F474073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 388 | 629 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_102041055|Ga0075428_1020410551 |
| Length | 145 |
| Sequence | MSMNVGGSMDGEDAQLNSTINTTPLVDVMLPVITKTVVQNLPKAVNIPTQTKPENITVEVDAKGNVYWNGKSVPNRTELLELVKTAAVKKPQPELHIRGDKETRYEAVGRVIYTIQRGGVVKVGFITEPPVGSGGGQAVAQNTAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 9 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 10 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 11 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 12 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 13 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 14 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 15 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 16 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 17 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 18 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 19 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 20 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 21 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 22 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 23 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 24 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 25 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 26 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 27 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 28 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 29 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 30 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 31 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 32 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 33 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 34 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 35 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 36 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 37 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 38 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 39 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 40 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 41 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 42 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 46 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 47 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 48 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 49 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 50 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 52 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 109 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 198 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 199 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 200 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 201 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 202 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 203 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 204 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 225 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 226 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 227 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 231 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 234 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 235 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 236 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 240 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 241 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 242 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 243 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 244 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 245 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 246 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 247 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 248 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 249 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 250 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 253 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 327 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 329 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 344 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 345 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 346 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 349 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 350 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 352 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 360 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 362 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 365 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 375 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 376 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 377 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.49 |
| Metatranscriptomes | 2.39 |
| Isolates | 6.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 28.06 |
| Nodule | 0.9 |
| Rhizoplane | 3.13 |
| Rhizosphere | 57.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_740581 | 2162886007 | Bacteria | 1466 |
| 2 | JGI24740J21852_10009941 | 3300001979 | Bacteria | 3691 |
| 3 | JGI24739J22299_10009105 | 3300001989 | Bacteria | 3702 |
| 4 | JGI24739J22299_10009112 | 3300001989 | Bacteria | 3701 |
| 5 | JGI25158J39367_1017379 | 3300002739 | Bacteria | 901 |
| 6 | JGI25152J39213_1006491 | 3300002773 | Bacteria | 3173 |
| 7 | JGI25150J39212_1001672 | 3300002774 | Bacteria | 6010 |
| 8 | JGI25159J45721_1010981 | 3300002987 | Bacteria | 2256 |
| 9 | JGI25151J46595_10035846 | 3300003187 | Bacteria | 1878 |
| 10 | JGI25406J46586_10017419 | 3300003203 | Bacteria | 2971 |
| 11 | JGI25153J46596_10015151 | 3300003215 | Bacteria | 3161 |
| 12 | Ga0055527_1008634 | 3300003760 | Bacteria | 1211 |
| 13 | Ga0055535_1000084 | 3300003761 | Bacteria | 104652 |
| 14 | Ga0055542_1000033 | 3300003762 | Bacteria | 233997 |
| 15 | Ga0055537_1000163 | 3300003773 | Bacteria | 49422 |
| 16 | Ga0055536_1001382 | 3300003781 | Bacteria | 14722 |
| 17 | Ga0055536_1010724 | 3300003781 | Bacteria | 3596 |
| 18 | Ga0055536_1012623 | 3300003781 | Bacteria | 3118 |
| 19 | Ga0055534_1000150 | 3300003784 | Bacteria | 51661 |
| 20 | Ga0055534_1011068 | 3300003784 | Bacteria | 1852 |
| 21 | Ga0055528_1015922 | 3300003790 | Bacteria | 2687 |
| 22 | Ga0055530_10004105 | 3300003791 | Bacteria | 7739 |
| 23 | Ga0055530_10009858 | 3300003791 | Bacteria | 3606 |
| 24 | Ga0055540_1000733 | 3300003792 | Bacteria | 22290 |
| 25 | Ga0055540_1002197 | 3300003792 | Bacteria | 10610 |
| 26 | Ga0055540_1008745 | 3300003792 | Bacteria | 3600 |
| 27 | Ga0055540_1009657 | 3300003792 | Bacteria | 3302 |
| 28 | Ga0055540_1010326 | 3300003792 | Bacteria | 3118 |
| 29 | Ga0055540_1031202 | 3300003792 | Bacteria | 1226 |
| 30 | Ga0055531_10000254 | 3300003794 | Bacteria | 57349 |
| 31 | Ga0055531_10002763 | 3300003794 | Bacteria | 11516 |
| 32 | Ga0055531_10008022 | 3300003794 | Bacteria | 5645 |
| 33 | Ga0055531_10016888 | 3300003794 | Bacteria | 3118 |
| 34 | Ga0065714_10005035 | 3300005288 | Bacteria | 5831 |
| 35 | Ga0065714_10095928 | 3300005288 | Bacteria | 1774 |
| 36 | Ga0065704_10078797 | 3300005289 | Bacteria | 4330 |
| 37 | Ga0065704_10104343 | 3300005289 | Bacteria | 2144 |
| 38 | Ga0065704_10206224 | 3300005289 | Bacteria | 1126 |
| 39 | Ga0070658_10084607 | 3300005327 | Bacteria | 2608 |
| 40 | Ga0070658_10128255 | 3300005327 | Bacteria | 2113 |
| 41 | Ga0070658_10475809 | 3300005327 | Bacteria | 1078 |
| 42 | Ga0070676_10440814 | 3300005328 | Bacteria | 914 |
| 43 | Ga0070670_100046178 | 3300005331 | Bacteria | 3745 |
| 44 | Ga0070677_10087359 | 3300005333 | Bacteria | 1349 |
| 45 | Ga0070677_10342302 | 3300005333 | Bacteria | 772 |
| 46 | Ga0070680_100142496 | 3300005336 | Bacteria | 2010 |
| 47 | Ga0070660_100009303 | 3300005339 | Bacteria | 6904 |
| 48 | Ga0070661_100248879 | 3300005344 | Bacteria | 1371 |
| 49 | Ga0070668_100411113 | 3300005347 | Bacteria | 1157 |
| 50 | Ga0070668_101315368 | 3300005347 | Bacteria | 657 |
| 51 | Ga0070669_100122085 | 3300005353 | Bacteria | 1989 |
| 52 | Ga0070669_100422150 | 3300005353 | Bacteria | 1095 |
| 53 | Ga0070669_101324948 | 3300005353 | Bacteria | 624 |
| 54 | Ga0070675_101753794 | 3300005354 | Bacteria | 573 |
| 55 | Ga0070674_100251225 | 3300005356 | Bacteria | 1389 |
| 56 | Ga0070673_100066282 | 3300005364 | Bacteria | 2884 |
| 57 | Ga0070673_100202065 | 3300005364 | Bacteria | 1712 |
| 58 | Ga0070659_100292456 | 3300005366 | Bacteria | 1357 |
| 59 | Ga0070667_100142295 | 3300005367 | Bacteria | 2102 |
| 60 | Ga0070667_100357708 | 3300005367 | Bacteria | 1323 |
| 61 | Ga0070700_100473375 | 3300005441 | Bacteria | 958 |
| 62 | Ga0070663_101311900 | 3300005455 | Bacteria | 639 |
| 63 | Ga0070678_100403844 | 3300005456 | Bacteria | 1187 |
| 64 | Ga0070678_100750372 | 3300005456 | Bacteria | 883 |
| 65 | Ga0068867_100068007 | 3300005459 | Bacteria | 2658 |
| 66 | Ga0068867_100419898 | 3300005459 | Bacteria | 1133 |
| 67 | Ga0070685_10198344 | 3300005466 | Bacteria | 1303 |
| 68 | Ga0070679_100041448 | 3300005530 | Bacteria | 4582 |
| 69 | Ga0070679_100320606 | 3300005530 | Bacteria | 1499 |
| 70 | Ga0068853_100072832 | 3300005539 | Bacteria | 2994 |
| 71 | Ga0068853_100721535 | 3300005539 | Bacteria | 952 |
| 72 | Ga0070672_100822226 | 3300005543 | Bacteria | 818 |
| 73 | Ga0070665_100015030 | 3300005548 | Bacteria | 7768 |
| 74 | Ga0070665_100954739 | 3300005548 | Bacteria | 870 |
| 75 | Ga0068855_100001070 | 3300005563 | Bacteria | 33986 |
| 76 | Ga0068855_100221222 | 3300005563 | Bacteria | 2123 |
| 77 | Ga0068857_100052201 | 3300005577 | Bacteria | 3628 |
| 78 | Ga0068857_100118116 | 3300005577 | Bacteria | 2387 |
| 79 | Ga0068852_100498156 | 3300005616 | Bacteria | 1213 |
| 80 | Ga0068852_100566216 | 3300005616 | Bacteria | 1138 |
| 81 | Ga0068859_100839952 | 3300005617 | Bacteria | 1005 |
| 82 | Ga0068864_100398707 | 3300005618 | Bacteria | 1307 |
| 83 | Ga0068861_100399966 | 3300005719 | Bacteria | 1218 |
| 84 | Ga0068851_10039165 | 3300005834 | Bacteria | 2380 |
| 85 | Ga0068863_100284610 | 3300005841 | Bacteria | 1602 |
| 86 | Ga0068862_100920535 | 3300005844 | Bacteria | 860 |
| 87 | Ga0081455_10000016 | 3300005937 | Bacteria | 176679 |
| 88 | Ga0081539_10000060 | 3300005985 | Bacteria | 252799 |
| 89 | Ga0075363_100004195 | 3300006048 | Bacteria | 6260 |
| 90 | Ga0075363_100082873 | 3300006048 | Bacteria | 1756 |
| 91 | Ga0075363_100119746 | 3300006048 | Bacteria | 1469 |
| 92 | Ga0075363_100251559 | 3300006048 | Bacteria | 1017 |
| 93 | Ga0075364_10090522 | 3300006051 | Bacteria | 2029 |
| 94 | Ga0075364_10138987 | 3300006051 | Bacteria | 1633 |
| 95 | Ga0075364_10587674 | 3300006051 | Bacteria | 761 |
| 96 | Ga0075432_10011325 | 3300006058 | Bacteria | 3030 |
