025304 Bacteria 251553
221 Ga0209257_1000281 3300025304 Bacteria 114413
222 Ga0209257_1001995 3300025304 Bacteria 21901
223 Ga0209257_1018084 3300025304 Bacteria 2735
224 Ga0207656_10016928 3300025321 Bacteria 2847
225 Ga0207655_1000566 3300025728 Bacteria 45937
226 Ga0207682_10069310 3300025893 Bacteria 1491
227 Ga0207647_10461398 3300025904 Bacteria 711
228 Ga0207645_10665219 3300025907 Bacteria 708
229 Ga0207705_10176113 3300025909 Bacteria 1612
230 Ga0207705_10200787 3300025909 Bacteria 1511
231 Ga0207705_10238103 3300025909 Bacteria 1386
232 Ga0207695_10093746 3300025913 Bacteria 3012
233 Ga0207695_10330048 3300025913 Bacteria 1414
234 Ga0207695_11317852 3300025913 Bacteria 602
235 Ga0207652_10032128 3300025921 Bacteria 4409
236 Ga0207681_10689342 3300025923 Bacteria 849
237 Ga0207681_11415511 3300025923 Bacteria 583
238 Ga0207694_10042687 3300025924 Bacteria 3498
239 Ga0207650_10842234 3300025925 Bacteria 778
240 Ga0207659_10849222 3300025926 Bacteria 785
241 Ga0207664_11131630 3300025929 Bacteria 699
242 Ga0207690_10293503 3300025932 Bacteria 1270
243 Ga0207690_10781392 3300025932 Bacteria 788
244 Ga0207706_11160545 3300025933 Bacteria 643
245 Ga0207686_10004118 3300025934 Bacteria 7801
246 Ga0207709_10000230 3300025935 Bacteria 70768
247 Ga0207709_10000240 3300025935 Bacteria 68308
248 Ga0207669_10017951 3300025937 Bacteria 3644
249 Ga0207691_10142942 3300025940 Bacteria 2107
250 Ga0207691_10416100 3300025940 Bacteria 1146
251 Ga0207711_10181176 3300025941 Bacteria 1916
252 Ga0207689_10212581 3300025942 Bacteria 1598
253 Ga0207667_10021805 3300025949 Bacteria 7091
254 Ga0207651_10126091 3300025960 Bacteria 1951
255 Ga0207651_10213950 3300025960 Bacteria 1554
256 Ga0207651_11942184 3300025960 Bacteria 529
257 Ga0207712_10287368 3300025961 Bacteria 1344
258 Ga0207668_11260504 3300025972 Bacteria 665
259 Ga0207640_10333840 3300025981 Bacteria 1212
260 Ga0207640_10596239 3300025981 Bacteria 935
261 Ga0207658_10303117 3300025986 Bacteria 1377
262 Ga0207658_10943868 3300025986 Bacteria 786
263 Ga0207639_10001769 3300026041 Bacteria 14537
264 Ga0207639_10389927 3300026041 Bacteria 1252
265 Ga0207641_10128355 3300026088 Bacteria 2273
266 Ga0207676_10542052 3300026095 Bacteria 1110
267 Ga0207674_10180344 3300026116 Bacteria 2063
268 Ga0207674_10182736 3300026116 Bacteria 2048
269 Ga0207683_10400740 3300026121 Bacteria 1262
270 Ga0207683_10554621 3300026121 Bacteria 1062
271 Ga0207683_10732854 3300026121 Bacteria 917
272 Ga0207683_11523680 3300026121 Bacteria 617
273 Ga0207683_11669200 3300026121 Bacteria 586
274 Ga0207698_10538410 3300026142 Bacteria 1142
275 Ga0207698_10756004 3300026142 Bacteria 971
276 Ga0209282_1000133 3300027666 Bacteria 44707
277 Ga0209282_1056012 3300027666 Bacteria 2226
278 Ga0209974_10013793 3300027876 Bacteria 2692
279 Ga0207428_10631273 3300027907 Bacteria 770
280 Ga0268266_10006402 3300028379 Bacteria 10791
281 Ga0268265_10064885 3300028380 Bacteria 2815
282 Ga0268265_10194630 3300028380 Bacteria 1754
283 Ga0268265_10350499 3300028380 Bacteria 1348
284 Ga0268264_10336814 3300028381 Bacteria 1432
285 Ga0268264_11431388 3300028381 Bacteria 702
286 Ga0307517_10235337 3300028786 Bacteria 1094
287 Ga0307515_10001286 3300028794 Bacteria 56985
288 Ga0307515_10014383 3300028794 Bacteria 14677
289 Ga0307515_10323569 3300028794 Bacteria 1206
290 Ga0307515_10497597 3300028794 Bacteria 830
291 Ga0316177_1065678 3300030731 Bacteria 8662
292 Ga0314311_1013889 3300030733 Bacteria 3248
293 Ga0316179_1063999 3300030734 Bacteria 1795
294 Ga0316178_1010531 3300030735 Bacteria 3326
295 Ga0316180_1110739 3300030736 Bacteria 2599
296 Ga0316183_1052716 3300030742 Bacteria 4223
297 Ga0316181_1013742 3300030744 Bacteria 999
298 Ga0316181_1028550 3300030744 Bacteria 2915
299 Ga0316182_1071522 3300030745 Bacteria 4117
300 Ga0316182_1178183 3300030745 Bacteria 6940
301 Ga0265327_10018197 3300031251 Bacteria 4366
302 Ga0307513_10000006 3300031456 Bacteria 470848
303 Ga0307513_10064926 3300031456 Bacteria 3842
304 Ga0307513_10510289 3300031456 Bacteria 919
305 Ga0307408_100036293 3300031548 Bacteria 3464
306 Ga0307408_100060036 3300031548 Bacteria 2770
307 Ga0307408_100121018 3300031548 Bacteria 2027
308 Ga0307408_100267340 3300031548 Bacteria 1418
309 Ga0307408_100343937 3300031548 Bacteria 1263
310 Ga0307408_100345631 3300031548 Bacteria 1260
311 Ga0307514_10000970 3300031649 Bacteria 42862
312 Ga0307514_10130289 3300031649 Bacteria 1733
313 Ga0307516_10332445 3300031730 Bacteria 1188
314 Ga0307405_10018778 3300031731 Bacteria 3822
315 Ga0307405_10032179 3300031731 Bacteria 3097
316 Ga0307405_10087297 3300031731 Bacteria 2055
317 Ga0307405_10131640 3300031731 Bacteria 1729
318 Ga0307405_10153897 3300031731 Bacteria 1620
319 Ga0307405_10463745 3300031731 Bacteria 1007
320 Ga0307405_10654156 3300031731 Bacteria 865
321 Ga0307413_10233292 3300031824 Bacteria 1353
322 Ga0307410_10071197 3300031852 Bacteria 2411
323 Ga0307410_10424144 3300031852 Bacteria 1080
324 Ga0307406_10027594 3300031901 Bacteria 3422
325 Ga0307406_10072562 3300031901 Bacteria 2260
326 Ga0307406_10441674 3300031901 Bacteria 1041
327 Ga0307406_10840986 3300031901 Bacteria 777
328 Ga0307406_11107402 3300031901 Bacteria 684
329 Ga0307407_10034424 3300031903 Bacteria 2773
330 Ga0307407_10943127 3300031903 Bacteria 664
331 Ga0307412_10062950 3300031911 Bacteria 2500
332 Ga0307412_10215409 3300031911 Bacteria 1468
333 Ga0307412_10247168 3300031911 Bacteria 1383
334 Ga0307412_10351597 3300031911 Bacteria 1183
335 Ga0307412_10481259 3300031911 Bacteria 1029
336 Ga0307412_10539920 3300031911 Bacteria 977
337 Ga0307409_100855704 3300031995 Bacteria 920
338 Ga0307416_100208097 3300032002 Bacteria 1863
339 Ga0307416_100314494 3300032002 Bacteria 1564
340 Ga0307416_101121357 3300032002 Bacteria 891
341 Ga0307414_10020805 3300032004 Bacteria 4098
342 Ga0307414_10127276 3300032004 Bacteria 1970
343 Ga0307414_10544200 3300032004 Bacteria 1034
344 Ga0307414_10608039 3300032004 Bacteria 981
345 Ga0307414_11485780 3300032004 Bacteria 630
346 Ga0307411_10065232 3300032005 Bacteria 2441
347 Ga0307411_10522740 3300032005 Bacteria 1007
348 Ga0307411_11283952 3300032005 Bacteria 666
349 Ga0373955_0139798 3300035172 Bacteria 1419
350 Ga0373931_0384122 3300035691 Bacteria 886
351 Ga0373931_0406181 3300035691 Bacteria 863
352 Ga0395898_0545691 3300037466 Bacteria 1101
353 Ga0395905_0858869 3300037471 Bacteria 810
354 Ga0439436_0000274 3300041404 Bacteria 12450
355 Ga0439436_0003221 3300041404 Bacteria 4954
356 Ga0439436_0019474 3300041404 Bacteria 2026
357 Ga0439439_0006621 3300041406 Bacteria 2683
358 Ga0439439_0007932 3300041406 Bacteria 2496
359 Ga0439439_0274052 3300041406 Bacteria 504
360 Ga0439461_0155807 3300041410 Bacteria 592
361 Ga0439466_0008277 3300041411 Bacteria 3920
362 Ga0439466_0024317 3300041411 Bacteria 2124
363 Ga0439465_0000448 3300041413 Bacteria 12074
364 Ga0439465_0010317 3300041413 Bacteria 2937
365 Ga0451793_0142041 3300041452 Bacteria 726
366 Ga0451793_0638839 3300041452 Bacteria 1053
367 Ga0451837_0796968 3300041494 Bacteria 543
368 Ga0451847_0557802 3300041503 Bacteria 918
369 Ga0439431_0000929 3300041997 Bacteria 6348
370 Ga0439431_0018549 3300041997 Bacteria 1647
371 Ga0439433_0000142 3300041999 Bacteria 10851
372 Ga0439433_0002117 3300041999 Bacteria 4175
373 Ga0439442_019836 3300042002 Bacteria 1393
374 Ga0439442_108196 3300042002 Bacteria 604
375 Ga0439445_0007988 3300042004 Bacteria 2468
376 Ga0439445_0017470 3300042004 Bacteria 1773
377 Ga0439445_0027061 3300042004 Bacteria 1471
378 Ga0439432_002894 3300042006 Bacteria 6392
379 Ga0439432_009431 3300042006 Bacteria 3404
380 Ga0439432_132048 3300042006 Bacteria 736
381 Ga0439449_0000240 3300042007 Bacteria 19806
382 Ga0439449_0001968 3300042007 Bacteria 8071
383 Ga0439449_0002571 3300042007 Bacteria 7087
384 Ga0439449_0003071 3300042007 Bacteria 6506
385 Ga0439452_013517 3300042010 Bacteria 2289
386 Ga0439452_026999 3300042010 Bacteria 1445
387 Ga0439457_010186 3300042014 Bacteria 2168
388 Ga0439457_011388 3300042014 Bacteria 2023
389 Ga0439462_0000492 3300042015 Bacteria 7779
390 Ga0439462_0015377 3300042015 Bacteria 1972
391 Ga0439462_0066923 3300042015 Bacteria 974
392 Ga0450911_000343 3300042115 Bacteria 16355
393 Ga0450914_004754 3300042118 Bacteria 1120
394 Ga0450920_003461 3300042122 Bacteria 2734
395 Ga0450923_023279 3300042125 Bacteria 1221
396 Ga0450923_038683 3300042125 Bacteria 996
397 Ga0450896_010164 3300042133 Bacteria 1317
398 Ga0450898_004135 3300042134 Bacteria 2124
399 Ga0450898_005436 3300042134 Bacteria 1925
400 Ga0450898_057525 3300042134 Bacteria 760
401 Ga0450906_005956 3300042145 Bacteria 2482
402 Ga0450906_010007 3300042145 Bacteria 1799
403 Ga0450906_065714 3300042145 Bacteria 647
404 Ga0450907_004688 3300042146 Bacteria 2343
405 Ga0450907_100444 3300042146 Bacteria 504
406 Ga0439446_0022790 3300042156 Bacteria 1777
407 Ga0439446_0024579 3300042156 Bacteria 1719
408 Ga0450908_000352 3300042184 Bacteria 8852
409 Ga0450908_024203 3300042184 Bacteria 1062
410 Ga0439434_0003838 3300042435 Bacteria 4393
411 Ga0439434_0005115 3300042435 Bacteria 3837
412 Ga0439434_0016814 3300042435 Bacteria 2186
413 Ga0439435_0178670 3300042436 Bacteria 692
414 Ga0450918_000204 3300042531 Bacteria 13434
415 Ga0450918_027273 3300042531 Bacteria 1004
416 Ga0453683_0014003 3300044673 Bacteria 5218
417 Ga0453683_0194382 3300044673 Bacteria 1288
418 Ga0466965_0056035 3300044683 Bacteria 1962
419 Ga0453684_0550258 3300044712 Bacteria 1271
420 Ga0451576_0021797 3300045051 Bacteria 6955
421 Ga0451576_0638903 3300045051 Bacteria 1118
422 Ga0451576_1667408 3300045051 Bacteria 661
423 Ga0495627_032104 3300046453 Bacteria 1654
424 Ga0495603_0716264 3300046455 Bacteria 572
425 Ga0495638_0019793 3300046460 Bacteria 4450
426 Ga0495651_0213257 3300046462 Bacteria 1342
427 Ga0495651_0672169 3300046462 Bacteria 647
428 Ga0495639_0208759 3300046475 Bacteria 958
429 Ga0495664_0206199 3300046477 Bacteria 1191
430 Ga0495610_0009323 3300046512 Bacteria 6217
431 Ga0495610_0200236 3300046512 Bacteria 818
432 Ga0495616_0018411 3300046513 Bacteria 3834
433 Ga0495620_0008425 3300046515 Bacteria 5536
434 Ga0495631_0026219 3300046518 Bacteria 2678
435 Ga0495637_0177825 3300046520 Bacteria 790
436 Ga0495643_0056092 3300046522 Bacteria 2104
437 Ga0495648_0145456 3300046524 Bacteria 1243
438 Ga0495642_0054355 3300046528 Bacteria 1651
439 Ga0495642_0123659 3300046528 Bacteria 1111
440 Ga0495652_0732578 3300046529 Bacteria 663
441 Ga0495654_0042640 3300046530 Bacteria 2251
442 Ga0495587_0293368 3300046536 Bacteria 910
443 Ga0495621_0012181 3300046539 Bacteria 2677
444 Ga0495621_0203355 3300046539 Bacteria 797
445 Ga0495622_0086440 3300046557 Bacteria 1442
446 Ga0495633_0204064 3300046558 Bacteria 907
447 Ga0495667_0264057 3300046559 Bacteria 1095
448 Ga0495656_0000376 3300046615 Bacteria 14908
449 Ga0495656_0010192 3300046615 Bacteria 3408
450 Ga0495656_0025242 3300046615 Bacteria 2355
451 Ga0495656_0203641 3300046615 Bacteria 983
452 Ga0495668_0310121 3300046616 Bacteria 865
453 Ga0495625_0000903 3300046660 Bacteria 39973
454 Ga0495625_0030774 3300046660 Bacteria 4000
455 Ga0495625_0404267 3300046660 Bacteria 852
456 Ga0495635_0796382 3300046663 Bacteria 609
457 Ga0495661_0045654 3300046665 Bacteria 2678
458 Ga0495588_0033071 3300046674 Bacteria 2610
459 Ga0495588_0079733 3300046674 Bacteria 1708
460 Ga0495588_0196150 3300046674 Bacteria 1066
461 Ga0495657_0263056 3300046675 Bacteria 1036
462 Ga0495599_0168685 3300046678 Bacteria 1351
463 Ga0495669_0099795 3300046684 Bacteria 1348
464 Ga0495669_0290457 3300046684 Bacteria 787
465 Ga0495670_0313321 3300046691 Bacteria 842
466 Ga0495671_0144860 3300046692 Bacteria 1157
467 Ga0495600_0264373 3300046809 Bacteria 1092
468 Ga0495636_0061074 3300047318 Bacteria 1593
469 Ga0495676_0001292 3300047321 Bacteria 21470
470 Ga0495677_0139063 3300047445 Bacteria 932
471 Ga0495677_0410705 3300047445 Bacteria 536
472 Ga0495685_014825 3300047447 Bacteria 2653
473 Ga0495593_0000578 3300047673 Bacteria 20838
474 Ga0495614_0000302 3300048089 Bacteria 19477
475 Ga0495615_0017987 3300048090 Bacteria 1549
476 Ga0496100_0006543 3300048903 Bacteria 6359
477 Ga0496101_0005412 3300048904 Bacteria 8133
478 Ga0496102_0199227 3300048905 Bacteria 1887
479 Ga0496103_0092168 3300048906 Bacteria 1913
480 Ga0496104_0003045 3300048907 Bacteria 14441
481 Ga0496105_0000491 3300048908 Bacteria 26041
482 Ga0496106_1031413 3300048909 Bacteria 646
483 Ga0496107_0246139 3300048910 Bacteria 1330
484 Ga0496108_0081281 3300048911 Bacteria 2746
485 Ga0496109_1578803 3300048912 Bacteria 591
486 Ga0496110_0196262 3300048913 Bacteria 1833
487 Ga0496110_0229658 3300048913 Bacteria 1687
488 Ga0496111_0292006 3300048914 Bacteria 1209
489 Ga0496111_0795870 3300048914 Bacteria 684
490 Ga0496114_0229356 3300048917 Bacteria 1631
491 Ga0496114_0295217 3300048917 Bacteria 1430
492 Ga0496116_0064175 3300048919 Bacteria 2361
493 Ga0496116_0134839 3300048919 Bacteria 1400
494 Ga0496117_0022168 3300048920 Bacteria 5100
495 Ga0496117_0026152 3300048920 Bacteria 4571
496 Ga0496117_0072100 3300048920 Bacteria 2311
497 Ga0496118_0014322 3300048921 Bacteria 7432
498 Ga0496118_0282042 3300048921 Bacteria 924
499 Ga0496118_0317712 3300048921 Bacteria 846
500 Ga0496119_0088212 3300048922 Bacteria 1769
501 Ga0496121_0045413 3300048924 Bacteria 3775
502 Ga0496121_0068195 3300048924 Bacteria 2878
503 Ga0496122_0000546 3300048925 Bacteria 77920
504 Ga0496122_0143883 3300048925 Bacteria 1486
505 Ga0496122_0245083 3300048925 Bacteria 1007
506 Ga0496122_0390091 3300048925 Bacteria 711
507 Ga0496123_0000235 3300048926 Bacteria 111823
508 Ga0496123_0105190 3300048926 Bacteria 1630
509 Ga0496124_0016715 3300048927 Bacteria 6959
510 Ga0496124_0053327 3300048927 Bacteria 3429
511 Ga0496124_0125299 3300048927 Bacteria 2047
512 Ga0496124_0326839 3300048927 Bacteria 1095
513 Ga0496124_0345612 3300048927 Bacteria 1054
514 Ga0496124_0634945 3300048927 Bacteria 688
515 Ga0496125_0005957 3300048928 Bacteria 13345
516 Ga0496125_0012018 3300048928 Bacteria 8619
517 Ga0496125_0021920 3300048928 Bacteria 5942
518 Ga0496125_0050661 3300048928 Bacteria 3435
519 Ga0496125_0062052 3300048928 Bacteria 2992
520 Ga0496125_0444840 3300048928 Bacteria 744
521 Ga0496125_0633723 3300048928 Bacteria 578
522 Ga0496126_0162420 3300048929 Bacteria 1908
523 Ga0496126_0555945 3300048929 Bacteria 910
524 Ga0501304_006403 3300049160 Bacteria 949
525 Ga0501332_09021 3300049548 Bacteria 653
526 Ga0501337_007091 3300049553 Bacteria 777
527 Ga0501033_0322692 3300049570 Bacteria 1085
528 Ga0501238_015379 3300049671 Bacteria 1055
529 Ga0501249_007483 3300049679 Bacteria 2257
530 Ga0501252_021242 3300049682 Bacteria 850
531 Ga0501257_106870 3300049686 Bacteria 739
532 Ga0501225_0034151 3300049705 Bacteria 1400
533 Ga0501262_004604 3300049759 Bacteria 1604
534 Ga0501035_0450335 3300049822 Bacteria 1065
535 Ga0501044_0055514 3300049823 Bacteria 4068
536 Ga0501044_0254398 3300049823 Bacteria 1696
537 nmdc:mga03683_2243_c1 3300050489 Bacteria 5962
538 nmdc:mga03683_274048_c1 3300050489 Bacteria 787
539 nmdc:mga03683_337243_c1 3300050489 Bacteria 712
540 nmdc:mga03683_37509_c1 3300050489 Bacteria 1975
541 nmdc:mga03683_471932_c1 3300050489 Bacteria 605
542 nmdc:mga03683_52313_c1 3300050489 Bacteria 1707
543 nmdc:mga03n38_15636_c1 3300050490 Bacteria 2933