| 97 | Ga0075362_10002959 | 3300006177 | Bacteria | 5835 |
| 98 | Ga0075362_10019624 | 3300006177 | Bacteria | 2814 |
| 99 | Ga0075362_10048477 | 3300006177 | Bacteria | 1895 |
| 100 | Ga0075362_10394988 | 3300006177 | Bacteria | 697 |
| 101 | Ga0075367_10019689 | 3300006178 | Bacteria | 3746 |
| 102 | Ga0075366_10004750 | 3300006195 | Bacteria | 7321 |
| 103 | Ga0075366_10014149 | 3300006195 | Bacteria | 4553 |
| 104 | Ga0075366_10069303 | 3300006195 | Bacteria | 2099 |
| 105 | Ga0075366_10071598 | 3300006195 | Bacteria | 2065 |
| 106 | Ga0075366_10103360 | 3300006195 | Bacteria | 1711 |
| 107 | Ga0075370_10006471 | 3300006353 | Bacteria | 5895 |
| 108 | Ga0075370_10007064 | 3300006353 | Bacteria | 5698 |
| 109 | Ga0075370_10023681 | 3300006353 | Bacteria | 3384 |
| 110 | Ga0075370_10059627 | 3300006353 | Bacteria | 2172 |
| 111 | Ga0075370_10092515 | 3300006353 | Bacteria | 1745 |
| 112 | Ga0075370_10183479 | 3300006353 | Bacteria | 1232 |
| 113 | Ga0075428_102041055 | 3300006844 | Bacteria | 594 |
| 114 | Ga0068865_101198511 | 3300006881 | Bacteria | 672 |
| 115 | Ga0097620_100839914 | 3300006931 | Bacteria | 1005 |
| 116 | Ga0079104_1033997 | 3300006946 | Bacteria | 1242 |
| 117 | Ga0099826_10000055 | 3300006948 | Bacteria | 70119 |
| 118 | Ga0099826_10046013 | 3300006948 | Bacteria | 2978 |
| 119 | Ga0105244_10030974 | 3300009036 | Bacteria | 2842 |
| 120 | Ga0105244_10354900 | 3300009036 | Bacteria | 676 |
| 121 | Ga0105240_10033861 | 3300009093 | Bacteria | 6597 |
| 122 | Ga0105240_10287930 | 3300009093 | Bacteria | 1885 |
| 123 | Ga0105245_10275370 | 3300009098 | Bacteria | 1643 |
| 124 | Ga0105243_10002185 | 3300009148 | Bacteria | 16494 |
| 125 | Ga0105243_10769394 | 3300009148 | Bacteria | 946 |
| 126 | Ga0105242_10002960 | 3300009176 | Bacteria | 13295 |
| 127 | Ga0105248_10103953 | 3300009177 | Bacteria | 3202 |
| 128 | Ga0105237_10133427 | 3300009545 | Bacteria | 2478 |
| 129 | Ga0105238_10079657 | 3300009551 | Bacteria | 3266 |
| 130 | Ga0105249_10079860 | 3300009553 | Bacteria | 3037 |
| 131 | Ga0105249_13257304 | 3300009553 | Bacteria | 522 |
| 132 | Ga0105239_10037060 | 3300010375 | Bacteria | 5349 |
| 133 | Ga0105239_10310216 | 3300010375 | Bacteria | 1778 |
| 134 | Ga0105246_10024498 | 3300011119 | Bacteria | 3921 |
| 135 | Ga0105246_10093008 | 3300011119 | Bacteria | 2177 |
| 136 | Ga0157347_1034967 | 3300012502 | Bacteria | 644 |
| 137 | Ga0157373_10008333 | 3300013100 | Bacteria | 7700 |
| 138 | Ga0157371_10540285 | 3300013102 | Bacteria | 863 |
| 139 | Ga0157370_10006222 | 3300013104 | Bacteria | 13222 |
| 140 | Ga0157370_10257363 | 3300013104 | Bacteria | 1613 |
| 141 | Ga0157369_10039882 | 3300013105 | Bacteria | 5130 |
| 142 | Ga0163162_11229642 | 3300013306 | Bacteria | 850 |
| 143 | Ga0157372_10059193 | 3300013307 | Bacteria | 4284 |
| 144 | Ga0157375_10519795 | 3300013308 | Bacteria | 1354 |
| 145 | Ga0157375_10986285 | 3300013308 | Bacteria | 983 |
| 146 | Ga0163163_11165352 | 3300014325 | Bacteria | 833 |
| 147 | Ga0182008_10002275 | 3300014497 | Bacteria | 12122 |
| 148 | Ga0182008_10023631 | 3300014497 | Bacteria | 3136 |
| 149 | Ga0182008_10024712 | 3300014497 | Bacteria | 3056 |
| 150 | Ga0182008_10042054 | 3300014497 | Bacteria | 2277 |
| 151 | Ga0157376_10200490 | 3300014969 | Bacteria | 1836 |
| 152 | Ga0182006_1001945 | 3300015261 | Bacteria | 11727 |
| 153 | Ga0182006_1066693 | 3300015261 | Bacteria | 1345 |
| 154 | Ga0182006_1069001 | 3300015261 | Bacteria | 1315 |
| 155 | Ga0182007_10001682 | 3300015262 | Bacteria | 11711 |
| 156 | Ga0182007_10020057 | 3300015262 | Bacteria | 2395 |
| 157 | Ga0182005_1019210 | 3300015265 | Bacteria | 1885 |
| 158 | Ga0182005_1043555 | 3300015265 | Bacteria | 1220 |
| 159 | Ga0182005_1058977 | 3300015265 | Bacteria | 1048 |
| 160 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 161 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 162 | Ga0163161_10000128 | 3300017792 | Bacteria | 70965 |
| 163 | Ga0163161_10003865 | 3300017792 | Bacteria | 10501 |
| 164 | Ga0163161_10007397 | 3300017792 | Bacteria | 7585 |
| 165 | Ga0163161_10043851 | 3300017792 | Bacteria | 3221 |
| 166 | Ga0163161_11498852 | 3300017792 | Bacteria | 592 |
| 167 | Ga0209436_112396 | 3300025208 | Bacteria | 1448 |
| 168 | Ga0209672_100228 | 3300025228 | Bacteria | 42777 |
| 169 | Ga0209258_100089 | 3300025242 | Bacteria | 234040 |
| 170 | Ga0207425_1001684 | 3300025245 | Bacteria | 8813 |
| 171 | Ga0207425_1003926 | 3300025245 | Bacteria | 4603 |
| 172 | Ga0209148_1000097 | 3300025254 | Bacteria | 234049 |
| 173 | Ga0209129_1000033 | 3300025258 | Bacteria | 336894 |
| 174 | Ga0209129_1001977 | 3300025258 | Bacteria | 10673 |
| 175 | Ga0209129_1007540 | 3300025258 | Bacteria | 3213 |
| 176 | Ga0209565_1000120 | 3300025263 | Bacteria | 111458 |
| 177 | Ga0209565_1000516 | 3300025263 | Bacteria | 27851 |
| 178 | Ga0209565_1000980 | 3300025263 | Bacteria | 14694 |
| 179 | Ga0209673_1000099 | 3300025273 | Bacteria | 193248 |
| 180 | Ga0209673_1000899 | 3300025273 | Bacteria | 38238 |
| 181 | Ga0209673_1001394 | 3300025273 | Bacteria | 23565 |
| 182 | Ga0209673_1006035 | 3300025273 | Bacteria | 5954 |
| 183 | Ga0209673_1027678 | 3300025273 | Bacteria | 1840 |
| 184 | Ga0209673_1037594 | 3300025273 | Bacteria | 1420 |
| 185 | Ga0209130_1000105 | 3300025284 | Bacteria | 135199 |
| 186 | Ga0209130_1000615 | 3300025284 | Bacteria | 34069 |
| 187 | Ga0209675_1000054 | 3300025291 | Bacteria | 193248 |
| 188 | Ga0209675_1000588 | 3300025291 | Bacteria | 26180 |
| 189 | Ga0209675_1001765 | 3300025291 | Bacteria | 11847 |
| 190 | Ga0209675_1004983 | 3300025291 | Bacteria | 5715 |
| 191 | Ga0209675_1084484 | 3300025291 | Bacteria | 583 |
| 192 | Ga0209676_1000260 | 3300025292 | Bacteria | 111683 |
| 193 | Ga0209676_1001304 | 3300025292 | Bacteria | 25409 |
| 194 | Ga0209676_1004531 | 3300025292 | Bacteria | 7698 |
| 195 | Ga0209676_1021203 | 3300025292 | Bacteria | 2187 |
| 196 | Ga0209676_1033402 | 3300025292 | Bacteria | 1533 |
| 197 | Ga0209025_1000221 | 3300025294 | Bacteria | 135793 |
| 198 | Ga0209025_1000732 | 3300025294 | Bacteria | 55664 |
| 199 | Ga0209025_1001070 | 3300025294 | Bacteria | 39701 |
| 200 | Ga0209025_1009557 | 3300025294 | Bacteria | 6733 |
| 201 | Ga0209025_1014260 | 3300025294 | Bacteria | 4909 |
| 202 | Ga0209564_1000151 | 3300025295 | Bacteria | 168783 |
| 203 | Ga0209564_1000246 | 3300025295 | Bacteria | 117096 |
| 204 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 205 | Ga0209050_1000977 | 3300025298 | Bacteria | 36542 |
| 206 | Ga0209050_1002366 | 3300025298 | Bacteria | 16428 |
| 207 | Ga0209050_1024517 | 3300025298 | Bacteria | 2083 |
| 208 | Ga0209256_1000069 | 3300025299 | Bacteria | 245640 |
| 209 | Ga0209256_1000506 | 3300025299 | Bacteria | 57382 |
| 210 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 211 | Ga0207426_1000859 | 3300025302 | Bacteria | 31835 |
| 212 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 213 | Ga0209051_1000319 | 3300025303 | Bacteria | 72894 |
| 214 | Ga0209051_1000510 | 3300025303 | Bacteria | 49177 |
| 215 | Ga0209051_1000707 | 3300025303 | Bacteria | 36542 |
| 216 | Ga0209051_1000832 | 3300025303 | Bacteria | 31807 |
| 217 | Ga0209051_1005253 | 3300025303 | Bacteria | 7636 |
| 218 | Ga0209051_1050284 | 3300025303 | Bacteria | 1397 |
| 219 | Ga0209051_1083255 | 3300025303 | Bacteria | 915 |
| 220 | Ga0209257_1000101 | 3300025304 | Bacteria | 251553 |
| 221 | Ga0209257_1000281 | 3300025304 | Bacteria | 114413 |
| 222 | Ga0209257_1001995 | 3300025304 | Bacteria | 21901 |
| 223 | Ga0209257_1018084 | 3300025304 | Bacteria | 2735 |
| 224 | Ga0207656_10016928 | 3300025321 | Bacteria | 2847 |
| 225 | Ga0207655_1000566 | 3300025728 | Bacteria | 45937 |
| 226 | Ga0207682_10069310 | 3300025893 | Bacteria | 1491 |
| 227 | Ga0207647_10461398 | 3300025904 | Bacteria | 711 |
| 228 | Ga0207645_10665219 | 3300025907 | Bacteria | 708 |
| 229 | Ga0207705_10176113 | 3300025909 | Bacteria | 1612 |
| 230 | Ga0207705_10200787 | 3300025909 | Bacteria | 1511 |
| 231 | Ga0207705_10238103 | 3300025909 | Bacteria | 1386 |
| 232 | Ga0207695_10093746 | 3300025913 | Bacteria | 3012 |
| 233 | Ga0207695_10330048 | 3300025913 | Bacteria | 1414 |
| 234 | Ga0207695_11317852 | 3300025913 | Bacteria | 602 |
| 235 | Ga0207652_10032128 | 3300025921 | Bacteria | 4409 |
| 236 | Ga0207681_10689342 | 3300025923 | Bacteria | 849 |
| 237 | Ga0207681_11415511 | 3300025923 | Bacteria | 583 |
| 238 | Ga0207694_10042687 | 3300025924 | Bacteria | 3498 |
| 239 | Ga0207650_10842234 | 3300025925 | Bacteria | 778 |
| 240 | Ga0207659_10849222 | 3300025926 | Bacteria | 785 |
| 241 | Ga0207664_11131630 | 3300025929 | Bacteria | 699 |
| 242 | Ga0207690_10293503 | 3300025932 | Bacteria | 1270 |
| 243 | Ga0207690_10781392 | 3300025932 | Bacteria | 788 |
| 244 | Ga0207706_11160545 | 3300025933 | Bacteria | 643 |
| 245 | Ga0207686_10004118 | 3300025934 | Bacteria | 7801 |
| 246 | Ga0207709_10000230 | 3300025935 | Bacteria | 70768 |
| 247 | Ga0207709_10000240 | 3300025935 | Bacteria | 68308 |
| 248 | Ga0207669_10017951 | 3300025937 | Bacteria | 3644 |
| 249 | Ga0207691_10142942 | 3300025940 | Bacteria | 2107 |
| 250 | Ga0207691_10416100 | 3300025940 | Bacteria | 1146 |
| 251 | Ga0207711_10181176 | 3300025941 | Bacteria | 1916 |
| 252 | Ga0207689_10212581 | 3300025942 | Bacteria | 1598 |
| 253 | Ga0207667_10021805 | 3300025949 | Bacteria | 7091 |
| 254 | Ga0207651_10126091 | 3300025960 | Bacteria | 1951 |
| 255 | Ga0207651_10213950 | 3300025960 | Bacteria | 1554 |
| 256 | Ga0207651_11942184 | 3300025960 | Bacteria | 529 |
| 257 | Ga0207712_10287368 | 3300025961 | Bacteria | 1344 |
| 258 | Ga0207668_11260504 | 3300025972 | Bacteria | 665 |
| 259 | Ga0207640_10333840 | 3300025981 | Bacteria | 1212 |
| 260 | Ga0207640_10596239 | 3300025981 | Bacteria | 935 |
| 261 | Ga0207658_10303117 | 3300025986 | Bacteria | 1377 |
| 262 | Ga0207658_10943868 | 3300025986 | Bacteria | 786 |
| 263 | Ga0207639_10001769 | 3300026041 | Bacteria | 14537 |
| 264 | Ga0207639_10389927 | 3300026041 | Bacteria | 1252 |
| 265 | Ga0207641_10128355 | 3300026088 | Bacteria | 2273 |
| 266 | Ga0207676_10542052 | 3300026095 | Bacteria | 1110 |
| 267 | Ga0207674_10180344 | 3300026116 | Bacteria | 2063 |
| 268 | Ga0207674_10182736 | 3300026116 | Bacteria | 2048 |
| 269 | Ga0207683_10400740 | 3300026121 | Bacteria | 1262 |
| 270 | Ga0207683_10554621 | 3300026121 | Bacteria | 1062 |
| 271 | Ga0207683_10732854 | 3300026121 | Bacteria | 917 |
| 272 | Ga0207683_11523680 | 3300026121 | Bacteria | 617 |
| 273 | Ga0207683_11669200 | 3300026121 | Bacteria | 586 |
| 274 | Ga0207698_10538410 | 3300026142 | Bacteria | 1142 |
| 275 | Ga0207698_10756004 | 3300026142 | Bacteria | 971 |
| 276 | Ga0209282_1000133 | 3300027666 | Bacteria | 44707 |
| 277 | Ga0209282_1056012 | 3300027666 | Bacteria | 2226 |
| 278 | Ga0209974_10013793 | 3300027876 | Bacteria | 2692 |
| 279 | Ga0207428_10631273 | 3300027907 | Bacteria | 770 |