544 nmdc:mga03n38_219946_c1 3300050490 Bacteria 991
545 nmdc:mga03n38_51229_c1 3300050490 Bacteria 1843
546 nmdc:mga00v17_923148_c1 3300050491 Bacteria 552
547 nmdc:mga00v17_95592_c1 3300050491 Bacteria 1871
548 nmdc:mga0yw44_214938_c1 3300050492 Bacteria 1273
549 nmdc:mga0yw44_71077_c1 3300050492 Bacteria 2160
550 nmdc:mga0k408_164149_c1 3300050493 Bacteria 1323
551 nmdc:mga0k408_199292_c1 3300050493 Bacteria 1195
552 nmdc:mga0k408_35698_c1 3300050493 Bacteria 2851
553 nmdc:mga0k408_6104_c1 3300050493 Bacteria 6418
554 nmdc:mga0k408_694560_c1 3300050493 Bacteria 596
555 nmdc:mga0k408_71802_c1 3300050493 Bacteria 2021
556 nmdc:mga0k408_8084_c1 3300050493 Bacteria 5639
557 nmdc:mga0k408_86586_c1 3300050493 Bacteria 1839
558 nmdc:mga06z11_23471_c1 3300050494 Bacteria 2898
559 nmdc:mga06z11_257228_c1 3300050494 Bacteria 1029
560 nmdc:mga06z11_310121_c1 3300050494 Bacteria 940
561 nmdc:mga06z11_443623_c1 3300050494 Bacteria 784
562 nmdc:mga07m45_129546_c1 3300050496 Bacteria 1460
563 nmdc:mga07m45_12997_c1 3300050496 Bacteria 4405
564 nmdc:mga07m45_38894_c1 3300050496 Bacteria 2657
565 nmdc:mga07m45_615501_c1 3300050496 Bacteria 627
566 nmdc:mga07m45_621_c1 3300050496 Bacteria 15097
567 nmdc:mga07m45_6447_c1 3300050496 Bacteria 5932
568 nmdc:mga07m45_673335_c1 3300050496 Bacteria 596
569 nmdc:mga07m45_93201_c1 3300050496 Bacteria 1727
570 nmdc:mga08x19_905675_c1 3300050514 Bacteria 626
571 Ga0500610_0062112 3300053079 Bacteria 1949
572 Ga0500610_0090088 3300053079 Bacteria 1593
573 Ga0500610_0090090 3300053079 Bacteria 1593
574 Ga0500643_013299 3300053087 Bacteria 2912
575 Ga0500646_0044743 3300053090 Bacteria 1258
576 Ga0500583_0022055 3300053092 Bacteria 2661
577 Ga0500651_0000024 3300053093 Bacteria 129450
578 Ga0500651_0040760 3300053093 Bacteria 2926
579 Ga0500566_0022420 3300053094 Bacteria 3710
580 Ga0500641_0104376 3300053096 Bacteria 1217
581 Ga0500557_107123 3300053105 Bacteria 929
582 Ga0500562_019422 3300053108 Bacteria 1757
583 Ga0500562_026867 3300053108 Bacteria 1509
584 Ga0500571_000051 3300053110 Bacteria 35723
585 Ga0500572_130265 3300053111 Bacteria 817
586 Ga0500593_004259 3300053117 Bacteria 5524
587 Ga0500594_0010260 3300053118 Bacteria 2172
588 Ga0500594_0026175 3300053118 Bacteria 1501
589 Ga0500597_055374 3300053120 Bacteria 1696
590 Ga0500607_002042 3300053121 Bacteria 17000
591 Ga0500608_008130 3300053122 Bacteria 4390
592 Ga0500608_055371 3300053122 Bacteria 1901
593 Ga0500618_064668 3300053125 Bacteria 822
594 Ga0500642_0109629 3300053130 Bacteria 1288
595 Ga0500655_028456 3300053133 Bacteria 1069
596 Ga0500658_0000226 3300053134 Bacteria 26958
597 Ga0500658_0000310 3300053134 Bacteria 21887
598 Ga0500559_0371061 3300053136 Bacteria 668
599 Ga0500564_032436 3300053138 Bacteria 2409
600 Ga0500568_0005294 3300053139 Bacteria 6700
601 Ga0500568_0091100 3300053139 Bacteria 1150
602 Ga0500573_0187287 3300053140 Bacteria 1108
603 Ga0500574_003119 3300053141 Bacteria 2868
604 Ga0500577_0331208 3300053142 Bacteria 665
605 Ga0500586_077080 3300053145 Bacteria 1169
606 Ga0500616_0129426 3300053153 Bacteria 1194
607 Ga0500622_0089570 3300053156 Bacteria 1528
608 Ga0500627_0002002 3300053158 Bacteria 5885
609 Ga0500627_0260756 3300053158 Bacteria 765
610 Ga0500634_0039027 3300053161 Bacteria 2581
611 Ga0500634_0105752 3300053161 Bacteria 1399
612 Ga0500638_069226 3300053162 Bacteria 1688
613 Ga0500636_0062256 3300053177 Bacteria 2176
614 Ga0500625_043967 3300053729 Bacteria 2091
615 Ga0500565_037786 3300053734 Bacteria 663
616 Ga0500596_022041 3300053735 Bacteria 962
617 Ga0587073_0050942 3300059492 Bacteria 938
618 Ga0587080_004255 3300059503 Bacteria 1845
619 Ga0587090_064934 3300059510 Bacteria 701
620 Ga0587092_011314 3300059512 Bacteria 1238
621 Ga0587115_010043 3300059626 Bacteria 1172
622 Ga0587128_041058 3300059630 Bacteria 809
623 Ga0587062_020558 3300059639 Bacteria 932
624 Ga0587067_009157 3300059640 Bacteria 1468
625 Ga0587072_009963 3300059643 Bacteria 1528
626 Ga0587072_018522 3300059643 Bacteria 1210
627 Ga0587079_047766 3300059647 Bacteria 888
628 Ga0587104_009538 3300059650 Bacteria 701
629 Ga0587111_0051463 3300060346 Bacteria 910

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042125 Ga0450923_023279 Ga0450923_023279_866_1207 102
2 3300046684 Ga0495669_0290457 Ga0495669_0290457_13_354 102
3 3300048905 Ga0496102_0199227 Ga0496102_0199227_14_355 102
4 3300048927 Ga0496124_0125299 Ga0496124_0125299_14_355 102
5 3300037466 Ga0395898_0545691 Ga0395898_0545691_211_624 108
6 3300037471 Ga0395905_0858869 Ga0395905_0858869_34_447 108
7 3300045051 Ga0451576_1667408 Ga0451576_1667408_288_650 108
8 3300048909 Ga0496106_1031413 Ga0496106_1031413_13_375 108
9 3300050489 nmdc:mga03683_52313_c1 nmdc:mga03683_52313_c1_1334_1696 108
10 3300059503 Ga0587080_004255 Ga0587080_004255_764_1231 112
11 3300028794 Ga0307515_10323569 Ga0307515_103235692 113
12 3300041406 Ga0439439_0006621 Ga0439439_0006621_10_387 113
13 3300041410 Ga0439461_0155807 Ga0439461_0155807_190_567 113
14 3300042002 Ga0439442_019836 Ga0439442_019836_22_399 113
15 3300042006 Ga0439432_132048 Ga0439432_132048_125_502 113
16 3300042146 Ga0450907_100444 Ga0450907_100444_18_395 113
17 3300046455 Ga0495603_0716264 Ga0495603_0716264_182_559 113
18 3300046660 Ga0495625_0404267 Ga0495625_0404267_19_396 113
19 3300046691 Ga0495670_0313321 Ga0495670_0313321_32_409 113
20 3300048928 Ga0496125_0633723 Ga0496125_0633723_180_557 113
21 3300049822 Ga0501035_0450335 Ga0501035_0450335_450_860 113
22 3300049823 Ga0501044_0254398 Ga0501044_0254398_992_1402 113
23 3300049570 Ga0501033_0322692 Ga0501033_0322692_403_813 114
24 3300049823 Ga0501044_0055514 Ga0501044_0055514_1284_1694 114
25 3300048917 Ga0496114_0229356 Ga0496114_0229356_1012_1395 115
26 3300050493 nmdc:mga0k408_694560_c1 nmdc:mga0k408_694560_c1_85_498 115
27 3300013102 Ga0157371_10540285 Ga0157371_105402851 116
28 3300025923 Ga0207681_10689342 Ga0207681_106893421 116
29 3300031548 Ga0307408_100343937 Ga0307408_1003439372 116
30 3300031852 Ga0307410_10424144 Ga0307410_104241442 116
31 3300032002 Ga0307416_100208097 Ga0307416_1002080974 116
32 3300009553 Ga0105249_10079860 Ga0105249_100798602 118
33 3300025961 Ga0207712_10287368 Ga0207712_102873681 118
34 3300005617 Ga0068859_100839952 Ga0068859_1008399522 119
35 3300006931 Ga0097620_100839914 Ga0097620_1008399142 119
36 3300028380 Ga0268265_10350499 Ga0268265_103504992 119
37 3300028381 Ga0268264_10336814 Ga0268264_103368143 119
38 3300053092 Ga0500583_0022055 Ga0500583_0022055_1914_2381 119
39 3300053105 Ga0500557_107123 Ga0500557_107123_37_504 119
40 3300053118 Ga0500594_0026175 Ga0500594_0026175_956_1423 119
41 3300053130 Ga0500642_0109629 Ga0500642_0109629_798_1265 119
42 3300053139 Ga0500568_0091100 Ga0500568_0091100_40_507 119
43 3300053158 Ga0500627_0260756 Ga0500627_0260756_118_585 119
44 3300059512 Ga0587092_011314 Ga0587092_011314_198_641 119
45 3300059626 Ga0587115_010043 Ga0587115_010043_353_817 119
46 3300059630 Ga0587128_041058 Ga0587128_041058_122_580 119
47 3300059639 Ga0587062_020558 Ga0587062_020558_353_811 119
48 3300059640 Ga0587067_009157 Ga0587067_009157_226_669 119
49 3300059643 Ga0587072_018522 Ga0587072_018522_665_1123 119
50 3300059650 Ga0587104_009538 Ga0587104_009538_36_479 119
51 3300060346 Ga0587111_0051463 Ga0587111_0051463_311_769 119
52 3300050489 nmdc:mga03683_274048_c1 nmdc:mga03683_274048_c1_261_674 120
53 3300053108 Ga0500562_026867 Ga0500562_026867_400_810 120
54 3300053145 Ga0500586_077080 Ga0500586_077080_640_1050 120
55 3300053153 Ga0500616_0129426 Ga0500616_0129426_154_564 120
56 3300003203 JGI25406J46586_10017419 JGI25406J46586_100174193 121
57 3300005719 Ga0068861_100399966 Ga0068861_1003999662 121
58 3300005937 Ga0081455_10000016 Ga0081455_10000016163 121
59 3300005985 Ga0081539_10000060 Ga0081539_10000060260 121
60 3300006195 Ga0075366_10004750 Ga0075366_100047508 121
61 3300006353 Ga0075370_10183479 Ga0075370_101834793 121
62 3300006844 Ga0075428_102041055 Ga0075428_1020410551 121
63 3300028380 Ga0268265_10194630 Ga0268265_101946302 121
64 3300028381 Ga0268264_11431388 Ga0268264_114313881 121
65 3300028794 Ga0307515_10014383 Ga0307515_1001438311 121
66 3300031456 Ga0307513_10064926 Ga0307513_100649264 121
67 3300031649 Ga0307514_10000970 Ga0307514_1000097023 121
68 3300035172 Ga0373955_0139798 Ga0373955_0139798_474_887 121
69 3300035691 Ga0373931_0406181 Ga0373931_0406181_299_712 121
70 3300041494 Ga0451837_0796968 Ga0451837_0796968_13_423 121
71 3300046529 Ga0495652_0732578 Ga0495652_0732578_182_595 121
72 3300050493 nmdc:mga0k408_164149_c1 nmdc:mga0k408_164149_c1_463_915 121
73 3300050493 nmdc:mga0k408_6104_c1 nmdc:mga0k408_6104_c1_973_1386 121
74 3300050496 nmdc:mga07m45_615501_c1 nmdc:mga07m45_615501_c1_19_432 121
75 3300053136 Ga0500559_0371061 Ga0500559_0371061_131_544 121
76 iso_pu_bacteria 2513020051 2513227947 121
77 iso_pu_bacteria 2599185214 2599624098 121
78 iso_pu_bacteria 2599185226 2599672109 121
79 iso_pu_bacteria 2599185227 2599681808 121
80 iso_pu_bacteria 2599185229 2599693822 121
81 iso_pu_bacteria 2643221628 2644162651 121
82 iso_pu_bacteria 2643221658 2644328848 121
83 iso_pu_bacteria 2643221672 2644397933 121
84 iso_pu_bacteria 2643221683 2644469100 121
85 iso_pu_bacteria 2738541277 2738719878 121
86 iso_pu_bacteria 2738541307 2738879709 121
87 iso_pu_bacteria 2738543013 2739252208 121
88 iso_pu_bacteria 2738543019 2739279077 121
89 iso_pu_bacteria 2818991446 2819596542 121
90 iso_pu_bacteria 2831265667 2831269580 121
91 iso_pu_bacteria 2838054893 2838060071 121
92 iso_pu_bacteria 2842677519 2842677845 121
93 iso_pu_bacteria 2842733646 2842734660 121
94 iso_pu_bacteria 2842747753 2842748569 121
95 iso_pu_bacteria 2885192300 2885195556 121
96 iso_pu_bacteria 2885198086 2885199259 121
97 iso_pu_bacteria 2885211737 2885212910 121
98 iso_pu_bacteria 2899924645 2899931260 121
99 iso_pu_bacteria 2904449895 2904450120 121
100 iso_pu_bacteria 2904456579 2904457057 121
101 iso_pu_bacteria 2904541872 2904543976 121
102 iso_pu_bacteria 2919462493 2919464949 121
103 iso_pu_bacteria 2919704043 2919705329 121
104 iso_pu_bacteria 2928037797 2928037967 121
105 iso_pu_bacteria 2928044640 2928046427 121
106 iso_pu_bacteria 2928051484 2928054123 121
107 iso_pu_bacteria 2928064002 2928065876 121
108 iso_pu_bacteria 2928070936 2928076782 121
109 iso_pu_bacteria 2928084124 2928090469 121
110 iso_pu_bacteria 2929160207 2929162465 121
111 iso_pu_bacteria 2929520902 2929525405 121
112 iso_pu_bacteria 2945909444 2945913160 121
113 iso_pu_bacteria 2945945610 2945948781 121
114 iso_pu_bacteria 2945972063 2945972899 121
115 iso_pu_bacteria 2945984333 2945984566 121
116 iso_pu_bacteria 2954767861 2954772919 121
117 3300001979 JGI24740J21852_10009941 JGI24740J21852_100099415 123
118 3300001989 JGI24739J22299_10009105 JGI24739J22299_100091053 123
119 3300001989 JGI24739J22299_10009112 JGI24739J22299_100091123 123
120 3300002739 JGI25158J39367_1017379 JGI25158J39367_10173792 123
121 3300002773 JGI25152J39213_1006491 JGI25152J39213_10064915 123
122 3300002774 JGI25150J39212_1001672 JGI25150J39212_10016722 123
123 3300002987 JGI25159J45721_1010981 JGI25159J45721_10109812 123
124 3300003187 JGI25151J46595_10035846 JGI25151J46595_100358463 123
125 3300003215 JGI25153J46596_10015151 JGI25153J46596_100151512 123
126 3300003760 Ga0055527_1008634 Ga0055527_10086342 123
127 3300003761 Ga0055535_1000084 Ga0055535_100008480 123
128 3300003762 Ga0055542_1000033 Ga0055542_1000033109 123
129 3300003773 Ga0055537_1000163 Ga0055537_100016343 123
130 3300003781 Ga0055536_1001382 Ga0055536_100138217 123
131 3300003781 Ga0055536_1010724 Ga0055536_10107242 123
132 3300003781 Ga0055536_1012623 Ga0055536_10126232 123
133 3300003784 Ga0055534_1000150 Ga0055534_100015043 123
134 3300003784 Ga0055534_1011068 Ga0055534_10110683 123
135 3300003790 Ga0055528_1015922 Ga0055528_10159224 123
136 3300003791 Ga0055530_10004105 Ga0055530_100041056 123
137 3300003791 Ga0055530_10009858 Ga0055530_100098585 123
138 3300003792 Ga0055540_1000733 Ga0055540_10007332 123
139 3300003792 Ga0055540_1002197 Ga0055540_10021978 123
140 3300003792 Ga0055540_1008745 Ga0055540_10087455 123
141 3300003792 Ga0055540_1009657 Ga0055540_10096575 123
142 3300003792 Ga0055540_1010326 Ga0055540_10103262 123
143 3300003794 Ga0055531_10002763 Ga0055531_100027635 123
144 3300003794 Ga0055531_10008022 Ga0055531_100080222 123
145 3300003794 Ga0055531_10016888 Ga0055531_100168882 123
146 3300005288 Ga0065714_10005035 Ga0065714_100050353 123
147 3300005288 Ga0065714_10095928 Ga0065714_100959283 123
148 3300005289 Ga0065704_10078797 Ga0065704_100787973 123
149 3300005289 Ga0065704_10206224 Ga0065704_102062242 123
150 3300005333 Ga0070677_10342302 Ga0070677_103423022 123
151 3300005344 Ga0070661_100248879 Ga0070661_1002488793 123
152 3300005347 Ga0070668_100411113 Ga0070668_1004111132 123
153 3300005353 Ga0070669_100122085 Ga0070669_1001220853 123
154 3300005353 Ga0070669_100422150 Ga0070669_1004221501 123
155 3300005353 Ga0070669_101324948 Ga0070669_1013249481 123
156 3300005354 Ga0070675_101753794 Ga0070675_1017537941 123
157 3300005356 Ga0070674_100251225 Ga0070674_1002512253 123
158 3300005364 Ga0070673_100066282 Ga0070673_1000662822 123
159 3300005364 Ga0070673_100202065 Ga0070673_1002020654 123
160 3300005367 Ga0070667_100142295 Ga0070667_1001422952 123
161 3300005367 Ga0070667_100357708 Ga0070667_1003577083 123
162 3300005455 Ga0070663_101311900 Ga0070663_1013119001 123
163 3300005456 Ga0070678_100403844 Ga0070678_1004038441 123
164 3300005456 Ga0070678_100750372 Ga0070678_1007503722 123
165 3300005459 Ga0068867_100068007 Ga0068867_1000680073 123
166 3300005459 Ga0068867_100419898 Ga0068867_1004198982 123
167 3300005466 Ga0070685_10198344 Ga0070685_101983443 123
168 3300005539 Ga0068853_100072832 Ga0068853_1000728324 123
169 3300005539 Ga0068853_100721535 Ga0068853_1007215352 123
170 3300005543 Ga0070672_100822226 Ga0070672_1008222262 123
171 3300005548 Ga0070665_100015030 Ga0070665_10001503010 123
172 3300005548 Ga0070665_100954739 Ga0070665_1009547392 123
173 3300005563 Ga0068855_100221222 Ga0068855_1002212224 123
174 3300005577 Ga0068857_100052201 Ga0068857_1000522015 123
175 3300005577 Ga0068857_100118116 Ga0068857_1001181163 123
176 3300005616 Ga0068852_100498156 Ga0068852_1004981563 123
177 3300005616 Ga0068852_100566216 Ga0068852_1005662162 123
178 3300005834 Ga0068851_10039165 Ga0068851_100391653 123
179 3300005844 Ga0068862_100920535 Ga0068862_1009205351 123
180 3300006048 Ga0075363_100004195 Ga0075363_1000041953 123
181 3300006048 Ga0075363_100082873 Ga0075363_1000828732 123
182 3300006048 Ga0075363_100119746 Ga0075363_1001197462 123
183 3300006048 Ga0075363_100251559 Ga0075363_1002515592 123
184 3300006051 Ga0075364_10090522 Ga0075364_100905222 123
185 3300006051 Ga0075364_10587674 Ga0075364_105876742 123
186 3300006058 Ga0075432_10011325 Ga0075432_100113254 123
187 3300006177 Ga0075362_10002959 Ga0075362_100029596 123
188 3300006177 Ga0075362_10019624 Ga0075362_100196244 123
189 3300006177 Ga0075362_10048477 Ga0075362_100484774 123
190 3300006177 Ga0075362_10394988 Ga0075362_103949882 123
191 3300006178 Ga0075367_10019689 Ga0075367_100196893 123
192 3300006195 Ga0075366_10014149 Ga0075366_100141495 123
193 3300006195 Ga0075366_10069303 Ga0075366_100693034 123
194 3300006195 Ga0075366_10071598 Ga0075366_100715983 123