| 280 | Ga0268266_10006402 | 3300028379 | Bacteria | 10791 |
| 281 | Ga0268265_10064885 | 3300028380 | Bacteria | 2815 |
| 282 | Ga0268265_10194630 | 3300028380 | Bacteria | 1754 |
| 283 | Ga0268265_10350499 | 3300028380 | Bacteria | 1348 |
| 284 | Ga0268264_10336814 | 3300028381 | Bacteria | 1432 |
| 285 | Ga0268264_11431388 | 3300028381 | Bacteria | 702 |
| 286 | Ga0307517_10235337 | 3300028786 | Bacteria | 1094 |
| 287 | Ga0307515_10001286 | 3300028794 | Bacteria | 56985 |
| 288 | Ga0307515_10014383 | 3300028794 | Bacteria | 14677 |
| 289 | Ga0307515_10323569 | 3300028794 | Bacteria | 1206 |
| 290 | Ga0307515_10497597 | 3300028794 | Bacteria | 830 |
| 291 | Ga0316177_1065678 | 3300030731 | Bacteria | 8662 |
| 292 | Ga0314311_1013889 | 3300030733 | Bacteria | 3248 |
| 293 | Ga0316179_1063999 | 3300030734 | Bacteria | 1795 |
| 294 | Ga0316178_1010531 | 3300030735 | Bacteria | 3326 |
| 295 | Ga0316180_1110739 | 3300030736 | Bacteria | 2599 |
| 296 | Ga0316183_1052716 | 3300030742 | Bacteria | 4223 |
| 297 | Ga0316181_1013742 | 3300030744 | Bacteria | 999 |
| 298 | Ga0316181_1028550 | 3300030744 | Bacteria | 2915 |
| 299 | Ga0316182_1071522 | 3300030745 | Bacteria | 4117 |
| 300 | Ga0316182_1178183 | 3300030745 | Bacteria | 6940 |
| 301 | Ga0265327_10018197 | 3300031251 | Bacteria | 4366 |
| 302 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 303 | Ga0307513_10064926 | 3300031456 | Bacteria | 3842 |
| 304 | Ga0307513_10510289 | 3300031456 | Bacteria | 919 |
| 305 | Ga0307408_100036293 | 3300031548 | Bacteria | 3464 |
| 306 | Ga0307408_100060036 | 3300031548 | Bacteria | 2770 |
| 307 | Ga0307408_100121018 | 3300031548 | Bacteria | 2027 |
| 308 | Ga0307408_100267340 | 3300031548 | Bacteria | 1418 |
| 309 | Ga0307408_100343937 | 3300031548 | Bacteria | 1263 |
| 310 | Ga0307408_100345631 | 3300031548 | Bacteria | 1260 |
| 311 | Ga0307514_10000970 | 3300031649 | Bacteria | 42862 |
| 312 | Ga0307514_10130289 | 3300031649 | Bacteria | 1733 |
| 313 | Ga0307516_10332445 | 3300031730 | Bacteria | 1188 |
| 314 | Ga0307405_10018778 | 3300031731 | Bacteria | 3822 |
| 315 | Ga0307405_10032179 | 3300031731 | Bacteria | 3097 |
| 316 | Ga0307405_10087297 | 3300031731 | Bacteria | 2055 |
| 317 | Ga0307405_10131640 | 3300031731 | Bacteria | 1729 |
| 318 | Ga0307405_10153897 | 3300031731 | Bacteria | 1620 |
| 319 | Ga0307405_10463745 | 3300031731 | Bacteria | 1007 |
| 320 | Ga0307405_10654156 | 3300031731 | Bacteria | 865 |
| 321 | Ga0307413_10233292 | 3300031824 | Bacteria | 1353 |
| 322 | Ga0307410_10071197 | 3300031852 | Bacteria | 2411 |
| 323 | Ga0307410_10424144 | 3300031852 | Bacteria | 1080 |
| 324 | Ga0307406_10027594 | 3300031901 | Bacteria | 3422 |
| 325 | Ga0307406_10072562 | 3300031901 | Bacteria | 2260 |
| 326 | Ga0307406_10441674 | 3300031901 | Bacteria | 1041 |
| 327 | Ga0307406_10840986 | 3300031901 | Bacteria | 777 |
| 328 | Ga0307406_11107402 | 3300031901 | Bacteria | 684 |
| 329 | Ga0307407_10034424 | 3300031903 | Bacteria | 2773 |
| 330 | Ga0307407_10943127 | 3300031903 | Bacteria | 664 |
| 331 | Ga0307412_10062950 | 3300031911 | Bacteria | 2500 |
| 332 | Ga0307412_10215409 | 3300031911 | Bacteria | 1468 |
| 333 | Ga0307412_10247168 | 3300031911 | Bacteria | 1383 |
| 334 | Ga0307412_10351597 | 3300031911 | Bacteria | 1183 |
| 335 | Ga0307412_10481259 | 3300031911 | Bacteria | 1029 |
| 336 | Ga0307412_10539920 | 3300031911 | Bacteria | 977 |
| 337 | Ga0307409_100855704 | 3300031995 | Bacteria | 920 |
| 338 | Ga0307416_100208097 | 3300032002 | Bacteria | 1863 |
| 339 | Ga0307416_100314494 | 3300032002 | Bacteria | 1564 |
| 340 | Ga0307416_101121357 | 3300032002 | Bacteria | 891 |
| 341 | Ga0307414_10020805 | 3300032004 | Bacteria | 4098 |
| 342 | Ga0307414_10127276 | 3300032004 | Bacteria | 1970 |
| 343 | Ga0307414_10544200 | 3300032004 | Bacteria | 1034 |
| 344 | Ga0307414_10608039 | 3300032004 | Bacteria | 981 |
| 345 | Ga0307414_11485780 | 3300032004 | Bacteria | 630 |
| 346 | Ga0307411_10065232 | 3300032005 | Bacteria | 2441 |
| 347 | Ga0307411_10522740 | 3300032005 | Bacteria | 1007 |
| 348 | Ga0307411_11283952 | 3300032005 | Bacteria | 666 |
| 349 | Ga0373955_0139798 | 3300035172 | Bacteria | 1419 |
| 350 | Ga0373931_0384122 | 3300035691 | Bacteria | 886 |
| 351 | Ga0373931_0406181 | 3300035691 | Bacteria | 863 |
| 352 | Ga0395898_0545691 | 3300037466 | Bacteria | 1101 |
| 353 | Ga0395905_0858869 | 3300037471 | Bacteria | 810 |
| 354 | Ga0439436_0000274 | 3300041404 | Bacteria | 12450 |
| 355 | Ga0439436_0003221 | 3300041404 | Bacteria | 4954 |
| 356 | Ga0439436_0019474 | 3300041404 | Bacteria | 2026 |
| 357 | Ga0439439_0006621 | 3300041406 | Bacteria | 2683 |
| 358 | Ga0439439_0007932 | 3300041406 | Bacteria | 2496 |
| 359 | Ga0439439_0274052 | 3300041406 | Bacteria | 504 |
| 360 | Ga0439461_0155807 | 3300041410 | Bacteria | 592 |
| 361 | Ga0439466_0008277 | 3300041411 | Bacteria | 3920 |
| 362 | Ga0439466_0024317 | 3300041411 | Bacteria | 2124 |
| 363 | Ga0439465_0000448 | 3300041413 | Bacteria | 12074 |
| 364 | Ga0439465_0010317 | 3300041413 | Bacteria | 2937 |
| 365 | Ga0451793_0142041 | 3300041452 | Bacteria | 726 |
| 366 | Ga0451793_0638839 | 3300041452 | Bacteria | 1053 |
| 367 | Ga0451837_0796968 | 3300041494 | Bacteria | 543 |
| 368 | Ga0451847_0557802 | 3300041503 | Bacteria | 918 |
| 369 | Ga0439431_0000929 | 3300041997 | Bacteria | 6348 |
| 370 | Ga0439431_0018549 | 3300041997 | Bacteria | 1647 |
| 371 | Ga0439433_0000142 | 3300041999 | Bacteria | 10851 |
| 372 | Ga0439433_0002117 | 3300041999 | Bacteria | 4175 |
| 373 | Ga0439442_019836 | 3300042002 | Bacteria | 1393 |
| 374 | Ga0439442_108196 | 3300042002 | Bacteria | 604 |
| 375 | Ga0439445_0007988 | 3300042004 | Bacteria | 2468 |
| 376 | Ga0439445_0017470 | 3300042004 | Bacteria | 1773 |
| 377 | Ga0439445_0027061 | 3300042004 | Bacteria | 1471 |
| 378 | Ga0439432_002894 | 3300042006 | Bacteria | 6392 |
| 379 | Ga0439432_009431 | 3300042006 | Bacteria | 3404 |
| 380 | Ga0439432_132048 | 3300042006 | Bacteria | 736 |
| 381 | Ga0439449_0000240 | 3300042007 | Bacteria | 19806 |
| 382 | Ga0439449_0001968 | 3300042007 | Bacteria | 8071 |
| 383 | Ga0439449_0002571 | 3300042007 | Bacteria | 7087 |
| 384 | Ga0439449_0003071 | 3300042007 | Bacteria | 6506 |
| 385 | Ga0439452_013517 | 3300042010 | Bacteria | 2289 |
| 386 | Ga0439452_026999 | 3300042010 | Bacteria | 1445 |
| 387 | Ga0439457_010186 | 3300042014 | Bacteria | 2168 |
| 388 | Ga0439457_011388 | 3300042014 | Bacteria | 2023 |
| 389 | Ga0439462_0000492 | 3300042015 | Bacteria | 7779 |
| 390 | Ga0439462_0015377 | 3300042015 | Bacteria | 1972 |
| 391 | Ga0439462_0066923 | 3300042015 | Bacteria | 974 |
| 392 | Ga0450911_000343 | 3300042115 | Bacteria | 16355 |
| 393 | Ga0450914_004754 | 3300042118 | Bacteria | 1120 |
| 394 | Ga0450920_003461 | 3300042122 | Bacteria | 2734 |
| 395 | Ga0450923_023279 | 3300042125 | Bacteria | 1221 |
| 396 | Ga0450923_038683 | 3300042125 | Bacteria | 996 |
| 397 | Ga0450896_010164 | 3300042133 | Bacteria | 1317 |
| 398 | Ga0450898_004135 | 3300042134 | Bacteria | 2124 |
| 399 | Ga0450898_005436 | 3300042134 | Bacteria | 1925 |
| 400 | Ga0450898_057525 | 3300042134 | Bacteria | 760 |
| 401 | Ga0450906_005956 | 3300042145 | Bacteria | 2482 |
| 402 | Ga0450906_010007 | 3300042145 | Bacteria | 1799 |
| 403 | Ga0450906_065714 | 3300042145 | Bacteria | 647 |
| 404 | Ga0450907_004688 | 3300042146 | Bacteria | 2343 |
| 405 | Ga0450907_100444 | 3300042146 | Bacteria | 504 |
| 406 | Ga0439446_0022790 | 3300042156 | Bacteria | 1777 |
| 407 | Ga0439446_0024579 | 3300042156 | Bacteria | 1719 |
| 408 | Ga0450908_000352 | 3300042184 | Bacteria | 8852 |
| 409 | Ga0450908_024203 | 3300042184 | Bacteria | 1062 |
| 410 | Ga0439434_0003838 | 3300042435 | Bacteria | 4393 |
| 411 | Ga0439434_0005115 | 3300042435 | Bacteria | 3837 |
| 412 | Ga0439434_0016814 | 3300042435 | Bacteria | 2186 |
| 413 | Ga0439435_0178670 | 3300042436 | Bacteria | 692 |
| 414 | Ga0450918_000204 | 3300042531 | Bacteria | 13434 |
| 415 | Ga0450918_027273 | 3300042531 | Bacteria | 1004 |
| 416 | Ga0453683_0014003 | 3300044673 | Bacteria | 5218 |
| 417 | Ga0453683_0194382 | 3300044673 | Bacteria | 1288 |
| 418 | Ga0466965_0056035 | 3300044683 | Bacteria | 1962 |
| 419 | Ga0453684_0550258 | 3300044712 | Bacteria | 1271 |
| 420 | Ga0451576_0021797 | 3300045051 | Bacteria | 6955 |
| 421 | Ga0451576_0638903 | 3300045051 | Bacteria | 1118 |
| 422 | Ga0451576_1667408 | 3300045051 | Bacteria | 661 |
| 423 | Ga0495627_032104 | 3300046453 | Bacteria | 1654 |
| 424 | Ga0495603_0716264 | 3300046455 | Bacteria | 572 |
| 425 | Ga0495638_0019793 | 3300046460 | Bacteria | 4450 |
| 426 | Ga0495651_0213257 | 3300046462 | Bacteria | 1342 |
| 427 | Ga0495651_0672169 | 3300046462 | Bacteria | 647 |
| 428 | Ga0495639_0208759 | 3300046475 | Bacteria | 958 |
| 429 | Ga0495664_0206199 | 3300046477 | Bacteria | 1191 |
| 430 | Ga0495610_0009323 | 3300046512 | Bacteria | 6217 |
| 431 | Ga0495610_0200236 | 3300046512 | Bacteria | 818 |
| 432 | Ga0495616_0018411 | 3300046513 | Bacteria | 3834 |
| 433 | Ga0495620_0008425 | 3300046515 | Bacteria | 5536 |
| 434 | Ga0495631_0026219 | 3300046518 | Bacteria | 2678 |
| 435 | Ga0495637_0177825 | 3300046520 | Bacteria | 790 |
| 436 | Ga0495643_0056092 | 3300046522 | Bacteria | 2104 |
| 437 | Ga0495648_0145456 | 3300046524 | Bacteria | 1243 |
| 438 | Ga0495642_0054355 | 3300046528 | Bacteria | 1651 |
| 439 | Ga0495642_0123659 | 3300046528 | Bacteria | 1111 |
| 440 | Ga0495652_0732578 | 3300046529 | Bacteria | 663 |
| 441 | Ga0495654_0042640 | 3300046530 | Bacteria | 2251 |
| 442 | Ga0495587_0293368 | 3300046536 | Bacteria | 910 |
| 443 | Ga0495621_0012181 | 3300046539 | Bacteria | 2677 |
| 444 | Ga0495621_0203355 | 3300046539 | Bacteria | 797 |
| 445 | Ga0495622_0086440 | 3300046557 | Bacteria | 1442 |
| 446 | Ga0495633_0204064 | 3300046558 | Bacteria | 907 |
| 447 | Ga0495667_0264057 | 3300046559 | Bacteria | 1095 |
| 448 | Ga0495656_0000376 | 3300046615 | Bacteria | 14908 |
| 449 | Ga0495656_0010192 | 3300046615 | Bacteria | 3408 |
| 450 | Ga0495656_0025242 | 3300046615 | Bacteria | 2355 |
| 451 | Ga0495656_0203641 | 3300046615 | Bacteria | 983 |
| 452 | Ga0495668_0310121 | 3300046616 | Bacteria | 865 |
| 453 | Ga0495625_0000903 | 3300046660 | Bacteria | 39973 |
| 454 | Ga0495625_0030774 | 3300046660 | Bacteria | 4000 |
| 455 | Ga0495625_0404267 | 3300046660 | Bacteria | 852 |
| 456 | Ga0495635_0796382 | 3300046663 | Bacteria | 609 |
| 457 | Ga0495661_0045654 | 3300046665 | Bacteria | 2678 |
| 458 | Ga0495588_0033071 | 3300046674 | Bacteria | 2610 |
| 459 | Ga0495588_0079733 | 3300046674 | Bacteria | 1708 |
| 460 | Ga0495588_0196150 | 3300046674 | Bacteria | 1066 |
| 461 | Ga0495657_0263056 | 3300046675 | Bacteria | 1036 |
| 462 | Ga0495599_0168685 | 3300046678 | Bacteria | 1351 |
| 463 | Ga0495669_0099795 | 3300046684 | Bacteria | 1348 |
| 464 | Ga0495669_0290457 | 3300046684 | Bacteria | 787 |
| 465 | Ga0495670_0313321 | 3300046691 | Bacteria | 842 |