195 3300006195 Ga0075366_10103360 Ga0075366_101033603 123
196 3300006353 Ga0075370_10006471 Ga0075370_100064717 123
197 3300006353 Ga0075370_10007064 Ga0075370_100070646 123
198 3300006353 Ga0075370_10023681 Ga0075370_100236814 123
199 3300006353 Ga0075370_10059627 Ga0075370_100596273 123
200 3300006353 Ga0075370_10092515 Ga0075370_100925153 123
201 3300006946 Ga0079104_1033997 Ga0079104_10339972 123
202 3300006948 Ga0099826_10000055 Ga0099826_1000005511 123
203 3300006948 Ga0099826_10046013 Ga0099826_100460133 123
204 3300009036 Ga0105244_10030974 Ga0105244_100309742 123
205 3300009093 Ga0105240_10287930 Ga0105240_102879302 123
206 3300009098 Ga0105245_10275370 Ga0105245_102753702 123
207 3300009148 Ga0105243_10002185 Ga0105243_100021857 123
208 3300009148 Ga0105243_10769394 Ga0105243_107693942 123
209 3300009545 Ga0105237_10133427 Ga0105237_101334272 123
210 3300009553 Ga0105249_13257304 Ga0105249_132573042 123
211 3300010375 Ga0105239_10037060 Ga0105239_100370606 123
212 3300010375 Ga0105239_10310216 Ga0105239_103102163 123
213 3300011119 Ga0105246_10024498 Ga0105246_100244983 123
214 3300011119 Ga0105246_10093008 Ga0105246_100930084 123
215 3300013100 Ga0157373_10008333 Ga0157373_100083336 123
216 3300013104 Ga0157370_10257363 Ga0157370_102573632 123
217 3300013105 Ga0157369_10039882 Ga0157369_100398825 123
218 3300013306 Ga0163162_11229642 Ga0163162_112296422 123
219 3300013307 Ga0157372_10059193 Ga0157372_100591935 123
220 3300013308 Ga0157375_10519795 Ga0157375_105197953 123
221 3300013308 Ga0157375_10986285 Ga0157375_109862852 123
222 3300014325 Ga0163163_11165352 Ga0163163_111653522 123
223 3300014497 Ga0182008_10002275 Ga0182008_100022758 123
224 3300014497 Ga0182008_10023631 Ga0182008_100236313 123
225 3300014497 Ga0182008_10024712 Ga0182008_100247124 123
226 3300014497 Ga0182008_10042054 Ga0182008_100420544 123
227 3300014969 Ga0157376_10200490 Ga0157376_102004903 123
228 3300015261 Ga0182006_1001945 Ga0182006_100194511 123
229 3300015261 Ga0182006_1066693 Ga0182006_10666932 123
230 3300015261 Ga0182006_1069001 Ga0182006_10690013 123
231 3300015262 Ga0182007_10001682 Ga0182007_1000168213 123
232 3300015262 Ga0182007_10020057 Ga0182007_100200571 123
233 3300015265 Ga0182005_1019210 Ga0182005_10192103 123
234 3300015265 Ga0182005_1043555 Ga0182005_10435552 123
235 3300015265 Ga0182005_1058977 Ga0182005_10589772 123
236 3300015683 Ga0183362_10001 Ga0183362_10001601 123
237 3300015683 Ga0183362_10002 Ga0183362_10002485 123
238 3300017792 Ga0163161_10000128 Ga0163161_1000012873 123
239 3300017792 Ga0163161_10003865 Ga0163161_100038654 123
240 3300017792 Ga0163161_10007397 Ga0163161_100073974 123
241 3300017792 Ga0163161_10043851 Ga0163161_100438512 123
242 3300017792 Ga0163161_11498852 Ga0163161_114988521 123
243 3300025208 Ga0209436_112396 Ga0209436_1123961 123
244 3300025228 Ga0209672_100228 Ga0209672_10022826 123
245 3300025242 Ga0209258_100089 Ga0209258_100089108 123
246 3300025245 Ga0207425_1001684 Ga0207425_10016847 123
247 3300025245 Ga0207425_1003926 Ga0207425_10039267 123
248 3300025254 Ga0209148_1000097 Ga0209148_1000097108 123
249 3300025258 Ga0209129_1000033 Ga0209129_1000033292 123
250 3300025258 Ga0209129_1001977 Ga0209129_10019776 123
251 3300025258 Ga0209129_1007540 Ga0209129_10075405 123
252 3300025263 Ga0209565_1000120 Ga0209565_100012075 123
253 3300025263 Ga0209565_1000516 Ga0209565_100051618 123
254 3300025263 Ga0209565_1000980 Ga0209565_100098020 123
255 3300025273 Ga0209673_1000099 Ga0209673_1000099125 123
256 3300025273 Ga0209673_1000899 Ga0209673_100089919 123
257 3300025273 Ga0209673_1001394 Ga0209673_10013947 123
258 3300025273 Ga0209673_1006035 Ga0209673_10060357 123
259 3300025284 Ga0209130_1000105 Ga0209130_1000105116 123
260 3300025284 Ga0209130_1000615 Ga0209130_100061529 123
261 3300025291 Ga0209675_1000054 Ga0209675_1000054125 123
262 3300025291 Ga0209675_1000588 Ga0209675_100058814 123
263 3300025291 Ga0209675_1001765 Ga0209675_10017657 123
264 3300025291 Ga0209675_1004983 Ga0209675_10049837 123
265 3300025291 Ga0209675_1084484 Ga0209675_10844841 123
266 3300025292 Ga0209676_1000260 Ga0209676_100026047 123
267 3300025292 Ga0209676_1001304 Ga0209676_10013044 123
268 3300025292 Ga0209676_1004531 Ga0209676_10045317 123
269 3300025292 Ga0209676_1021203 Ga0209676_10212033 123
270 3300025292 Ga0209676_1033402 Ga0209676_10334021 123
271 3300025294 Ga0209025_1000221 Ga0209025_1000221112 123
272 3300025294 Ga0209025_1000732 Ga0209025_100073220 123
273 3300025294 Ga0209025_1001070 Ga0209025_100107016 123
274 3300025294 Ga0209025_1009557 Ga0209025_10095576 123
275 3300025294 Ga0209025_1014260 Ga0209025_10142604 123
276 3300025295 Ga0209564_1000151 Ga0209564_1000151141 123
277 3300025295 Ga0209564_1000246 Ga0209564_100024632 123
278 3300025297 Ga0209758_1000027 Ga0209758_1000027292 123
279 3300025298 Ga0209050_1000977 Ga0209050_100097730 123
280 3300025298 Ga0209050_1002366 Ga0209050_100236616 123
281 3300025298 Ga0209050_1024517 Ga0209050_10245172 123
282 3300025299 Ga0209256_1000069 Ga0209256_1000069189 123
283 3300025299 Ga0209256_1000506 Ga0209256_100050620 123
284 3300025302 Ga0207426_1000027 Ga0207426_1000027257 123
285 3300025302 Ga0207426_1000859 Ga0207426_10008594 123
286 3300025303 Ga0209051_1000319 Ga0209051_10003197 123
287 3300025303 Ga0209051_1000510 Ga0209051_100051021 123
288 3300025303 Ga0209051_1000707 Ga0209051_10007075 123
289 3300025303 Ga0209051_1000832 Ga0209051_100083232 123
290 3300025303 Ga0209051_1005253 Ga0209051_100525310 123
291 3300025303 Ga0209051_1050284 Ga0209051_10502843 123
292 3300025303 Ga0209051_1083255 Ga0209051_10832552 123
293 3300025304 Ga0209257_1000281 Ga0209257_1000281111 123
294 3300025304 Ga0209257_1001995 Ga0209257_10019955 123
295 3300025304 Ga0209257_1018084 Ga0209257_10180843 123
296 3300025321 Ga0207656_10016928 Ga0207656_100169283 123
297 3300025728 Ga0207655_1000566 Ga0207655_100056634 123
298 3300025893 Ga0207682_10069310 Ga0207682_100693102 123
299 3300025904 Ga0207647_10461398 Ga0207647_104613981 123
300 3300025907 Ga0207645_10665219 Ga0207645_106652192 123
301 3300025909 Ga0207705_10200787 Ga0207705_102007871 123
302 3300025913 Ga0207695_10330048 Ga0207695_103300482 123
303 3300025913 Ga0207695_11317852 Ga0207695_113178522 123
304 3300025923 Ga0207681_11415511 Ga0207681_114155111 123
305 3300025926 Ga0207659_10849222 Ga0207659_108492221 123
306 3300025932 Ga0207690_10781392 Ga0207690_107813921 123
307 3300025933 Ga0207706_11160545 Ga0207706_111605452 123
308 3300025935 Ga0207709_10000230 Ga0207709_1000023034 123
309 3300025935 Ga0207709_10000240 Ga0207709_1000024047 123
310 3300025937 Ga0207669_10017951 Ga0207669_100179515 123
311 3300025940 Ga0207691_10142942 Ga0207691_101429425 123
312 3300025940 Ga0207691_10416100 Ga0207691_104161003 123
313 3300025942 Ga0207689_10212581 Ga0207689_102125813 123
314 3300025960 Ga0207651_10126091 Ga0207651_101260911 123
315 3300025960 Ga0207651_10213950 Ga0207651_102139502 123
316 3300025960 Ga0207651_11942184 Ga0207651_119421841 123
317 3300025981 Ga0207640_10333840 Ga0207640_103338402 123
318 3300025981 Ga0207640_10596239 Ga0207640_105962392 123
319 3300025986 Ga0207658_10303117 Ga0207658_103031172 123
320 3300025986 Ga0207658_10943868 Ga0207658_109438682 123
321 3300026041 Ga0207639_10001769 Ga0207639_1000176914 123
322 3300026041 Ga0207639_10389927 Ga0207639_103899272 123
323 3300026116 Ga0207674_10180344 Ga0207674_101803442 123
324 3300026116 Ga0207674_10182736 Ga0207674_101827362 123
325 3300026121 Ga0207683_10400740 Ga0207683_104007402 123
326 3300026121 Ga0207683_10554621 Ga0207683_105546213 123
327 3300026121 Ga0207683_10732854 Ga0207683_107328542 123