| 466 | Ga0495671_0144860 | 3300046692 | Bacteria | 1157 |
| 467 | Ga0495600_0264373 | 3300046809 | Bacteria | 1092 |
| 468 | Ga0495636_0061074 | 3300047318 | Bacteria | 1593 |
| 469 | Ga0495676_0001292 | 3300047321 | Bacteria | 21470 |
| 470 | Ga0495677_0139063 | 3300047445 | Bacteria | 932 |
| 471 | Ga0495677_0410705 | 3300047445 | Bacteria | 536 |
| 472 | Ga0495685_014825 | 3300047447 | Bacteria | 2653 |
| 473 | Ga0495593_0000578 | 3300047673 | Bacteria | 20838 |
| 474 | Ga0495614_0000302 | 3300048089 | Bacteria | 19477 |
| 475 | Ga0495615_0017987 | 3300048090 | Bacteria | 1549 |
| 476 | Ga0496100_0006543 | 3300048903 | Bacteria | 6359 |
| 477 | Ga0496101_0005412 | 3300048904 | Bacteria | 8133 |
| 478 | Ga0496102_0199227 | 3300048905 | Bacteria | 1887 |
| 479 | Ga0496103_0092168 | 3300048906 | Bacteria | 1913 |
| 480 | Ga0496104_0003045 | 3300048907 | Bacteria | 14441 |
| 481 | Ga0496105_0000491 | 3300048908 | Bacteria | 26041 |
| 482 | Ga0496106_1031413 | 3300048909 | Bacteria | 646 |
| 483 | Ga0496107_0246139 | 3300048910 | Bacteria | 1330 |
| 484 | Ga0496108_0081281 | 3300048911 | Bacteria | 2746 |
| 485 | Ga0496109_1578803 | 3300048912 | Bacteria | 591 |
| 486 | Ga0496110_0196262 | 3300048913 | Bacteria | 1833 |
| 487 | Ga0496110_0229658 | 3300048913 | Bacteria | 1687 |
| 488 | Ga0496111_0292006 | 3300048914 | Bacteria | 1209 |
| 489 | Ga0496111_0795870 | 3300048914 | Bacteria | 684 |
| 490 | Ga0496114_0229356 | 3300048917 | Bacteria | 1631 |
| 491 | Ga0496114_0295217 | 3300048917 | Bacteria | 1430 |
| 492 | Ga0496116_0064175 | 3300048919 | Bacteria | 2361 |
| 493 | Ga0496116_0134839 | 3300048919 | Bacteria | 1400 |
| 494 | Ga0496117_0022168 | 3300048920 | Bacteria | 5100 |
| 495 | Ga0496117_0026152 | 3300048920 | Bacteria | 4571 |
| 496 | Ga0496117_0072100 | 3300048920 | Bacteria | 2311 |
| 497 | Ga0496118_0014322 | 3300048921 | Bacteria | 7432 |
| 498 | Ga0496118_0282042 | 3300048921 | Bacteria | 924 |
| 499 | Ga0496118_0317712 | 3300048921 | Bacteria | 846 |
| 500 | Ga0496119_0088212 | 3300048922 | Bacteria | 1769 |
| 501 | Ga0496121_0045413 | 3300048924 | Bacteria | 3775 |
| 502 | Ga0496121_0068195 | 3300048924 | Bacteria | 2878 |
| 503 | Ga0496122_0000546 | 3300048925 | Bacteria | 77920 |
| 504 | Ga0496122_0143883 | 3300048925 | Bacteria | 1486 |
| 505 | Ga0496122_0245083 | 3300048925 | Bacteria | 1007 |
| 506 | Ga0496122_0390091 | 3300048925 | Bacteria | 711 |
| 507 | Ga0496123_0000235 | 3300048926 | Bacteria | 111823 |
| 508 | Ga0496123_0105190 | 3300048926 | Bacteria | 1630 |
| 509 | Ga0496124_0016715 | 3300048927 | Bacteria | 6959 |
| 510 | Ga0496124_0053327 | 3300048927 | Bacteria | 3429 |
| 511 | Ga0496124_0125299 | 3300048927 | Bacteria | 2047 |
| 512 | Ga0496124_0326839 | 3300048927 | Bacteria | 1095 |
| 513 | Ga0496124_0345612 | 3300048927 | Bacteria | 1054 |
| 514 | Ga0496124_0634945 | 3300048927 | Bacteria | 688 |
| 515 | Ga0496125_0005957 | 3300048928 | Bacteria | 13345 |
| 516 | Ga0496125_0012018 | 3300048928 | Bacteria | 8619 |
| 517 | Ga0496125_0021920 | 3300048928 | Bacteria | 5942 |
| 518 | Ga0496125_0050661 | 3300048928 | Bacteria | 3435 |
| 519 | Ga0496125_0062052 | 3300048928 | Bacteria | 2992 |
| 520 | Ga0496125_0444840 | 3300048928 | Bacteria | 744 |
| 521 | Ga0496125_0633723 | 3300048928 | Bacteria | 578 |
| 522 | Ga0496126_0162420 | 3300048929 | Bacteria | 1908 |
| 523 | Ga0496126_0555945 | 3300048929 | Bacteria | 910 |
| 524 | Ga0501304_006403 | 3300049160 | Bacteria | 949 |
| 525 | Ga0501332_09021 | 3300049548 | Bacteria | 653 |
| 526 | Ga0501337_007091 | 3300049553 | Bacteria | 777 |
| 527 | Ga0501033_0322692 | 3300049570 | Bacteria | 1085 |
| 528 | Ga0501238_015379 | 3300049671 | Bacteria | 1055 |
| 529 | Ga0501249_007483 | 3300049679 | Bacteria | 2257 |
| 530 | Ga0501252_021242 | 3300049682 | Bacteria | 850 |
| 531 | Ga0501257_106870 | 3300049686 | Bacteria | 739 |
| 532 | Ga0501225_0034151 | 3300049705 | Bacteria | 1400 |
| 533 | Ga0501262_004604 | 3300049759 | Bacteria | 1604 |
| 534 | Ga0501035_0450335 | 3300049822 | Bacteria | 1065 |
| 535 | Ga0501044_0055514 | 3300049823 | Bacteria | 4068 |
| 536 | Ga0501044_0254398 | 3300049823 | Bacteria | 1696 |
| 537 | nmdc:mga03683_2243_c1 | 3300050489 | Bacteria | 5962 |
| 538 | nmdc:mga03683_274048_c1 | 3300050489 | Bacteria | 787 |
| 539 | nmdc:mga03683_337243_c1 | 3300050489 | Bacteria | 712 |
| 540 | nmdc:mga03683_37509_c1 | 3300050489 | Bacteria | 1975 |
| 541 | nmdc:mga03683_471932_c1 | 3300050489 | Bacteria | 605 |
| 542 | nmdc:mga03683_52313_c1 | 3300050489 | Bacteria | 1707 |
| 543 | nmdc:mga03n38_15636_c1 | 3300050490 | Bacteria | 2933 |
| 544 | nmdc:mga03n38_219946_c1 | 3300050490 | Bacteria | 991 |
| 545 | nmdc:mga03n38_51229_c1 | 3300050490 | Bacteria | 1843 |
| 546 | nmdc:mga00v17_923148_c1 | 3300050491 | Bacteria | 552 |
| 547 | nmdc:mga00v17_95592_c1 | 3300050491 | Bacteria | 1871 |
| 548 | nmdc:mga0yw44_214938_c1 | 3300050492 | Bacteria | 1273 |
| 549 | nmdc:mga0yw44_71077_c1 | 3300050492 | Bacteria | 2160 |
| 550 | nmdc:mga0k408_164149_c1 | 3300050493 | Bacteria | 1323 |
| 551 | nmdc:mga0k408_199292_c1 | 3300050493 | Bacteria | 1195 |
| 552 | nmdc:mga0k408_35698_c1 | 3300050493 | Bacteria | 2851 |
| 553 | nmdc:mga0k408_6104_c1 | 3300050493 | Bacteria | 6418 |
| 554 | nmdc:mga0k408_694560_c1 | 3300050493 | Bacteria | 596 |
| 555 | nmdc:mga0k408_71802_c1 | 3300050493 | Bacteria | 2021 |
| 556 | nmdc:mga0k408_8084_c1 | 3300050493 | Bacteria | 5639 |
| 557 | nmdc:mga0k408_86586_c1 | 3300050493 | Bacteria | 1839 |
| 558 | nmdc:mga06z11_23471_c1 | 3300050494 | Bacteria | 2898 |
| 559 | nmdc:mga06z11_257228_c1 | 3300050494 | Bacteria | 1029 |
| 560 | nmdc:mga06z11_310121_c1 | 3300050494 | Bacteria | 940 |
| 561 | nmdc:mga06z11_443623_c1 | 3300050494 | Bacteria | 784 |
| 562 | nmdc:mga07m45_129546_c1 | 3300050496 | Bacteria | 1460 |
| 563 | nmdc:mga07m45_12997_c1 | 3300050496 | Bacteria | 4405 |
| 564 | nmdc:mga07m45_38894_c1 | 3300050496 | Bacteria | 2657 |
| 565 | nmdc:mga07m45_615501_c1 | 3300050496 | Bacteria | 627 |
| 566 | nmdc:mga07m45_621_c1 | 3300050496 | Bacteria | 15097 |
| 567 | nmdc:mga07m45_6447_c1 | 3300050496 | Bacteria | 5932 |
| 568 | nmdc:mga07m45_673335_c1 | 3300050496 | Bacteria | 596 |
| 569 | nmdc:mga07m45_93201_c1 | 3300050496 | Bacteria | 1727 |
| 570 | nmdc:mga08x19_905675_c1 | 3300050514 | Bacteria | 626 |
| 571 | Ga0500610_0062112 | 3300053079 | Bacteria | 1949 |
| 572 | Ga0500610_0090088 | 3300053079 | Bacteria | 1593 |
| 573 | Ga0500610_0090090 | 3300053079 | Bacteria | 1593 |
| 574 | Ga0500643_013299 | 3300053087 | Bacteria | 2912 |
| 575 | Ga0500646_0044743 | 3300053090 | Bacteria | 1258 |
| 576 | Ga0500583_0022055 | 3300053092 | Bacteria | 2661 |
| 577 | Ga0500651_0000024 | 3300053093 | Bacteria | 129450 |
| 578 | Ga0500651_0040760 | 3300053093 | Bacteria | 2926 |
| 579 | Ga0500566_0022420 | 3300053094 | Bacteria | 3710 |
| 580 | Ga0500641_0104376 | 3300053096 | Bacteria | 1217 |
| 581 | Ga0500557_107123 | 3300053105 | Bacteria | 929 |
| 582 | Ga0500562_019422 | 3300053108 | Bacteria | 1757 |
| 583 | Ga0500562_026867 | 3300053108 | Bacteria | 1509 |
| 584 | Ga0500571_000051 | 3300053110 | Bacteria | 35723 |
| 585 | Ga0500572_130265 | 3300053111 | Bacteria | 817 |
| 586 | Ga0500593_004259 | 3300053117 | Bacteria | 5524 |
| 587 | Ga0500594_0010260 | 3300053118 | Bacteria | 2172 |
| 588 | Ga0500594_0026175 | 3300053118 | Bacteria | 1501 |
| 589 | Ga0500597_055374 | 3300053120 | Bacteria | 1696 |
| 590 | Ga0500607_002042 | 3300053121 | Bacteria | 17000 |
| 591 | Ga0500608_008130 | 3300053122 | Bacteria | 4390 |
| 592 | Ga0500608_055371 | 3300053122 | Bacteria | 1901 |
| 593 | Ga0500618_064668 | 3300053125 | Bacteria | 822 |
| 594 | Ga0500642_0109629 | 3300053130 | Bacteria | 1288 |
| 595 | Ga0500655_028456 | 3300053133 | Bacteria | 1069 |
| 596 | Ga0500658_0000226 | 3300053134 | Bacteria | 26958 |
| 597 | Ga0500658_0000310 | 3300053134 | Bacteria | 21887 |
| 598 | Ga0500559_0371061 | 3300053136 | Bacteria | 668 |
| 599 | Ga0500564_032436 | 3300053138 | Bacteria | 2409 |
| 600 | Ga0500568_0005294 | 3300053139 | Bacteria | 6700 |
| 601 | Ga0500568_0091100 | 3300053139 | Bacteria | 1150 |
| 602 | Ga0500573_0187287 | 3300053140 | Bacteria | 1108 |
| 603 | Ga0500574_003119 | 3300053141 | Bacteria | 2868 |
| 604 | Ga0500577_0331208 | 3300053142 | Bacteria | 665 |
| 605 | Ga0500586_077080 | 3300053145 | Bacteria | 1169 |
| 606 | Ga0500616_0129426 | 3300053153 | Bacteria | 1194 |
| 607 | Ga0500622_0089570 | 3300053156 | Bacteria | 1528 |
| 608 | Ga0500627_0002002 | 3300053158 | Bacteria | 5885 |
| 609 | Ga0500627_0260756 | 3300053158 | Bacteria | 765 |
| 610 | Ga0500634_0039027 | 3300053161 | Bacteria | 2581 |
| 611 | Ga0500634_0105752 | 3300053161 | Bacteria | 1399 |
| 612 | Ga0500638_069226 | 3300053162 | Bacteria | 1688 |
| 613 | Ga0500636_0062256 | 3300053177 | Bacteria | 2176 |
| 614 | Ga0500625_043967 | 3300053729 | Bacteria | 2091 |
| 615 | Ga0500565_037786 | 3300053734 | Bacteria | 663 |
| 616 | Ga0500596_022041 | 3300053735 | Bacteria | 962 |
| 617 | Ga0587073_0050942 | 3300059492 | Bacteria | 938 |
| 618 | Ga0587080_004255 | 3300059503 | Bacteria | 1845 |
| 619 | Ga0587090_064934 | 3300059510 | Bacteria | 701 |
| 620 | Ga0587092_011314 | 3300059512 | Bacteria | 1238 |
| 621 | Ga0587115_010043 | 3300059626 | Bacteria | 1172 |
| 622 | Ga0587128_041058 | 3300059630 | Bacteria | 809 |
| 623 | Ga0587062_020558 | 3300059639 | Bacteria | 932 |
| 624 | Ga0587067_009157 | 3300059640 | Bacteria | 1468 |
| 625 | Ga0587072_009963 | 3300059643 | Bacteria | 1528 |
| 626 | Ga0587072_018522 | 3300059643 | Bacteria | 1210 |
| 627 | Ga0587079_047766 | 3300059647 | Bacteria | 888 |
| 628 | Ga0587104_009538 | 3300059650 | Bacteria | 701 |
| 629 | Ga0587111_0051463 | 3300060346 | Bacteria | 910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042125 | Ga0450923_023279 | Ga0450923_023279_866_1207 | 102 |
| 2 | 3300046684 | Ga0495669_0290457 | Ga0495669_0290457_13_354 | 102 |
| 3 | 3300048905 | Ga0496102_0199227 | Ga0496102_0199227_14_355 | 102 |
| 4 | 3300048927 | Ga0496124_0125299 | Ga0496124_0125299_14_355 | 102 |
| 5 | 3300037466 | Ga0395898_0545691 | Ga0395898_0545691_211_624 | 108 |
| 6 | 3300037471 | Ga0395905_0858869 | Ga0395905_0858869_34_447 | 108 |
| 7 | 3300045051 | Ga0451576_1667408 | Ga0451576_1667408_288_650 | 108 |
| 8 | 3300048909 | Ga0496106_1031413 | Ga0496106_1031413_13_375 | 108 |
| 9 | 3300050489 | nmdc:mga03683_52313_c1 | nmdc:mga03683_52313_c1_1334_1696 | 108 |
| 10 | 3300059503 | Ga0587080_004255 | Ga0587080_004255_764_1231 | 112 |
| 11 | 3300028794 | Ga0307515_10323569 | Ga0307515_103235692 | 113 |
| 12 | 3300041406 | Ga0439439_0006621 | Ga0439439_0006621_10_387 | 113 |
| 13 | 3300041410 | Ga0439461_0155807 | Ga0439461_0155807_190_567 | 113 |
| 14 | 3300042002 | Ga0439442_019836 | Ga0439442_019836_22_399 | 113 |
| 15 | 3300042006 | Ga0439432_132048 | Ga0439432_132048_125_502 | 113 |
| 16 | 3300042146 | Ga0450907_100444 | Ga0450907_100444_18_395 | 113 |
| 17 | 3300046455 | Ga0495603_0716264 | Ga0495603_0716264_182_559 | 113 |
| 18 | 3300046660 | Ga0495625_0404267 | Ga0495625_0404267_19_396 | 113 |
| 19 | 3300046691 | Ga0495670_0313321 | Ga0495670_0313321_32_409 | 113 |
| 20 | 3300048928 | Ga0496125_0633723 | Ga0496125_0633723_180_557 | 113 |
| 21 | 3300049822 | Ga0501035_0450335 | Ga0501035_0450335_450_860 | 113 |
| 22 | 3300049823 | Ga0501044_0254398 | Ga0501044_0254398_992_1402 | 113 |
| 23 | 3300049570 | Ga0501033_0322692 | Ga0501033_0322692_403_813 | 114 |
| 24 | 3300049823 | Ga0501044_0055514 | Ga0501044_0055514_1284_1694 | 114 |
| 25 | 3300048917 | Ga0496114_0229356 | Ga0496114_0229356_1012_1395 | 115 |
| 26 | 3300050493 | nmdc:mga0k408_694560_c1 | nmdc:mga0k408_694560_c1_85_498 | 115 |
| 27 | 3300013102 | Ga0157371_10540285 | Ga0157371_105402851 | 116 |
| 28 | 3300025923 | Ga0207681_10689342 | Ga0207681_106893421 | 116 |
| 29 | 3300031548 | Ga0307408_100343937 | Ga0307408_1003439372 | 116 |
| 30 | 3300031852 | Ga0307410_10424144 | Ga0307410_104241442 | 116 |
| 31 | 3300032002 | Ga0307416_100208097 | Ga0307416_1002080974 | 116 |
| 32 | 3300009553 | Ga0105249_10079860 | Ga0105249_100798602 | 118 |
| 33 | 3300025961 | Ga0207712_10287368 | Ga0207712_102873681 | 118 |
| 34 | 3300005617 | Ga0068859_100839952 | Ga0068859_1008399522 | 119 |
| 35 | 3300006931 | Ga0097620_100839914 | Ga0097620_1008399142 | 119 |
| 36 | 3300028380 | Ga0268265_10350499 | Ga0268265_103504992 | 119 |
| 37 | 3300028381 | Ga0268264_10336814 | Ga0268264_103368143 | 119 |
| 38 | 3300053092 | Ga0500583_0022055 | Ga0500583_0022055_1914_2381 | 119 |
| 39 | 3300053105 | Ga0500557_107123 | Ga0500557_107123_37_504 | 119 |
| 40 | 3300053118 | Ga0500594_0026175 | Ga0500594_0026175_956_1423 | 119 |
| 41 | 3300053130 | Ga0500642_0109629 | Ga0500642_0109629_798_1265 | 119 |
| 42 | 3300053139 | Ga0500568_0091100 | Ga0500568_0091100_40_507 | 119 |
| 43 | 3300053158 | Ga0500627_0260756 | Ga0500627_0260756_118_585 | 119 |
| 44 | 3300059512 | Ga0587092_011314 | Ga0587092_011314_198_641 | 119 |
| 45 | 3300059626 | Ga0587115_010043 | Ga0587115_010043_353_817 | 119 |
| 46 | 3300059630 | Ga0587128_041058 | Ga0587128_041058_122_580 | 119 |
| 47 | 3300059639 | Ga0587062_020558 | Ga0587062_020558_353_811 | 119 |
| 48 | 3300059640 | Ga0587067_009157 | Ga0587067_009157_226_669 | 119 |
| 49 | 3300059643 | Ga0587072_018522 | Ga0587072_018522_665_1123 | 119 |
| 50 | 3300059650 | Ga0587104_009538 | Ga0587104_009538_36_479 | 119 |
| 51 | 3300060346 | Ga0587111_0051463 | Ga0587111_0051463_311_769 | 119 |
| 52 | 3300050489 | nmdc:mga03683_274048_c1 | nmdc:mga03683_274048_c1_261_674 | 120 |
| 53 | 3300053108 | Ga0500562_026867 | Ga0500562_026867_400_810 | 120 |
| 54 | 3300053145 | Ga0500586_077080 | Ga0500586_077080_640_1050 | 120 |
| 55 | 3300053153 | Ga0500616_0129426 | Ga0500616_0129426_154_564 | 120 |
| 56 | 3300003203 | JGI25406J46586_10017419 | JGI25406J46586_100174193 | 121 |
| 57 | 3300005719 | Ga0068861_100399966 | Ga0068861_1003999662 | 121 |
| 58 | 3300005937 | Ga0081455_10000016 | Ga0081455_10000016163 | 121 |
| 59 | 3300005985 | Ga0081539_10000060 | Ga0081539_10000060260 | 121 |
| 60 | 3300006195 | Ga0075366_10004750 | Ga0075366_100047508 | 121 |
| 61 | 3300006353 | Ga0075370_10183479 | Ga0075370_101834793 | 121 |
| 62 | 3300006844 | Ga0075428_102041055 | Ga0075428_1020410551 | 121 |
| 63 | 3300028380 | Ga0268265_10194630 | Ga0268265_101946302 | 121 |
| 64 | 3300028381 | Ga0268264_11431388 | Ga0268264_114313881 | 121 |
| 65 | 3300028794 | Ga0307515_10014383 | Ga0307515_1001438311 | 121 |
| 66 | 3300031456 | Ga0307513_10064926 | Ga0307513_100649264 | 121 |
| 67 | 3300031649 | Ga0307514_10000970 | Ga0307514_1000097023 | 121 |
| 68 | 3300035172 | Ga0373955_0139798 | Ga0373955_0139798_474_887 | 121 |
| 69 | 3300035691 | Ga0373931_0406181 | Ga0373931_0406181_299_712 | 121 |
| 70 | 3300041494 | Ga0451837_0796968 | Ga0451837_0796968_13_423 | 121 |
| 71 | 3300046529 | Ga0495652_0732578 | Ga0495652_0732578_182_595 | 121 |
| 72 | 3300050493 | nmdc:mga0k408_164149_c1 | nmdc:mga0k408_164149_c1_463_915 | 121 |
| 73 | 3300050493 | nmdc:mga0k408_6104_c1 | nmdc:mga0k408_6104_c1_973_1386 | 121 |
| 74 | 3300050496 | nmdc:mga07m45_615501_c1 | nmdc:mga07m45_615501_c1_19_432 | 121 |
| 75 | 3300053136 | Ga0500559_0371061 | Ga0500559_0371061_131_544 | 121 |
| 76 | iso_pu_bacteria | 2513020051 | 2513227947 | 121 |
| 77 | iso_pu_bacteria | 2599185214 | 2599624098 | 121 |
| 78 | iso_pu_bacteria | 2599185226 | 2599672109 | 121 |
| 79 | iso_pu_bacteria | 2599185227 | 2599681808 | 121 |
| 80 | iso_pu_bacteria | 2599185229 | 2599693822 | 121 |
| 81 | iso_pu_bacteria | 2643221628 | 2644162651 | 121 |
| 82 | iso_pu_bacteria | 2643221658 | 2644328848 | 121 |
| 83 | iso_pu_bacteria | 2643221672 | 2644397933 | 121 |
| 84 | iso_pu_bacteria | 2643221683 | 2644469100 | 121 |
| 85 | iso_pu_bacteria | 2738541277 | 2738719878 | 121 |
| 86 | iso_pu_bacteria | 2738541307 | 2738879709 | 121 |
| 87 | iso_pu_bacteria | 2738543013 | 2739252208 | 121 |
| 88 | iso_pu_bacteria | 2738543019 | 2739279077 | 121 |
| 89 | iso_pu_bacteria | 2818991446 | 2819596542 | 121 |
| 90 | iso_pu_bacteria | 2831265667 | 2831269580 | 121 |
| 91 | iso_pu_bacteria | 2838054893 | 2838060071 | 121 |
| 92 | iso_pu_bacteria | 2842677519 | 2842677845 | 121 |
| 93 | iso_pu_bacteria | 2842733646 | 2842734660 | 121 |
| 94 | iso_pu_bacteria | 2842747753 | 2842748569 | 121 |
| 95 | iso_pu_bacteria | 2885192300 | 2885195556 | 121 |
| 96 | iso_pu_bacteria | 2885198086 | 2885199259 | 121 |
| 97 | iso_pu_bacteria | 2885211737 | 2885212910 | 121 |
| 98 | iso_pu_bacteria | 2899924645 | 2899931260 | 121 |
| 99 | iso_pu_bacteria | 2904449895 | 2904450120 | 121 |
| 100 | iso_pu_bacteria | 2904456579 | 2904457057 | 121 |
| 101 | iso_pu_bacteria | 2904541872 | 2904543976 | 121 |
| 102 | iso_pu_bacteria | 2919462493 | 2919464949 | 121 |
| 103 | iso_pu_bacteria | 2919704043 | 2919705329 | 121 |
| 104 | iso_pu_bacteria | 2928037797 | 2928037967 | 121 |
| 105 | iso_pu_bacteria | 2928044640 | 2928046427 | 121 |
| 106 | iso_pu_bacteria | 2928051484 | 2928054123 | 121 |
| 107 | iso_pu_bacteria | 2928064002 | 2928065876 | 121 |
| 108 | iso_pu_bacteria | 2928070936 | 2928076782 | 121 |
| 109 | iso_pu_bacteria | 2928084124 | 2928090469 | 121 |
| 110 | iso_pu_bacteria | 2929160207 | 2929162465 | 121 |
| 111 | iso_pu_bacteria | 2929520902 | 2929525405 | 121 |
| 112 | iso_pu_bacteria | 2945909444 | 2945913160 | 121 |
| 113 | iso_pu_bacteria | 2945945610 | 2945948781 | 121 |
| 114 | iso_pu_bacteria | 2945972063 | 2945972899 | 121 |
| 115 | iso_pu_bacteria | 2945984333 | 2945984566 | 121 |
| 116 | iso_pu_bacteria | 2954767861 | 2954772919 | 121 |
| 117 | 3300001979 | JGI24740J21852_10009941 | JGI24740J21852_100099415 | 123 |
| 118 | 3300001989 | JGI24739J22299_10009105 | JGI24739J22299_100091053 | 123 |
| 119 | 3300001989 | JGI24739J22299_10009112 | JGI24739J22299_100091123 | 123 |
| 120 | 3300002739 | JGI25158J39367_1017379 | JGI25158J39367_10173792 | 123 |
| 121 | 3300002773 | JGI25152J39213_1006491 | JGI25152J39213_10064915 | 123 |
| 122 | 3300002774 | JGI25150J39212_1001672 | JGI25150J39212_10016722 | 123 |
| 123 | 3300002987 | JGI25159J45721_1010981 | JGI25159J45721_10109812 | 123 |
| 124 | 3300003187 | JGI25151J46595_10035846 | JGI25151J46595_100358463 | 123 |
| 125 | 3300003215 | JGI25153J46596_10015151 | JGI25153J46596_100151512 | 123 |
| 126 | 3300003760 | Ga0055527_1008634 | Ga0055527_10086342 | 123 |
| 127 | 3300003761 | Ga0055535_1000084 | Ga0055535_100008480 | 123 |
| 128 | 3300003762 | Ga0055542_1000033 | Ga0055542_1000033109 | 123 |
| 129 | 3300003773 | Ga0055537_1000163 | Ga0055537_100016343 | 123 |
| 130 | 3300003781 | Ga0055536_1001382 | Ga0055536_100138217 | 123 |
| 131 | 3300003781 | Ga0055536_1010724 | Ga0055536_10107242 | 123 |
| 132 | 3300003781 | Ga0055536_1012623 | Ga0055536_10126232 | 123 |
| 133 | 3300003784 | Ga0055534_1000150 | Ga0055534_100015043 | 123 |
| 134 | 3300003784 | Ga0055534_1011068 | Ga0055534_10110683 | 123 |
| 135 | 3300003790 | Ga0055528_1015922 | Ga0055528_10159224 | 123 |
| 136 | 3300003791 | Ga0055530_10004105 | Ga0055530_100041056 | 123 |
| 137 | 3300003791 | Ga0055530_10009858 | Ga0055530_100098585 | 123 |
| 138 | 3300003792 | Ga0055540_1000733 | Ga0055540_10007332 | 123 |
| 139 | 3300003792 | Ga0055540_1002197 | Ga0055540_10021978 | 123 |
| 140 | 3300003792 | Ga0055540_1008745 | Ga0055540_10087455 | 123 |
| 141 | 3300003792 | Ga0055540_1009657 | Ga0055540_10096575 | 123 |
| 142 | 3300003792 | Ga0055540_1010326 | Ga0055540_10103262 | 123 |
| 143 | 3300003794 | Ga0055531_10002763 | Ga0055531_100027635 | 123 |
| 144 | 3300003794 | Ga0055531_10008022 | Ga0055531_100080222 | 123 |
| 145 | 3300003794 | Ga0055531_10016888 | Ga0055531_100168882 | 123 |
| 146 | 3300005288 | Ga0065714_10005035 | Ga0065714_100050353 | 123 |
| 147 | 3300005288 | Ga0065714_10095928 | Ga0065714_100959283 | 123 |
| 148 | 3300005289 | Ga0065704_10078797 | Ga0065704_100787973 | 123 |
| 149 | 3300005289 | Ga0065704_10206224 | Ga0065704_102062242 | 123 |
| 150 | 3300005333 | Ga0070677_10342302 | Ga0070677_103423022 | 123 |
| 151 | 3300005344 | Ga0070661_100248879 | Ga0070661_1002488793 | 123 |
| 152 | 3300005347 | Ga0070668_100411113 | Ga0070668_1004111132 | 123 |
| 153 | 3300005353 | Ga0070669_100122085 | Ga0070669_1001220853 | 123 |
| 154 | 3300005353 | Ga0070669_100422150 | Ga0070669_1004221501 | 123 |
| 155 | 3300005353 | Ga0070669_101324948 | Ga0070669_1013249481 | 123 |
| 156 | 3300005354 | Ga0070675_101753794 | Ga0070675_1017537941 | 123 |
| 157 | 3300005356 | Ga0070674_100251225 | Ga0070674_1002512253 | 123 |
| 158 | 3300005364 | Ga0070673_100066282 | Ga0070673_1000662822 | 123 |
| 159 | 3300005364 | Ga0070673_100202065 | Ga0070673_1002020654 | 123 |
| 160 | 3300005367 | Ga0070667_100142295 | Ga0070667_1001422952 | 123 |
| 161 | 3300005367 | Ga0070667_100357708 | Ga0070667_1003577083 | 123 |
| 162 | 3300005455 | Ga0070663_101311900 | Ga0070663_1013119001 | 123 |
| 163 | 3300005456 | Ga0070678_100403844 | Ga0070678_1004038441 | 123 |
| 164 | 3300005456 | Ga0070678_100750372 | Ga0070678_1007503722 | 123 |
| 165 | 3300005459 | Ga0068867_100068007 | Ga0068867_1000680073 | 123 |
| 166 | 3300005459 | Ga0068867_100419898 | Ga0068867_1004198982 | 123 |
| 167 | 3300005466 | Ga0070685_10198344 | Ga0070685_101983443 | 123 |
| 168 | 3300005539 | Ga0068853_100072832 | Ga0068853_1000728324 | 123 |
| 169 | 3300005539 | Ga0068853_100721535 | Ga0068853_1007215352 | 123 |
| 170 | 3300005543 | Ga0070672_100822226 | Ga0070672_1008222262 | 123 |
| 171 | 3300005548 | Ga0070665_100015030 | Ga0070665_10001503010 | 123 |
| 172 | 3300005548 | Ga0070665_100954739 | Ga0070665_1009547392 | 123 |
| 173 | 3300005563 | Ga0068855_100221222 | Ga0068855_1002212224 | 123 |
| 174 | 3300005577 | Ga0068857_100052201 | Ga0068857_1000522015 | 123 |
| 175 | 3300005577 | Ga0068857_100118116 | Ga0068857_1001181163 | 123 |