328 3300026121 Ga0207683_11523680 Ga0207683_115236801 123
329 3300026121 Ga0207683_11669200 Ga0207683_116692002 123
330 3300026142 Ga0207698_10538410 Ga0207698_105384103 123
331 3300026142 Ga0207698_10756004 Ga0207698_107560041 123
332 3300027666 Ga0209282_1000133 Ga0209282_10001339 123
333 3300027666 Ga0209282_1056012 Ga0209282_10560122 123
334 3300027907 Ga0207428_10631273 Ga0207428_106312731 123
335 3300028379 Ga0268266_10006402 Ga0268266_100064026 123
336 3300028380 Ga0268265_10064885 Ga0268265_100648851 123
337 3300028786 Ga0307517_10235337 Ga0307517_102353372 123
338 3300028794 Ga0307515_10001286 Ga0307515_1000128651 123
339 3300028794 Ga0307515_10497597 Ga0307515_104975972 123
340 3300030731 Ga0316177_1065678 Ga0316177_106567810 123
341 3300030733 Ga0314311_1013889 Ga0314311_10138894 123
342 3300030734 Ga0316179_1063999 Ga0316179_10639992 123
343 3300030735 Ga0316178_1010531 Ga0316178_10105313 123
344 3300030736 Ga0316180_1110739 Ga0316180_11107392 123
345 3300030742 Ga0316183_1052716 Ga0316183_10527162 123
346 3300030744 Ga0316181_1013742 Ga0316181_10137422 123
347 3300030744 Ga0316181_1028550 Ga0316181_10285502 123
348 3300030745 Ga0316182_1071522 Ga0316182_10715225 123
349 3300030745 Ga0316182_1178183 Ga0316182_11781838 123
350 3300031251 Ga0265327_10018197 Ga0265327_100181975 123
351 3300031456 Ga0307513_10510289 Ga0307513_105102892 123
352 3300031548 Ga0307408_100036293 Ga0307408_1000362932 123
353 3300031548 Ga0307408_100060036 Ga0307408_1000600364 123
354 3300031548 Ga0307408_100121018 Ga0307408_1001210183 123
355 3300031548 Ga0307408_100345631 Ga0307408_1003456311 123
356 3300031649 Ga0307514_10130289 Ga0307514_101302893 123
357 3300031730 Ga0307516_10332445 Ga0307516_103324452 123
358 3300031731 Ga0307405_10018778 Ga0307405_100187785 123
359 3300031731 Ga0307405_10032179 Ga0307405_100321793 123
360 3300031731 Ga0307405_10087297 Ga0307405_100872972 123
361 3300031731 Ga0307405_10131640 Ga0307405_101316402 123
362 3300031731 Ga0307405_10153897 Ga0307405_101538972 123
363 3300031731 Ga0307405_10463745 Ga0307405_104637452 123
364 3300031824 Ga0307413_10233292 Ga0307413_102332922 123
365 3300031852 Ga0307410_10071197 Ga0307410_100711972 123
366 3300031901 Ga0307406_10027594 Ga0307406_100275944 123
367 3300031901 Ga0307406_10072562 Ga0307406_100725623 123
368 3300031901 Ga0307406_10441674 Ga0307406_104416741 123
369 3300031901 Ga0307406_10840986 Ga0307406_108409861 123
370 3300031901 Ga0307406_11107402 Ga0307406_111074022 123
371 3300031903 Ga0307407_10034424 Ga0307407_100344245 123
372 3300031903 Ga0307407_10943127 Ga0307407_109431271 123
373 3300031911 Ga0307412_10062950 Ga0307412_100629503 123
374 3300031911 Ga0307412_10215409 Ga0307412_102154091 123
375 3300031911 Ga0307412_10247168 Ga0307412_102471683 123
376 3300031911 Ga0307412_10351597 Ga0307412_103515971 123
377 3300031911 Ga0307412_10481259 Ga0307412_104812592 123
378 3300031911 Ga0307412_10539920 Ga0307412_105399202 123
379 3300031995 Ga0307409_100855704 Ga0307409_1008557042 123
380 3300032002 Ga0307416_100314494 Ga0307416_1003144942 123
381 3300032002 Ga0307416_101121357 Ga0307416_1011213572 123
382 3300032004 Ga0307414_10020805 Ga0307414_100208053 123
383 3300032004 Ga0307414_10127276 Ga0307414_101272761 123
384 3300032004 Ga0307414_10544200 Ga0307414_105442002 123
385 3300032004 Ga0307414_10608039 Ga0307414_106080392 123
386 3300032004 Ga0307414_11485780 Ga0307414_114857801 123
387 3300032005 Ga0307411_10065232 Ga0307411_100652323 123
388 3300032005 Ga0307411_10522740 Ga0307411_105227401 123
389 3300032005 Ga0307411_11283952 Ga0307411_112839521 123
390 3300041404 Ga0439436_0000274 Ga0439436_0000274_6665_7078 123
391 3300041404 Ga0439436_0003221 Ga0439436_0003221_1145_1558 123
392 3300041404 Ga0439436_0019474 Ga0439436_0019474_154_567 123
393 3300041406 Ga0439439_0007932 Ga0439439_0007932_666_1079 123
394 3300041406 Ga0439439_0274052 Ga0439439_0274052_39_452 123
395 3300041411 Ga0439466_0008277 Ga0439466_0008277_569_982 123
396 3300041411 Ga0439466_0024317 Ga0439466_0024317_1226_1639 123
397 3300041413 Ga0439465_0000448 Ga0439465_0000448_7106_7519 123
398 3300041413 Ga0439465_0010317 Ga0439465_0010317_1225_1638 123
399 3300041452 Ga0451793_0142041 Ga0451793_0142041_226_639 123
400 3300041452 Ga0451793_0638839 Ga0451793_0638839_183_596 123
401 3300041503 Ga0451847_0557802 Ga0451847_0557802_115_585 123
402 3300041997 Ga0439431_0000929 Ga0439431_0000929_101_514 123
403 3300041997 Ga0439431_0018549 Ga0439431_0018549_1106_1519 123
404 3300041999 Ga0439433_0000142 Ga0439433_0000142_6585_6998 123
405 3300041999 Ga0439433_0002117 Ga0439433_0002117_618_1031 123
406 3300042002 Ga0439442_108196 Ga0439442_108196_66_479 123
407 3300042004 Ga0439445_0007988 Ga0439445_0007988_122_535 123
408 3300042004 Ga0439445_0017470 Ga0439445_0017470_526_939 123
409 3300042004 Ga0439445_0027061 Ga0439445_0027061_203_613 123
410 3300042006 Ga0439432_002894 Ga0439432_002894_629_1042 123
411 3300042006 Ga0439432_009431 Ga0439432_009431_882_1295 123
412 3300042007 Ga0439449_0000240 Ga0439449_0000240_11366_11779 123
413 3300042007 Ga0439449_0001968 Ga0439449_0001968_3759_4172 123
414 3300042007 Ga0439449_0002571 Ga0439449_0002571_1448_1861 123
415 3300042007 Ga0439449_0003071 Ga0439449_0003071_777_1190 123
416 3300042010 Ga0439452_013517 Ga0439452_013517_1636_2049 123
417 3300042010 Ga0439452_026999 Ga0439452_026999_823_1236 123
418 3300042014 Ga0439457_010186 Ga0439457_010186_807_1220 123
419 3300042014 Ga0439457_011388 Ga0439457_011388_404_817 123
420 3300042015 Ga0439462_0000492 Ga0439462_0000492_5774_6187 123
421 3300042015 Ga0439462_0015377 Ga0439462_0015377_1516_1929 123
422 3300042015 Ga0439462_0066923 Ga0439462_0066923_371_784 123
423 3300042115 Ga0450911_000343 Ga0450911_000343_14725_15135 123
424 3300042118 Ga0450914_004754 Ga0450914_004754_402_815 123
425 3300042122 Ga0450920_003461 Ga0450920_003461_732_1145 123
426 3300042125 Ga0450923_038683 Ga0450923_038683_101_514 123
427 3300042133 Ga0450896_010164 Ga0450896_010164_45_458 123
428 3300042134 Ga0450898_004135 Ga0450898_004135_670_1083 123
429 3300042134 Ga0450898_005436 Ga0450898_005436_627_1040 123
430 3300042134 Ga0450898_057525 Ga0450898_057525_226_639 123
431 3300042145 Ga0450906_005956 Ga0450906_005956_968_1381 123
432 3300042145 Ga0450906_010007 Ga0450906_010007_1312_1725 123
433 3300042145 Ga0450906_065714 Ga0450906_065714_122_535 123
434 3300042146 Ga0450907_004688 Ga0450907_004688_1500_1913 123
435 3300042156 Ga0439446_0022790 Ga0439446_0022790_1243_1656 123
436 3300042156 Ga0439446_0024579 Ga0439446_0024579_214_627 123
437 3300042184 Ga0450908_000352 Ga0450908_000352_164_577 123
438 3300042184 Ga0450908_024203 Ga0450908_024203_573_986 123
439 3300042435 Ga0439434_0003838 Ga0439434_0003838_1382_1795 123
440 3300042435 Ga0439434_0005115 Ga0439434_0005115_1766_2179 123
441 3300042435 Ga0439434_0016814 Ga0439434_0016814_339_752 123
442 3300042436 Ga0439435_0178670 Ga0439435_0178670_147_560 123
443 3300042531 Ga0450918_000204 Ga0450918_000204_10910_11323 123
444 3300042531 Ga0450918_027273 Ga0450918_027273_150_563 123
445 3300044683 Ga0466965_0056035 Ga0466965_0056035_534_947 123
446 3300046453 Ga0495627_032104 Ga0495627_032104_655_1068 123
447 3300046460 Ga0495638_0019793 Ga0495638_0019793_740_1153 123
448 3300046462 Ga0495651_0213257 Ga0495651_0213257_837_1250 123
449 3300046462 Ga0495651_0672169 Ga0495651_0672169_66_479 123
450 3300046475 Ga0495639_0208759 Ga0495639_0208759_113_526 123
451 3300046477 Ga0495664_0206199 Ga0495664_0206199_481_894 123
452 3300046512 Ga0495610_0009323 Ga0495610_0009323_3938_4351 123
453 3300046512 Ga0495610_0200236 Ga0495610_0200236_275_688 123
454 3300046513 Ga0495616_0018411 Ga0495616_0018411_3022_3435 123
455 3300046515 Ga0495620_0008425 Ga0495620_0008425_998_1411 123
456 3300046518 Ga0495631_0026219 Ga0495631_0026219_1212_1625 123
457 3300046520 Ga0495637_0177825 Ga0495637_0177825_290_703 123
458 3300046522 Ga0495643_0056092 Ga0495643_0056092_1247_1660 123
459 3300046528 Ga0495642_0054355 Ga0495642_0054355_404_817 123
460 3300046530 Ga0495654_0042640 Ga0495654_0042640_704_1117 123
461 3300046536 Ga0495587_0293368 Ga0495587_0293368_102_515 123
462 3300046539 Ga0495621_0012181 Ga0495621_0012181_1318_1731 123
463 3300046539 Ga0495621_0203355 Ga0495621_0203355_67_480 123
464 3300046557 Ga0495622_0086440 Ga0495622_0086440_439_852 123
465 3300046559 Ga0495667_0264057 Ga0495667_0264057_336_749 123
466 3300046615 Ga0495656_0000376 Ga0495656_0000376_6101_6514 123
467 3300046615 Ga0495656_0025242 Ga0495656_0025242_1409_1822 123
468 3300046616 Ga0495668_0310121 Ga0495668_0310121_201_614 123
469 3300046660 Ga0495625_0000903 Ga0495625_0000903_28405_28818 123
470 3300046660 Ga0495625_0030774 Ga0495625_0030774_1265_1678 123
471 3300046663 Ga0495635_0796382 Ga0495635_0796382_74_487 123
472 3300046665 Ga0495661_0045654 Ga0495661_0045654_398_811 123
473 3300046674 Ga0495588_0033071 Ga0495588_0033071_2088_2501 123
474 3300046674 Ga0495588_0079733 Ga0495588_0079733_668_1081 123
475 3300046674 Ga0495588_0196150 Ga0495588_0196150_22_435 123
476 3300046675 Ga0495657_0263056 Ga0495657_0263056_441_854 123
477 3300046678 Ga0495599_0168685 Ga0495599_0168685_893_1306 123
478 3300046684 Ga0495669_0099795 Ga0495669_0099795_397_810 123
479 3300046692 Ga0495671_0144860 Ga0495671_0144860_449_862 123
480 3300046809 Ga0495600_0264373 Ga0495600_0264373_14_427 123
481 3300047321 Ga0495676_0001292 Ga0495676_0001292_14338_14751 123
482 3300047445 Ga0495677_0410705 Ga0495677_0410705_57_470 123
483 3300047673 Ga0495593_0000578 Ga0495593_0000578_1209_1622 123
484 3300048089 Ga0495614_0000302 Ga0495614_0000302_1392_1805 123
485 3300048903 Ga0496100_0006543 Ga0496100_0006543_4545_4958 123
486 3300048904 Ga0496101_0005412 Ga0496101_0005412_6035_6448 123
487 3300048906 Ga0496103_0092168 Ga0496103_0092168_873_1286 123
488 3300048907 Ga0496104_0003045 Ga0496104_0003045_851_1264 123
489 3300048908 Ga0496105_0000491 Ga0496105_0000491_25056_25469 123
490 3300048910 Ga0496107_0246139 Ga0496107_0246139_789_1202 123
491 3300048911 Ga0496108_0081281 Ga0496108_0081281_876_1289 123
492 3300048912 Ga0496109_1578803 Ga0496109_1578803_23_451 123
493 3300048913 Ga0496110_0196262 Ga0496110_0196262_1386_1799 123
494 3300048913 Ga0496110_0229658 Ga0496110_0229658_964_1377 123
495 3300048914 Ga0496111_0292006 Ga0496111_0292006_193_606 123
496 3300048914 Ga0496111_0795870 Ga0496111_0795870_18_431 123
497 3300048917 Ga0496114_0295217 Ga0496114_0295217_737_1150 123
498 3300048919 Ga0496116_0064175 Ga0496116_0064175_232_645 123
499 3300048919 Ga0496116_0134839 Ga0496116_0134839_144_557 123
500 3300048920 Ga0496117_0022168 Ga0496117_0022168_58_471 123
501 3300048920 Ga0496117_0026152 Ga0496117_0026152_1464_1877 123
502 3300048920 Ga0496117_0072100 Ga0496117_0072100_505_918 123
503 3300048921 Ga0496118_0014322 Ga0496118_0014322_5630_6043 123
504 3300048921 Ga0496118_0282042 Ga0496118_0282042_264_677 123
505 3300048921 Ga0496118_0317712 Ga0496118_0317712_236_649 123
506 3300048922 Ga0496119_0088212 Ga0496119_0088212_1183_1596 123
507 3300048924 Ga0496121_0045413 Ga0496121_0045413_1502_1915 123
508 3300048924 Ga0496121_0068195 Ga0496121_0068195_1747_2160 123
509 3300048925 Ga0496122_0000546 Ga0496122_0000546_60844_61260 123
510 3300048925 Ga0496122_0143883 Ga0496122_0143883_356_769 123
511 3300048925 Ga0496122_0245083 Ga0496122_0245083_209_622 123
512 3300048925 Ga0496122_0390091 Ga0496122_0390091_152_565 123
513 3300048926 Ga0496123_0000235 Ga0496123_0000235_51839_52255 123
514 3300048926 Ga0496123_0105190 Ga0496123_0105190_805_1218 123
515 3300048927 Ga0496124_0016715 Ga0496124_0016715_3421_3837 123
516 3300048927 Ga0496124_0053327 Ga0496124_0053327_1247_1657 123
517 3300048927 Ga0496124_0326839 Ga0496124_0326839_270_683 123
518 3300048927 Ga0496124_0345612 Ga0496124_0345612_439_852 123
519 3300048927 Ga0496124_0634945 Ga0496124_0634945_254_667 123
520 3300048928 Ga0496125_0005957 Ga0496125_0005957_10699_11109 123
521 3300048928 Ga0496125_0012018 Ga0496125_0012018_7551_7961 123
522 3300048928 Ga0496125_0021920 Ga0496125_0021920_1879_2289 123
523 3300048928 Ga0496125_0050661 Ga0496125_0050661_464_877 123
524 3300048928 Ga0496125_0062052 Ga0496125_0062052_988_1401 123
525 3300048928 Ga0496125_0444840 Ga0496125_0444840_138_551 123
526 3300048929 Ga0496126_0162420 Ga0496126_0162420_610_1020 123
527 3300049160 Ga0501304_006403 Ga0501304_006403_351_764 123
528 3300049548 Ga0501332_09021 Ga0501332_09021_179_592 123
529 3300049553 Ga0501337_007091 Ga0501337_007091_179_592 123
530 3300049679 Ga0501249_007483 Ga0501249_007483_834_1247 123
531 3300049686 Ga0501257_106870 Ga0501257_106870_266_679 123
532 3300049705 Ga0501225_0034151 Ga0501225_0034151_755_1168 123
533 3300049759 Ga0501262_004604 Ga0501262_004604_359_772 123
534 3300050489 nmdc:mga03683_2243_c1 nmdc:mga03683_2243_c1_5107_5520 123
535 3300050489 nmdc:mga03683_337243_c1 nmdc:mga03683_337243_c1_186_599 123
536 3300050489 nmdc:mga03683_37509_c1 nmdc:mga03683_37509_c1_493_906 123
537 3300050489 nmdc:mga03683_471932_c1 nmdc:mga03683_471932_c1_31_444 123
538 3300050490 nmdc:mga03n38_15636_c1 nmdc:mga03n38_15636_c1_1034_1447 123
539 3300050490 nmdc:mga03n38_219946_c1 nmdc:mga03n38_219946_c1_442_855 123
540 3300050490 nmdc:mga03n38_51229_c1 nmdc:mga03n38_51229_c1_45_458 123
541 3300050491 nmdc:mga00v17_95592_c1 nmdc:mga00v17_95592_c1_740_1153 123
542 3300050492 nmdc:mga0yw44_214938_c1 nmdc:mga0yw44_214938_c1_563_976 123
543 3300050492 nmdc:mga0yw44_71077_c1 nmdc:mga0yw44_71077_c1_1350_1763 123
544 3300050493 nmdc:mga0k408_199292_c1 nmdc:mga0k408_199292_c1_426_839 123
545 3300050493 nmdc:mga0k408_35698_c1 nmdc:mga0k408_35698_c1_1019_1432 123
546 3300050493 nmdc:mga0k408_71802_c1 nmdc:mga0k408_71802_c1_236_649 123
547 3300050493 nmdc:mga0k408_8084_c1 nmdc:mga0k408_8084_c1_1045_1458 123
548 3300050493 nmdc:mga0k408_86586_c1 nmdc:mga0k408_86586_c1_35_448 123
549 3300050494 nmdc:mga06z11_23471_c1 nmdc:mga06z11_23471_c1_1495_1908 123
550 3300050494 nmdc:mga06z11_257228_c1 nmdc:mga06z11_257228_c1_320_733 123
551 3300050494 nmdc:mga06z11_310121_c1 nmdc:mga06z11_310121_c1_35_448 123
552 3300050494 nmdc:mga06z11_443623_c1 nmdc:mga06z11_443623_c1_287_700 123
553 3300050496 nmdc:mga07m45_129546_c1 nmdc:mga07m45_129546_c1_629_1042 123
554 3300050496 nmdc:mga07m45_12997_c1 nmdc:mga07m45_12997_c1_1078_1491 123
555 3300050496 nmdc:mga07m45_38894_c1 nmdc:mga07m45_38894_c1_1046_1459 123
556 3300050496 nmdc:mga07m45_621_c1 nmdc:mga07m45_621_c1_13485_13898 123
557 3300050496 nmdc:mga07m45_6447_c1 nmdc:mga07m45_6447_c1_4420_4833 123
558 3300050496 nmdc:mga07m45_673335_c1 nmdc:mga07m45_673335_c1_159_572 123
559 3300050496 nmdc:mga07m45_93201_c1 nmdc:mga07m45_93201_c1_321_734 123
560 3300050514 nmdc:mga08x19_905675_c1 nmdc:mga08x19_905675_c1_23_436 123
561 3300053079 Ga0500610_0062112 Ga0500610_0062112_1219_1632 123
562 3300053079 Ga0500610_0090088 Ga0500610_0090088_815_1228 123
563 3300053079 Ga0500610_0090090 Ga0500610_0090090_366_779 123
564 3300053087 Ga0500643_013299 Ga0500643_013299_1363_1776 123
565 3300053090 Ga0500646_0044743 Ga0500646_0044743_688_1104 123
566 3300053093 Ga0500651_0000024 Ga0500651_0000024_107567_107980 123
567 3300053094 Ga0500566_0022420 Ga0500566_0022420_2789_3202 123
568 3300053096 Ga0500641_0104376 Ga0500641_0104376_530_943 123
569 3300053108 Ga0500562_019422 Ga0500562_019422_95_508 123