| 176 | 3300005616 | Ga0068852_100498156 | Ga0068852_1004981563 | 123 |
| 177 | 3300005616 | Ga0068852_100566216 | Ga0068852_1005662162 | 123 |
| 178 | 3300005834 | Ga0068851_10039165 | Ga0068851_100391653 | 123 |
| 179 | 3300005844 | Ga0068862_100920535 | Ga0068862_1009205351 | 123 |
| 180 | 3300006048 | Ga0075363_100004195 | Ga0075363_1000041953 | 123 |
| 181 | 3300006048 | Ga0075363_100082873 | Ga0075363_1000828732 | 123 |
| 182 | 3300006048 | Ga0075363_100119746 | Ga0075363_1001197462 | 123 |
| 183 | 3300006048 | Ga0075363_100251559 | Ga0075363_1002515592 | 123 |
| 184 | 3300006051 | Ga0075364_10090522 | Ga0075364_100905222 | 123 |
| 185 | 3300006051 | Ga0075364_10587674 | Ga0075364_105876742 | 123 |
| 186 | 3300006058 | Ga0075432_10011325 | Ga0075432_100113254 | 123 |
| 187 | 3300006177 | Ga0075362_10002959 | Ga0075362_100029596 | 123 |
| 188 | 3300006177 | Ga0075362_10019624 | Ga0075362_100196244 | 123 |
| 189 | 3300006177 | Ga0075362_10048477 | Ga0075362_100484774 | 123 |
| 190 | 3300006177 | Ga0075362_10394988 | Ga0075362_103949882 | 123 |
| 191 | 3300006178 | Ga0075367_10019689 | Ga0075367_100196893 | 123 |
| 192 | 3300006195 | Ga0075366_10014149 | Ga0075366_100141495 | 123 |
| 193 | 3300006195 | Ga0075366_10069303 | Ga0075366_100693034 | 123 |
| 194 | 3300006195 | Ga0075366_10071598 | Ga0075366_100715983 | 123 |
| 195 | 3300006195 | Ga0075366_10103360 | Ga0075366_101033603 | 123 |
| 196 | 3300006353 | Ga0075370_10006471 | Ga0075370_100064717 | 123 |
| 197 | 3300006353 | Ga0075370_10007064 | Ga0075370_100070646 | 123 |
| 198 | 3300006353 | Ga0075370_10023681 | Ga0075370_100236814 | 123 |
| 199 | 3300006353 | Ga0075370_10059627 | Ga0075370_100596273 | 123 |
| 200 | 3300006353 | Ga0075370_10092515 | Ga0075370_100925153 | 123 |
| 201 | 3300006946 | Ga0079104_1033997 | Ga0079104_10339972 | 123 |
| 202 | 3300006948 | Ga0099826_10000055 | Ga0099826_1000005511 | 123 |
| 203 | 3300006948 | Ga0099826_10046013 | Ga0099826_100460133 | 123 |
| 204 | 3300009036 | Ga0105244_10030974 | Ga0105244_100309742 | 123 |
| 205 | 3300009093 | Ga0105240_10287930 | Ga0105240_102879302 | 123 |
| 206 | 3300009098 | Ga0105245_10275370 | Ga0105245_102753702 | 123 |
| 207 | 3300009148 | Ga0105243_10002185 | Ga0105243_100021857 | 123 |
| 208 | 3300009148 | Ga0105243_10769394 | Ga0105243_107693942 | 123 |
| 209 | 3300009545 | Ga0105237_10133427 | Ga0105237_101334272 | 123 |
| 210 | 3300009553 | Ga0105249_13257304 | Ga0105249_132573042 | 123 |
| 211 | 3300010375 | Ga0105239_10037060 | Ga0105239_100370606 | 123 |
| 212 | 3300010375 | Ga0105239_10310216 | Ga0105239_103102163 | 123 |
| 213 | 3300011119 | Ga0105246_10024498 | Ga0105246_100244983 | 123 |
| 214 | 3300011119 | Ga0105246_10093008 | Ga0105246_100930084 | 123 |
| 215 | 3300013100 | Ga0157373_10008333 | Ga0157373_100083336 | 123 |
| 216 | 3300013104 | Ga0157370_10257363 | Ga0157370_102573632 | 123 |
| 217 | 3300013105 | Ga0157369_10039882 | Ga0157369_100398825 | 123 |
| 218 | 3300013306 | Ga0163162_11229642 | Ga0163162_112296422 | 123 |
| 219 | 3300013307 | Ga0157372_10059193 | Ga0157372_100591935 | 123 |
| 220 | 3300013308 | Ga0157375_10519795 | Ga0157375_105197953 | 123 |
| 221 | 3300013308 | Ga0157375_10986285 | Ga0157375_109862852 | 123 |
| 222 | 3300014325 | Ga0163163_11165352 | Ga0163163_111653522 | 123 |
| 223 | 3300014497 | Ga0182008_10002275 | Ga0182008_100022758 | 123 |
| 224 | 3300014497 | Ga0182008_10023631 | Ga0182008_100236313 | 123 |
| 225 | 3300014497 | Ga0182008_10024712 | Ga0182008_100247124 | 123 |
| 226 | 3300014497 | Ga0182008_10042054 | Ga0182008_100420544 | 123 |
| 227 | 3300014969 | Ga0157376_10200490 | Ga0157376_102004903 | 123 |
| 228 | 3300015261 | Ga0182006_1001945 | Ga0182006_100194511 | 123 |
| 229 | 3300015261 | Ga0182006_1066693 | Ga0182006_10666932 | 123 |
| 230 | 3300015261 | Ga0182006_1069001 | Ga0182006_10690013 | 123 |
| 231 | 3300015262 | Ga0182007_10001682 | Ga0182007_1000168213 | 123 |
| 232 | 3300015262 | Ga0182007_10020057 | Ga0182007_100200571 | 123 |
| 233 | 3300015265 | Ga0182005_1019210 | Ga0182005_10192103 | 123 |
| 234 | 3300015265 | Ga0182005_1043555 | Ga0182005_10435552 | 123 |
| 235 | 3300015265 | Ga0182005_1058977 | Ga0182005_10589772 | 123 |
| 236 | 3300015683 | Ga0183362_10001 | Ga0183362_10001601 | 123 |
| 237 | 3300015683 | Ga0183362_10002 | Ga0183362_10002485 | 123 |
| 238 | 3300017792 | Ga0163161_10000128 | Ga0163161_1000012873 | 123 |
| 239 | 3300017792 | Ga0163161_10003865 | Ga0163161_100038654 | 123 |
| 240 | 3300017792 | Ga0163161_10007397 | Ga0163161_100073974 | 123 |
| 241 | 3300017792 | Ga0163161_10043851 | Ga0163161_100438512 | 123 |
| 242 | 3300017792 | Ga0163161_11498852 | Ga0163161_114988521 | 123 |
| 243 | 3300025208 | Ga0209436_112396 | Ga0209436_1123961 | 123 |
| 244 | 3300025228 | Ga0209672_100228 | Ga0209672_10022826 | 123 |
| 245 | 3300025242 | Ga0209258_100089 | Ga0209258_100089108 | 123 |
| 246 | 3300025245 | Ga0207425_1001684 | Ga0207425_10016847 | 123 |
| 247 | 3300025245 | Ga0207425_1003926 | Ga0207425_10039267 | 123 |
| 248 | 3300025254 | Ga0209148_1000097 | Ga0209148_1000097108 | 123 |
| 249 | 3300025258 | Ga0209129_1000033 | Ga0209129_1000033292 | 123 |
| 250 | 3300025258 | Ga0209129_1001977 | Ga0209129_10019776 | 123 |
| 251 | 3300025258 | Ga0209129_1007540 | Ga0209129_10075405 | 123 |
| 252 | 3300025263 | Ga0209565_1000120 | Ga0209565_100012075 | 123 |
| 253 | 3300025263 | Ga0209565_1000516 | Ga0209565_100051618 | 123 |
| 254 | 3300025263 | Ga0209565_1000980 | Ga0209565_100098020 | 123 |
| 255 | 3300025273 | Ga0209673_1000099 | Ga0209673_1000099125 | 123 |
| 256 | 3300025273 | Ga0209673_1000899 | Ga0209673_100089919 | 123 |
| 257 | 3300025273 | Ga0209673_1001394 | Ga0209673_10013947 | 123 |
| 258 | 3300025273 | Ga0209673_1006035 | Ga0209673_10060357 | 123 |
| 259 | 3300025284 | Ga0209130_1000105 | Ga0209130_1000105116 | 123 |
| 260 | 3300025284 | Ga0209130_1000615 | Ga0209130_100061529 | 123 |
| 261 | 3300025291 | Ga0209675_1000054 | Ga0209675_1000054125 | 123 |
| 262 | 3300025291 | Ga0209675_1000588 | Ga0209675_100058814 | 123 |
| 263 | 3300025291 | Ga0209675_1001765 | Ga0209675_10017657 | 123 |
| 264 | 3300025291 | Ga0209675_1004983 | Ga0209675_10049837 | 123 |
| 265 | 3300025291 | Ga0209675_1084484 | Ga0209675_10844841 | 123 |
| 266 | 3300025292 | Ga0209676_1000260 | Ga0209676_100026047 | 123 |
| 267 | 3300025292 | Ga0209676_1001304 | Ga0209676_10013044 | 123 |
| 268 | 3300025292 | Ga0209676_1004531 | Ga0209676_10045317 | 123 |
| 269 | 3300025292 | Ga0209676_1021203 | Ga0209676_10212033 | 123 |
| 270 | 3300025292 | Ga0209676_1033402 | Ga0209676_10334021 | 123 |
| 271 | 3300025294 | Ga0209025_1000221 | Ga0209025_1000221112 | 123 |
| 272 | 3300025294 | Ga0209025_1000732 | Ga0209025_100073220 | 123 |
| 273 | 3300025294 | Ga0209025_1001070 | Ga0209025_100107016 | 123 |
| 274 | 3300025294 | Ga0209025_1009557 | Ga0209025_10095576 | 123 |
| 275 | 3300025294 | Ga0209025_1014260 | Ga0209025_10142604 | 123 |
| 276 | 3300025295 | Ga0209564_1000151 | Ga0209564_1000151141 | 123 |
| 277 | 3300025295 | Ga0209564_1000246 | Ga0209564_100024632 | 123 |
| 278 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027292 | 123 |
| 279 | 3300025298 | Ga0209050_1000977 | Ga0209050_100097730 | 123 |
| 280 | 3300025298 | Ga0209050_1002366 | Ga0209050_100236616 | 123 |
| 281 | 3300025298 | Ga0209050_1024517 | Ga0209050_10245172 | 123 |
| 282 | 3300025299 | Ga0209256_1000069 | Ga0209256_1000069189 | 123 |
| 283 | 3300025299 | Ga0209256_1000506 | Ga0209256_100050620 | 123 |
| 284 | 3300025302 | Ga0207426_1000027 | Ga0207426_1000027257 | 123 |
| 285 | 3300025302 | Ga0207426_1000859 | Ga0207426_10008594 | 123 |
| 286 | 3300025303 | Ga0209051_1000319 | Ga0209051_10003197 | 123 |
| 287 | 3300025303 | Ga0209051_1000510 | Ga0209051_100051021 | 123 |
| 288 | 3300025303 | Ga0209051_1000707 | Ga0209051_10007075 | 123 |
| 289 | 3300025303 | Ga0209051_1000832 | Ga0209051_100083232 | 123 |
| 290 | 3300025303 | Ga0209051_1005253 | Ga0209051_100525310 | 123 |
| 291 | 3300025303 | Ga0209051_1050284 | Ga0209051_10502843 | 123 |
| 292 | 3300025303 | Ga0209051_1083255 | Ga0209051_10832552 | 123 |
| 293 | 3300025304 | Ga0209257_1000281 | Ga0209257_1000281111 | 123 |
| 294 | 3300025304 | Ga0209257_1001995 | Ga0209257_10019955 | 123 |
| 295 | 3300025304 | Ga0209257_1018084 | Ga0209257_10180843 | 123 |
| 296 | 3300025321 | Ga0207656_10016928 | Ga0207656_100169283 | 123 |
| 297 | 3300025728 | Ga0207655_1000566 | Ga0207655_100056634 | 123 |
| 298 | 3300025893 | Ga0207682_10069310 | Ga0207682_100693102 | 123 |
| 299 | 3300025904 | Ga0207647_10461398 | Ga0207647_104613981 | 123 |
| 300 | 3300025907 | Ga0207645_10665219 | Ga0207645_106652192 | 123 |
| 301 | 3300025909 | Ga0207705_10200787 | Ga0207705_102007871 | 123 |
| 302 | 3300025913 | Ga0207695_10330048 | Ga0207695_103300482 | 123 |
| 303 | 3300025913 | Ga0207695_11317852 | Ga0207695_113178522 | 123 |
| 304 | 3300025923 | Ga0207681_11415511 | Ga0207681_114155111 | 123 |
| 305 | 3300025926 | Ga0207659_10849222 | Ga0207659_108492221 | 123 |
| 306 | 3300025932 | Ga0207690_10781392 | Ga0207690_107813921 | 123 |
| 307 | 3300025933 | Ga0207706_11160545 | Ga0207706_111605452 | 123 |
| 308 | 3300025935 | Ga0207709_10000230 | Ga0207709_1000023034 | 123 |
| 309 | 3300025935 | Ga0207709_10000240 | Ga0207709_1000024047 | 123 |
| 310 | 3300025937 | Ga0207669_10017951 | Ga0207669_100179515 | 123 |
| 311 | 3300025940 | Ga0207691_10142942 | Ga0207691_101429425 | 123 |
| 312 | 3300025940 | Ga0207691_10416100 | Ga0207691_104161003 | 123 |
| 313 | 3300025942 | Ga0207689_10212581 | Ga0207689_102125813 | 123 |
| 314 | 3300025960 | Ga0207651_10126091 | Ga0207651_101260911 | 123 |
| 315 | 3300025960 | Ga0207651_10213950 | Ga0207651_102139502 | 123 |
| 316 | 3300025960 | Ga0207651_11942184 | Ga0207651_119421841 | 123 |
| 317 | 3300025981 | Ga0207640_10333840 | Ga0207640_103338402 | 123 |
| 318 | 3300025981 | Ga0207640_10596239 | Ga0207640_105962392 | 123 |
| 319 | 3300025986 | Ga0207658_10303117 | Ga0207658_103031172 | 123 |
| 320 | 3300025986 | Ga0207658_10943868 | Ga0207658_109438682 | 123 |
| 321 | 3300026041 | Ga0207639_10001769 | Ga0207639_1000176914 | 123 |
| 322 | 3300026041 | Ga0207639_10389927 | Ga0207639_103899272 | 123 |
| 323 | 3300026116 | Ga0207674_10180344 | Ga0207674_101803442 | 123 |
| 324 | 3300026116 | Ga0207674_10182736 | Ga0207674_101827362 | 123 |
| 325 | 3300026121 | Ga0207683_10400740 | Ga0207683_104007402 | 123 |
| 326 | 3300026121 | Ga0207683_10554621 | Ga0207683_105546213 | 123 |
| 327 | 3300026121 | Ga0207683_10732854 | Ga0207683_107328542 | 123 |
| 328 | 3300026121 | Ga0207683_11523680 | Ga0207683_115236801 | 123 |
| 329 | 3300026121 | Ga0207683_11669200 | Ga0207683_116692002 | 123 |
| 330 | 3300026142 | Ga0207698_10538410 | Ga0207698_105384103 | 123 |
| 331 | 3300026142 | Ga0207698_10756004 | Ga0207698_107560041 | 123 |
| 332 | 3300027666 | Ga0209282_1000133 | Ga0209282_10001339 | 123 |
| 333 | 3300027666 | Ga0209282_1056012 | Ga0209282_10560122 | 123 |