570 3300053110 Ga0500571_000051 Ga0500571_000051_24165_24578 123
571 3300053111 Ga0500572_130265 Ga0500572_130265_305_718 123
572 3300053117 Ga0500593_004259 Ga0500593_004259_4875_5288 123
573 3300053118 Ga0500594_0010260 Ga0500594_0010260_1158_1574 123
574 3300053120 Ga0500597_055374 Ga0500597_055374_40_453 123
575 3300053121 Ga0500607_002042 Ga0500607_002042_3465_3878 123
576 3300053122 Ga0500608_008130 Ga0500608_008130_831_1244 123
577 3300053122 Ga0500608_055371 Ga0500608_055371_1213_1626 123
578 3300053125 Ga0500618_064668 Ga0500618_064668_197_613 123
579 3300053133 Ga0500655_028456 Ga0500655_028456_465_878 123
580 3300053134 Ga0500658_0000226 Ga0500658_0000226_23263_23676 123
581 3300053134 Ga0500658_0000310 Ga0500658_0000310_21268_21681 123
582 3300053138 Ga0500564_032436 Ga0500564_032436_740_1153 123
583 3300053139 Ga0500568_0005294 Ga0500568_0005294_1398_1811 123
584 3300053140 Ga0500573_0187287 Ga0500573_0187287_422_838 123
585 3300053141 Ga0500574_003119 Ga0500574_003119_1369_1782 123
586 3300053142 Ga0500577_0331208 Ga0500577_0331208_241_654 123
587 3300053156 Ga0500622_0089570 Ga0500622_0089570_103_519 123
588 3300053158 Ga0500627_0002002 Ga0500627_0002002_4224_4637 123
589 3300053161 Ga0500634_0039027 Ga0500634_0039027_801_1214 123
590 3300053162 Ga0500638_069226 Ga0500638_069226_1051_1464 123
591 3300053177 Ga0500636_0062256 Ga0500636_0062256_656_1069 123
592 3300053729 Ga0500625_043967 Ga0500625_043967_1083_1496 123
593 3300053734 Ga0500565_037786 Ga0500565_037786_238_651 123
594 3300053735 Ga0500596_022041 Ga0500596_022041_181_594 123
595 3300059492 Ga0587073_0050942 Ga0587073_0050942_340_783 123
596 3300059510 Ga0587090_064934 Ga0587090_064934_183_596 123
597 3300059643 Ga0587072_009963 Ga0587072_009963_1042_1455 123
598 3300059647 Ga0587079_047766 Ga0587079_047766_307_750 123
599 3300005333 Ga0070677_10087359 Ga0070677_100873592 124
600 3300012502 Ga0157347_1034967 Ga0157347_10349671 124
601 3300013104 Ga0157370_10006222 Ga0157370_1000622216 124
602 3300045051 Ga0451576_0638903 Ga0451576_0638903_67_480 124
603 3300046524 Ga0495648_0145456 Ga0495648_0145456_461_874 124
604 3300048929 Ga0496126_0555945 Ga0496126_0555945_327_740 124
605 2162886007 SwRhRL2b_contig_740581 SwRhRL2b_0864.00006990 125
606 3300003792 Ga0055540_1031202 Ga0055540_10312022 125
607 3300003794 Ga0055531_10000254 Ga0055531_100002544 125
608 3300005289 Ga0065704_10104343 Ga0065704_101043432 125
609 3300005327 Ga0070658_10084607 Ga0070658_100846073 125
610 3300005327 Ga0070658_10128255 Ga0070658_101282553 125
611 3300005327 Ga0070658_10475809 Ga0070658_104758091 125
612 3300005328 Ga0070676_10440814 Ga0070676_104408142 125
613 3300005331 Ga0070670_100046178 Ga0070670_1000461786 125
614 3300005336 Ga0070680_100142496 Ga0070680_1001424962 125
615 3300005339 Ga0070660_100009303 Ga0070660_1000093037 125
616 3300005347 Ga0070668_101315368 Ga0070668_1013153682 125
617 3300005366 Ga0070659_100292456 Ga0070659_1002924562 125
618 3300005441 Ga0070700_100473375 Ga0070700_1004733752 125
619 3300005530 Ga0070679_100041448 Ga0070679_1000414485 125
620 3300005530 Ga0070679_100320606 Ga0070679_1003206061 125
621 3300005563 Ga0068855_100001070 Ga0068855_10000107021 125
622 3300005618 Ga0068864_100398707 Ga0068864_1003987072 125
623 3300005841 Ga0068863_100284610 Ga0068863_1002846103 125
624 3300006051 Ga0075364_10138987 Ga0075364_101389872 125
625 3300006881 Ga0068865_101198511 Ga0068865_1011985112 125
626 3300009036 Ga0105244_10354900 Ga0105244_103549001 125
627 3300009093 Ga0105240_10033861 Ga0105240_100338614 125
628 3300009176 Ga0105242_10002960 Ga0105242_1000296011 125
629 3300009177 Ga0105248_10103953 Ga0105248_101039535 125
630 3300009551 Ga0105238_10079657 Ga0105238_100796574 125
631 3300025273 Ga0209673_1027678 Ga0209673_10276782 125
632 3300025273 Ga0209673_1037594 Ga0209673_10375943 125
633 3300025303 Ga0209051_1000055 Ga0209051_100005535 125
634 3300025304 Ga0209257_1000101 Ga0209257_10001019 125
635 3300025909 Ga0207705_10176113 Ga0207705_101761133 125
636 3300025909 Ga0207705_10238103 Ga0207705_102381031 125
637 3300025913 Ga0207695_10093746 Ga0207695_100937463 125
638 3300025921 Ga0207652_10032128 Ga0207652_100321284 125
639 3300025924 Ga0207694_10042687 Ga0207694_100426874 125
640 3300025925 Ga0207650_10842234 Ga0207650_108422342 125
641 3300025929 Ga0207664_11131630 Ga0207664_111316302 125
642 3300025932 Ga0207690_10293503 Ga0207690_102935032 125
643 3300025934 Ga0207686_10004118 Ga0207686_100041182 125
644 3300025941 Ga0207711_10181176 Ga0207711_101811762 125
645 3300025949 Ga0207667_10021805 Ga0207667_100218058 125
646 3300025972 Ga0207668_11260504 Ga0207668_112605042 125
647 3300026088 Ga0207641_10128355 Ga0207641_101283551 125
648 3300026095 Ga0207676_10542052 Ga0207676_105420522 125
649 3300027876 Ga0209974_10013793 Ga0209974_100137933 125
650 3300031456 Ga0307513_10000006 Ga0307513_10000006180 125
651 3300031548 Ga0307408_100267340 Ga0307408_1002673402 125
652 3300031731 Ga0307405_10654156 Ga0307405_106541561 125
653 3300035691 Ga0373931_0384122 Ga0373931_0384122_79_486 125
654 3300044673 Ga0453683_0014003 Ga0453683_0014003_3595_4008 125
655 3300044673 Ga0453683_0194382 Ga0453683_0194382_350_763 125
656 3300044712 Ga0453684_0550258 Ga0453684_0550258_164_574 125
657 3300045051 Ga0451576_0021797 Ga0451576_0021797_5413_5826 125
658 3300046528 Ga0495642_0123659 Ga0495642_0123659_388_801 125
659 3300046558 Ga0495633_0204064 Ga0495633_0204064_388_801 125
660 3300046615 Ga0495656_0010192 Ga0495656_0010192_2291_2704 125
661 3300046615 Ga0495656_0203641 Ga0495656_0203641_358_771 125
662 3300047318 Ga0495636_0061074 Ga0495636_0061074_17_430 125
663 3300047445 Ga0495677_0139063 Ga0495677_0139063_322_735 125
664 3300047447 Ga0495685_014825 Ga0495685_014825_67_480 125
665 3300048090 Ga0495615_0017987 Ga0495615_0017987_40_453 125
666 3300049671 Ga0501238_015379 Ga0501238_015379_428_844 125
667 3300049682 Ga0501252_021242 Ga0501252_021242_17_436 125
668 3300050491 nmdc:mga00v17_923148_c1 nmdc:mga00v17_923148_c1_73_480 125
669 3300053093 Ga0500651_0040760 Ga0500651_0040760_2298_2708 125
670 3300053161 Ga0500634_0105752 Ga0500634_0105752_63_473 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

13

130

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f4h-assembly1.cif.gz_A crystal structure of a glutamine dependent nad+ synthetase from burkholderia thailandensis 0.86 87 122
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8525 50 121
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8316 50 121
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.793 51 116
1vdm-assembly1.cif.gz_I crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.7726 89 122
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.793 51 116 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7534 52 119 3.30.420.270
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7435 70 125 3.40.50.620
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7277 52 119 3.30.420.270
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7131 89 122 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A519LWY9-F1-model_v4 Biopolymer transporter ExbD 0.9719 43 125 GO:0005886
GO:0015031
GO:0022857
AF-A0A2M7X866-F1-model_v4 Biopolymer transporter ExbD 0.9652 52 125 GO:0005886
GO:0015031
GO:0022857
AF-A0A7X8V0M5-F1-model_v4 deleted 0.9633 48 125
AF-A0A192D7G6-F1-model_v4 Biopolymer transporter ExbD 0.9586 51 121 GO:0005886
GO:0015031
GO:0022857
AF-A0A519LWY9-F1-model_v4 Biopolymer transporter ExbD 0.9494 43 125 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
73.5 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map