| 334 | 3300027907 | Ga0207428_10631273 | Ga0207428_106312731 | 123 |
| 335 | 3300028379 | Ga0268266_10006402 | Ga0268266_100064026 | 123 |
| 336 | 3300028380 | Ga0268265_10064885 | Ga0268265_100648851 | 123 |
| 337 | 3300028786 | Ga0307517_10235337 | Ga0307517_102353372 | 123 |
| 338 | 3300028794 | Ga0307515_10001286 | Ga0307515_1000128651 | 123 |
| 339 | 3300028794 | Ga0307515_10497597 | Ga0307515_104975972 | 123 |
| 340 | 3300030731 | Ga0316177_1065678 | Ga0316177_106567810 | 123 |
| 341 | 3300030733 | Ga0314311_1013889 | Ga0314311_10138894 | 123 |
| 342 | 3300030734 | Ga0316179_1063999 | Ga0316179_10639992 | 123 |
| 343 | 3300030735 | Ga0316178_1010531 | Ga0316178_10105313 | 123 |
| 344 | 3300030736 | Ga0316180_1110739 | Ga0316180_11107392 | 123 |
| 345 | 3300030742 | Ga0316183_1052716 | Ga0316183_10527162 | 123 |
| 346 | 3300030744 | Ga0316181_1013742 | Ga0316181_10137422 | 123 |
| 347 | 3300030744 | Ga0316181_1028550 | Ga0316181_10285502 | 123 |
| 348 | 3300030745 | Ga0316182_1071522 | Ga0316182_10715225 | 123 |
| 349 | 3300030745 | Ga0316182_1178183 | Ga0316182_11781838 | 123 |
| 350 | 3300031251 | Ga0265327_10018197 | Ga0265327_100181975 | 123 |
| 351 | 3300031456 | Ga0307513_10510289 | Ga0307513_105102892 | 123 |
| 352 | 3300031548 | Ga0307408_100036293 | Ga0307408_1000362932 | 123 |
| 353 | 3300031548 | Ga0307408_100060036 | Ga0307408_1000600364 | 123 |
| 354 | 3300031548 | Ga0307408_100121018 | Ga0307408_1001210183 | 123 |
| 355 | 3300031548 | Ga0307408_100345631 | Ga0307408_1003456311 | 123 |
| 356 | 3300031649 | Ga0307514_10130289 | Ga0307514_101302893 | 123 |
| 357 | 3300031730 | Ga0307516_10332445 | Ga0307516_103324452 | 123 |
| 358 | 3300031731 | Ga0307405_10018778 | Ga0307405_100187785 | 123 |
| 359 | 3300031731 | Ga0307405_10032179 | Ga0307405_100321793 | 123 |
| 360 | 3300031731 | Ga0307405_10087297 | Ga0307405_100872972 | 123 |
| 361 | 3300031731 | Ga0307405_10131640 | Ga0307405_101316402 | 123 |
| 362 | 3300031731 | Ga0307405_10153897 | Ga0307405_101538972 | 123 |
| 363 | 3300031731 | Ga0307405_10463745 | Ga0307405_104637452 | 123 |
| 364 | 3300031824 | Ga0307413_10233292 | Ga0307413_102332922 | 123 |
| 365 | 3300031852 | Ga0307410_10071197 | Ga0307410_100711972 | 123 |
| 366 | 3300031901 | Ga0307406_10027594 | Ga0307406_100275944 | 123 |
| 367 | 3300031901 | Ga0307406_10072562 | Ga0307406_100725623 | 123 |
| 368 | 3300031901 | Ga0307406_10441674 | Ga0307406_104416741 | 123 |
| 369 | 3300031901 | Ga0307406_10840986 | Ga0307406_108409861 | 123 |
| 370 | 3300031901 | Ga0307406_11107402 | Ga0307406_111074022 | 123 |
| 371 | 3300031903 | Ga0307407_10034424 | Ga0307407_100344245 | 123 |
| 372 | 3300031903 | Ga0307407_10943127 | Ga0307407_109431271 | 123 |
| 373 | 3300031911 | Ga0307412_10062950 | Ga0307412_100629503 | 123 |
| 374 | 3300031911 | Ga0307412_10215409 | Ga0307412_102154091 | 123 |
| 375 | 3300031911 | Ga0307412_10247168 | Ga0307412_102471683 | 123 |
| 376 | 3300031911 | Ga0307412_10351597 | Ga0307412_103515971 | 123 |
| 377 | 3300031911 | Ga0307412_10481259 | Ga0307412_104812592 | 123 |
| 378 | 3300031911 | Ga0307412_10539920 | Ga0307412_105399202 | 123 |
| 379 | 3300031995 | Ga0307409_100855704 | Ga0307409_1008557042 | 123 |
| 380 | 3300032002 | Ga0307416_100314494 | Ga0307416_1003144942 | 123 |
| 381 | 3300032002 | Ga0307416_101121357 | Ga0307416_1011213572 | 123 |
| 382 | 3300032004 | Ga0307414_10020805 | Ga0307414_100208053 | 123 |
| 383 | 3300032004 | Ga0307414_10127276 | Ga0307414_101272761 | 123 |
| 384 | 3300032004 | Ga0307414_10544200 | Ga0307414_105442002 | 123 |
| 385 | 3300032004 | Ga0307414_10608039 | Ga0307414_106080392 | 123 |
| 386 | 3300032004 | Ga0307414_11485780 | Ga0307414_114857801 | 123 |
| 387 | 3300032005 | Ga0307411_10065232 | Ga0307411_100652323 | 123 |
| 388 | 3300032005 | Ga0307411_10522740 | Ga0307411_105227401 | 123 |
| 389 | 3300032005 | Ga0307411_11283952 | Ga0307411_112839521 | 123 |
| 390 | 3300041404 | Ga0439436_0000274 | Ga0439436_0000274_6665_7078 | 123 |
| 391 | 3300041404 | Ga0439436_0003221 | Ga0439436_0003221_1145_1558 | 123 |
| 392 | 3300041404 | Ga0439436_0019474 | Ga0439436_0019474_154_567 | 123 |
| 393 | 3300041406 | Ga0439439_0007932 | Ga0439439_0007932_666_1079 | 123 |
| 394 | 3300041406 | Ga0439439_0274052 | Ga0439439_0274052_39_452 | 123 |
| 395 | 3300041411 | Ga0439466_0008277 | Ga0439466_0008277_569_982 | 123 |
| 396 | 3300041411 | Ga0439466_0024317 | Ga0439466_0024317_1226_1639 | 123 |
| 397 | 3300041413 | Ga0439465_0000448 | Ga0439465_0000448_7106_7519 | 123 |
| 398 | 3300041413 | Ga0439465_0010317 | Ga0439465_0010317_1225_1638 | 123 |
| 399 | 3300041452 | Ga0451793_0142041 | Ga0451793_0142041_226_639 | 123 |
| 400 | 3300041452 | Ga0451793_0638839 | Ga0451793_0638839_183_596 | 123 |
| 401 | 3300041503 | Ga0451847_0557802 | Ga0451847_0557802_115_585 | 123 |
| 402 | 3300041997 | Ga0439431_0000929 | Ga0439431_0000929_101_514 | 123 |
| 403 | 3300041997 | Ga0439431_0018549 | Ga0439431_0018549_1106_1519 | 123 |
| 404 | 3300041999 | Ga0439433_0000142 | Ga0439433_0000142_6585_6998 | 123 |
| 405 | 3300041999 | Ga0439433_0002117 | Ga0439433_0002117_618_1031 | 123 |
| 406 | 3300042002 | Ga0439442_108196 | Ga0439442_108196_66_479 | 123 |
| 407 | 3300042004 | Ga0439445_0007988 | Ga0439445_0007988_122_535 | 123 |
| 408 | 3300042004 | Ga0439445_0017470 | Ga0439445_0017470_526_939 | 123 |
| 409 | 3300042004 | Ga0439445_0027061 | Ga0439445_0027061_203_613 | 123 |
| 410 | 3300042006 | Ga0439432_002894 | Ga0439432_002894_629_1042 | 123 |
| 411 | 3300042006 | Ga0439432_009431 | Ga0439432_009431_882_1295 | 123 |
| 412 | 3300042007 | Ga0439449_0000240 | Ga0439449_0000240_11366_11779 | 123 |
| 413 | 3300042007 | Ga0439449_0001968 | Ga0439449_0001968_3759_4172 | 123 |
| 414 | 3300042007 | Ga0439449_0002571 | Ga0439449_0002571_1448_1861 | 123 |
| 415 | 3300042007 | Ga0439449_0003071 | Ga0439449_0003071_777_1190 | 123 |
| 416 | 3300042010 | Ga0439452_013517 | Ga0439452_013517_1636_2049 | 123 |
| 417 | 3300042010 | Ga0439452_026999 | Ga0439452_026999_823_1236 | 123 |
| 418 | 3300042014 | Ga0439457_010186 | Ga0439457_010186_807_1220 | 123 |
| 419 | 3300042014 | Ga0439457_011388 | Ga0439457_011388_404_817 | 123 |
| 420 | 3300042015 | Ga0439462_0000492 | Ga0439462_0000492_5774_6187 | 123 |
| 421 | 3300042015 | Ga0439462_0015377 | Ga0439462_0015377_1516_1929 | 123 |
| 422 | 3300042015 | Ga0439462_0066923 | Ga0439462_0066923_371_784 | 123 |
| 423 | 3300042115 | Ga0450911_000343 | Ga0450911_000343_14725_15135 | 123 |
| 424 | 3300042118 | Ga0450914_004754 | Ga0450914_004754_402_815 | 123 |
| 425 | 3300042122 | Ga0450920_003461 | Ga0450920_003461_732_1145 | 123 |
| 426 | 3300042125 | Ga0450923_038683 | Ga0450923_038683_101_514 | 123 |
| 427 | 3300042133 | Ga0450896_010164 | Ga0450896_010164_45_458 | 123 |
| 428 | 3300042134 | Ga0450898_004135 | Ga0450898_004135_670_1083 | 123 |
| 429 | 3300042134 | Ga0450898_005436 | Ga0450898_005436_627_1040 | 123 |
| 430 | 3300042134 | Ga0450898_057525 | Ga0450898_057525_226_639 | 123 |
| 431 | 3300042145 | Ga0450906_005956 | Ga0450906_005956_968_1381 | 123 |
| 432 | 3300042145 | Ga0450906_010007 | Ga0450906_010007_1312_1725 | 123 |
| 433 | 3300042145 | Ga0450906_065714 | Ga0450906_065714_122_535 | 123 |
| 434 | 3300042146 | Ga0450907_004688 | Ga0450907_004688_1500_1913 | 123 |
| 435 | 3300042156 | Ga0439446_0022790 | Ga0439446_0022790_1243_1656 | 123 |
| 436 | 3300042156 | Ga0439446_0024579 | Ga0439446_0024579_214_627 | 123 |
| 437 | 3300042184 | Ga0450908_000352 | Ga0450908_000352_164_577 | 123 |
| 438 | 3300042184 | Ga0450908_024203 | Ga0450908_024203_573_986 | 123 |
| 439 | 3300042435 | Ga0439434_0003838 | Ga0439434_0003838_1382_1795 | 123 |
| 440 | 3300042435 | Ga0439434_0005115 | Ga0439434_0005115_1766_2179 | 123 |
| 441 | 3300042435 | Ga0439434_0016814 | Ga0439434_0016814_339_752 | 123 |
| 442 | 3300042436 | Ga0439435_0178670 | Ga0439435_0178670_147_560 | 123 |
| 443 | 3300042531 | Ga0450918_000204 | Ga0450918_000204_10910_11323 | 123 |
| 444 | 3300042531 | Ga0450918_027273 | Ga0450918_027273_150_563 | 123 |
| 445 | 3300044683 | Ga0466965_0056035 | Ga0466965_0056035_534_947 | 123 |
| 446 | 3300046453 | Ga0495627_032104 | Ga0495627_032104_655_1068 | 123 |
| 447 | 3300046460 | Ga0495638_0019793 | Ga0495638_0019793_740_1153 | 123 |
| 448 | 3300046462 | Ga0495651_0213257 | Ga0495651_0213257_837_1250 | 123 |
| 449 | 3300046462 | Ga0495651_0672169 | Ga0495651_0672169_66_479 | 123 |
| 450 | 3300046475 | Ga0495639_0208759 | Ga0495639_0208759_113_526 | 123 |
| 451 | 3300046477 | Ga0495664_0206199 | Ga0495664_0206199_481_894 | 123 |
| 452 | 3300046512 | Ga0495610_0009323 | Ga0495610_0009323_3938_4351 | 123 |
| 453 | 3300046512 | Ga0495610_0200236 | Ga0495610_0200236_275_688 | 123 |
| 454 | 3300046513 | Ga0495616_0018411 | Ga0495616_0018411_3022_3435 | 123 |
| 455 | 3300046515 | Ga0495620_0008425 | Ga0495620_0008425_998_1411 | 123 |
| 456 | 3300046518 | Ga0495631_0026219 | Ga0495631_0026219_1212_1625 | 123 |
| 457 | 3300046520 | Ga0495637_0177825 | Ga0495637_0177825_290_703 | 123 |
| 458 | 3300046522 | Ga0495643_0056092 | Ga0495643_0056092_1247_1660 | 123 |
| 459 | 3300046528 | Ga0495642_0054355 | Ga0495642_0054355_404_817 | 123 |
| 460 | 3300046530 | Ga0495654_0042640 | Ga0495654_0042640_704_1117 | 123 |
| 461 | 3300046536 | Ga0495587_0293368 | Ga0495587_0293368_102_515 | 123 |
| 462 | 3300046539 | Ga0495621_0012181 | Ga0495621_0012181_1318_1731 | 123 |
| 463 | 3300046539 | Ga0495621_0203355 | Ga0495621_0203355_67_480 | 123 |
| 464 | 3300046557 | Ga0495622_0086440 | Ga0495622_0086440_439_852 | 123 |
| 465 | 3300046559 | Ga0495667_0264057 | Ga0495667_0264057_336_749 | 123 |
| 466 | 3300046615 | Ga0495656_0000376 | Ga0495656_0000376_6101_6514 | 123 |
| 467 | 3300046615 | Ga0495656_0025242 | Ga0495656_0025242_1409_1822 | 123 |
| 468 | 3300046616 | Ga0495668_0310121 | Ga0495668_0310121_201_614 | 123 |
| 469 | 3300046660 | Ga0495625_0000903 | Ga0495625_0000903_28405_28818 | 123 |
| 470 | 3300046660 | Ga0495625_0030774 | Ga0495625_0030774_1265_1678 | 123 |
| 471 | 3300046663 | Ga0495635_0796382 | Ga0495635_0796382_74_487 | 123 |
| 472 | 3300046665 | Ga0495661_0045654 | Ga0495661_0045654_398_811 | 123 |
| 473 | 3300046674 | Ga0495588_0033071 | Ga0495588_0033071_2088_2501 | 123 |
| 474 | 3300046674 | Ga0495588_0079733 | Ga0495588_0079733_668_1081 | 123 |
| 475 | 3300046674 | Ga0495588_0196150 | Ga0495588_0196150_22_435 | 123 |
| 476 | 3300046675 | Ga0495657_0263056 | Ga0495657_0263056_441_854 | 123 |
| 477 | 3300046678 | Ga0495599_0168685 | Ga0495599_0168685_893_1306 | 123 |
| 478 | 3300046684 | Ga0495669_0099795 | Ga0495669_0099795_397_810 | 123 |
| 479 | 3300046692 | Ga0495671_0144860 | Ga0495671_0144860_449_862 | 123 |
| 480 | 3300046809 | Ga0495600_0264373 | Ga0495600_0264373_14_427 | 123 |
| 481 | 3300047321 | Ga0495676_0001292 | Ga0495676_0001292_14338_14751 | 123 |
| 482 | 3300047445 | Ga0495677_0410705 | Ga0495677_0410705_57_470 | 123 |
| 483 | 3300047673 | Ga0495593_0000578 | Ga0495593_0000578_1209_1622 | 123 |
| 484 | 3300048089 | Ga0495614_0000302 | Ga0495614_0000302_1392_1805 | 123 |
| 485 | 3300048903 | Ga0496100_0006543 | Ga0496100_0006543_4545_4958 | 123 |
| 486 | 3300048904 | Ga0496101_0005412 | Ga0496101_0005412_6035_6448 | 123 |
| 487 | 3300048906 | Ga0496103_0092168 | Ga0496103_0092168_873_1286 | 123 |
| 488 | 3300048907 | Ga0496104_0003045 | Ga0496104_0003045_851_1264 | 123 |
| 489 | 3300048908 | Ga0496105_0000491 | Ga0496105_0000491_25056_25469 | 123 |
| 490 | 3300048910 | Ga0496107_0246139 | Ga0496107_0246139_789_1202 | 123 |
| 491 | 3300048911 | Ga0496108_0081281 | Ga0496108_0081281_876_1289 | 123 |
| 492 | 3300048912 | Ga0496109_1578803 | Ga0496109_1578803_23_451 | 123 |
| 493 | 3300048913 | Ga0496110_0196262 | Ga0496110_0196262_1386_1799 | 123 |
| 494 | 3300048913 | Ga0496110_0229658 | Ga0496110_0229658_964_1377 | 123 |
| 495 | 3300048914 | Ga0496111_0292006 | Ga0496111_0292006_193_606 | 123 |
| 496 | 3300048914 | Ga0496111_0795870 | Ga0496111_0795870_18_431 | 123 |
| 497 | 3300048917 | Ga0496114_0295217 | Ga0496114_0295217_737_1150 | 123 |
| 498 | 3300048919 | Ga0496116_0064175 | Ga0496116_0064175_232_645 | 123 |
| 499 | 3300048919 | Ga0496116_0134839 | Ga0496116_0134839_144_557 | 123 |
| 500 | 3300048920 | Ga0496117_0022168 | Ga0496117_0022168_58_471 | 123 |
| 501 | 3300048920 | Ga0496117_0026152 | Ga0496117_0026152_1464_1877 | 123 |
| 502 | 3300048920 | Ga0496117_0072100 | Ga0496117_0072100_505_918 | 123 |
| 503 | 3300048921 | Ga0496118_0014322 | Ga0496118_0014322_5630_6043 | 123 |
| 504 | 3300048921 | Ga0496118_0282042 | Ga0496118_0282042_264_677 | 123 |
| 505 | 3300048921 | Ga0496118_0317712 | Ga0496118_0317712_236_649 | 123 |
| 506 | 3300048922 | Ga0496119_0088212 | Ga0496119_0088212_1183_1596 | 123 |
| 507 | 3300048924 | Ga0496121_0045413 | Ga0496121_0045413_1502_1915 | 123 |
| 508 | 3300048924 | Ga0496121_0068195 | Ga0496121_0068195_1747_2160 | 123 |
| 509 | 3300048925 | Ga0496122_0000546 | Ga0496122_0000546_60844_61260 | 123 |
| 510 | 3300048925 | Ga0496122_0143883 | Ga0496122_0143883_356_769 | 123 |
| 511 | 3300048925 | Ga0496122_0245083 | Ga0496122_0245083_209_622 | 123 |
| 512 | 3300048925 | Ga0496122_0390091 | Ga0496122_0390091_152_565 | 123 |
| 513 | 3300048926 | Ga0496123_0000235 | Ga0496123_0000235_51839_52255 | 123 |
| 514 | 3300048926 | Ga0496123_0105190 | Ga0496123_0105190_805_1218 | 123 |
| 515 | 3300048927 | Ga0496124_0016715 | Ga0496124_0016715_3421_3837 | 123 |
| 516 | 3300048927 | Ga0496124_0053327 | Ga0496124_0053327_1247_1657 | 123 |
| 517 | 3300048927 | Ga0496124_0326839 | Ga0496124_0326839_270_683 | 123 |
| 518 | 3300048927 | Ga0496124_0345612 | Ga0496124_0345612_439_852 | 123 |
| 519 | 3300048927 | Ga0496124_0634945 | Ga0496124_0634945_254_667 | 123 |
| 520 | 3300048928 | Ga0496125_0005957 | Ga0496125_0005957_10699_11109 | 123 |
| 521 | 3300048928 | Ga0496125_0012018 | Ga0496125_0012018_7551_7961 | 123 |
| 522 | 3300048928 | Ga0496125_0021920 | Ga0496125_0021920_1879_2289 | 123 |
| 523 | 3300048928 | Ga0496125_0050661 | Ga0496125_0050661_464_877 | 123 |
| 524 | 3300048928 | Ga0496125_0062052 | Ga0496125_0062052_988_1401 | 123 |
| 525 | 3300048928 | Ga0496125_0444840 | Ga0496125_0444840_138_551 | 123 |
| 526 | 3300048929 | Ga0496126_0162420 | Ga0496126_0162420_610_1020 | 123 |
| 527 | 3300049160 | Ga0501304_006403 | Ga0501304_006403_351_764 | 123 |
| 528 | 3300049548 | Ga0501332_09021 | Ga0501332_09021_179_592 | 123 |
| 529 | 3300049553 | Ga0501337_007091 | Ga0501337_007091_179_592 | 123 |
| 530 | 3300049679 | Ga0501249_007483 | Ga0501249_007483_834_1247 | 123 |
| 531 | 3300049686 | Ga0501257_106870 | Ga0501257_106870_266_679 | 123 |
| 532 | 3300049705 | Ga0501225_0034151 | Ga0501225_0034151_755_1168 | 123 |
| 533 | 3300049759 | Ga0501262_004604 | Ga0501262_004604_359_772 | 123 |
| 534 | 3300050489 | nmdc:mga03683_2243_c1 | nmdc:mga03683_2243_c1_5107_5520 | 123 |
| 535 | 3300050489 | nmdc:mga03683_337243_c1 | nmdc:mga03683_337243_c1_186_599 | 123 |
| 536 | 3300050489 | nmdc:mga03683_37509_c1 | nmdc:mga03683_37509_c1_493_906 | 123 |
| 537 | 3300050489 | nmdc:mga03683_471932_c1 | nmdc:mga03683_471932_c1_31_444 | 123 |
| 538 | 3300050490 | nmdc:mga03n38_15636_c1 | nmdc:mga03n38_15636_c1_1034_1447 | 123 |
| 539 | 3300050490 | nmdc:mga03n38_219946_c1 | nmdc:mga03n38_219946_c1_442_855 | 123 |
| 540 | 3300050490 | nmdc:mga03n38_51229_c1 | nmdc:mga03n38_51229_c1_45_458 | 123 |
| 541 | 3300050491 | nmdc:mga00v17_95592_c1 | nmdc:mga00v17_95592_c1_740_1153 | 123 |
| 542 | 3300050492 | nmdc:mga0yw44_214938_c1 | nmdc:mga0yw44_214938_c1_563_976 | 123 |
| 543 | 3300050492 | nmdc:mga0yw44_71077_c1 | nmdc:mga0yw44_71077_c1_1350_1763 | 123 |
| 544 | 3300050493 | nmdc:mga0k408_199292_c1 | nmdc:mga0k408_199292_c1_426_839 | 123 |
| 545 | 3300050493 | nmdc:mga0k408_35698_c1 | nmdc:mga0k408_35698_c1_1019_1432 | 123 |
| 546 | 3300050493 | nmdc:mga0k408_71802_c1 | nmdc:mga0k408_71802_c1_236_649 | 123 |
| 547 | 3300050493 | nmdc:mga0k408_8084_c1 | nmdc:mga0k408_8084_c1_1045_1458 | 123 |
| 548 | 3300050493 | nmdc:mga0k408_86586_c1 | nmdc:mga0k408_86586_c1_35_448 | 123 |
| 549 | 3300050494 | nmdc:mga06z11_23471_c1 | nmdc:mga06z11_23471_c1_1495_1908 | 123 |
| 550 | 3300050494 | nmdc:mga06z11_257228_c1 | nmdc:mga06z11_257228_c1_320_733 | 123 |
| 551 | 3300050494 | nmdc:mga06z11_310121_c1 | nmdc:mga06z11_310121_c1_35_448 | 123 |
| 552 | 3300050494 | nmdc:mga06z11_443623_c1 | nmdc:mga06z11_443623_c1_287_700 | 123 |
| 553 | 3300050496 | nmdc:mga07m45_129546_c1 | nmdc:mga07m45_129546_c1_629_1042 | 123 |
| 554 | 3300050496 | nmdc:mga07m45_12997_c1 | nmdc:mga07m45_12997_c1_1078_1491 | 123 |
| 555 | 3300050496 | nmdc:mga07m45_38894_c1 | nmdc:mga07m45_38894_c1_1046_1459 | 123 |
| 556 | 3300050496 | nmdc:mga07m45_621_c1 | nmdc:mga07m45_621_c1_13485_13898 | 123 |
| 557 | 3300050496 | nmdc:mga07m45_6447_c1 | nmdc:mga07m45_6447_c1_4420_4833 | 123 |
| 558 | 3300050496 | nmdc:mga07m45_673335_c1 | nmdc:mga07m45_673335_c1_159_572 | 123 |
| 559 | 3300050496 | nmdc:mga07m45_93201_c1 | nmdc:mga07m45_93201_c1_321_734 | 123 |
| 560 | 3300050514 | nmdc:mga08x19_905675_c1 | nmdc:mga08x19_905675_c1_23_436 | 123 |
| 561 | 3300053079 | Ga0500610_0062112 | Ga0500610_0062112_1219_1632 | 123 |
| 562 | 3300053079 | Ga0500610_0090088 | Ga0500610_0090088_815_1228 | 123 |
| 563 | 3300053079 | Ga0500610_0090090 | Ga0500610_0090090_366_779 | 123 |
| 564 | 3300053087 | Ga0500643_013299 | Ga0500643_013299_1363_1776 | 123 |
| 565 | 3300053090 | Ga0500646_0044743 | Ga0500646_0044743_688_1104 | 123 |
| 566 | 3300053093 | Ga0500651_0000024 | Ga0500651_0000024_107567_107980 | 123 |
| 567 | 3300053094 | Ga0500566_0022420 | Ga0500566_0022420_2789_3202 | 123 |
| 568 | 3300053096 | Ga0500641_0104376 | Ga0500641_0104376_530_943 | 123 |
| 569 | 3300053108 | Ga0500562_019422 | Ga0500562_019422_95_508 | 123 |
| 570 | 3300053110 | Ga0500571_000051 | Ga0500571_000051_24165_24578 | 123 |
| 571 | 3300053111 | Ga0500572_130265 | Ga0500572_130265_305_718 | 123 |
| 572 | 3300053117 | Ga0500593_004259 | Ga0500593_004259_4875_5288 | 123 |
| 573 | 3300053118 | Ga0500594_0010260 | Ga0500594_0010260_1158_1574 | 123 |
| 574 | 3300053120 | Ga0500597_055374 | Ga0500597_055374_40_453 | 123 |
| 575 | 3300053121 | Ga0500607_002042 | Ga0500607_002042_3465_3878 | 123 |
| 576 | 3300053122 | Ga0500608_008130 | Ga0500608_008130_831_1244 | 123 |
| 577 | 3300053122 | Ga0500608_055371 | Ga0500608_055371_1213_1626 | 123 |
| 578 | 3300053125 | Ga0500618_064668 | Ga0500618_064668_197_613 | 123 |
| 579 | 3300053133 | Ga0500655_028456 | Ga0500655_028456_465_878 | 123 |
| 580 | 3300053134 | Ga0500658_0000226 | Ga0500658_0000226_23263_23676 | 123 |
| 581 | 3300053134 | Ga0500658_0000310 | Ga0500658_0000310_21268_21681 | 123 |
| 582 | 3300053138 | Ga0500564_032436 | Ga0500564_032436_740_1153 | 123 |
| 583 | 3300053139 | Ga0500568_0005294 | Ga0500568_0005294_1398_1811 | 123 |
| 584 | 3300053140 | Ga0500573_0187287 | Ga0500573_0187287_422_838 | 123 |
| 585 | 3300053141 | Ga0500574_003119 | Ga0500574_003119_1369_1782 | 123 |
| 586 | 3300053142 | Ga0500577_0331208 | Ga0500577_0331208_241_654 | 123 |
| 587 | 3300053156 | Ga0500622_0089570 | Ga0500622_0089570_103_519 | 123 |
| 588 | 3300053158 | Ga0500627_0002002 | Ga0500627_0002002_4224_4637 | 123 |
| 589 | 3300053161 | Ga0500634_0039027 | Ga0500634_0039027_801_1214 | 123 |
| 590 | 3300053162 | Ga0500638_069226 | Ga0500638_069226_1051_1464 | 123 |
| 591 | 3300053177 | Ga0500636_0062256 | Ga0500636_0062256_656_1069 | 123 |
| 592 | 3300053729 | Ga0500625_043967 | Ga0500625_043967_1083_1496 | 123 |
| 593 | 3300053734 | Ga0500565_037786 | Ga0500565_037786_238_651 | 123 |
| 594 | 3300053735 | Ga0500596_022041 | Ga0500596_022041_181_594 | 123 |
| 595 | 3300059492 | Ga0587073_0050942 | Ga0587073_0050942_340_783 | 123 |
| 596 | 3300059510 | Ga0587090_064934 | Ga0587090_064934_183_596 | 123 |
| 597 | 3300059643 | Ga0587072_009963 | Ga0587072_009963_1042_1455 | 123 |
| 598 | 3300059647 | Ga0587079_047766 | Ga0587079_047766_307_750 | 123 |
| 599 | 3300005333 | Ga0070677_10087359 | Ga0070677_100873592 | 124 |
| 600 | 3300012502 | Ga0157347_1034967 | Ga0157347_10349671 | 124 |
| 601 | 3300013104 | Ga0157370_10006222 | Ga0157370_1000622216 | 124 |
| 602 | 3300045051 | Ga0451576_0638903 | Ga0451576_0638903_67_480 | 124 |
| 603 | 3300046524 | Ga0495648_0145456 | Ga0495648_0145456_461_874 | 124 |
| 604 | 3300048929 | Ga0496126_0555945 | Ga0496126_0555945_327_740 | 124 |
| 605 | 2162886007 | SwRhRL2b_contig_740581 | SwRhRL2b_0864.00006990 | 125 |
| 606 | 3300003792 | Ga0055540_1031202 | Ga0055540_10312022 | 125 |
| 607 | 3300003794 | Ga0055531_10000254 | Ga0055531_100002544 | 125 |
| 608 | 3300005289 | Ga0065704_10104343 | Ga0065704_101043432 | 125 |
| 609 | 3300005327 | Ga0070658_10084607 | Ga0070658_100846073 | 125 |
| 610 | 3300005327 | Ga0070658_10128255 | Ga0070658_101282553 | 125 |
| 611 | 3300005327 | Ga0070658_10475809 | Ga0070658_104758091 | 125 |
| 612 | 3300005328 | Ga0070676_10440814 | Ga0070676_104408142 | 125 |
| 613 | 3300005331 | Ga0070670_100046178 | Ga0070670_1000461786 | 125 |
| 614 | 3300005336 | Ga0070680_100142496 | Ga0070680_1001424962 | 125 |
| 615 | 3300005339 | Ga0070660_100009303 | Ga0070660_1000093037 | 125 |
| 616 | 3300005347 | Ga0070668_101315368 | Ga0070668_1013153682 | 125 |
| 617 | 3300005366 | Ga0070659_100292456 | Ga0070659_1002924562 | 125 |
| 618 | 3300005441 | Ga0070700_100473375 | Ga0070700_1004733752 | 125 |
| 619 | 3300005530 | Ga0070679_100041448 | Ga0070679_1000414485 | 125 |
| 620 | 3300005530 | Ga0070679_100320606 | Ga0070679_1003206061 | 125 |
| 621 | 3300005563 | Ga0068855_100001070 | Ga0068855_10000107021 | 125 |
| 622 | 3300005618 | Ga0068864_100398707 | Ga0068864_1003987072 | 125 |
| 623 | 3300005841 | Ga0068863_100284610 | Ga0068863_1002846103 | 125 |
| 624 | 3300006051 | Ga0075364_10138987 | Ga0075364_101389872 | 125 |
| 625 | 3300006881 | Ga0068865_101198511 | Ga0068865_1011985112 | 125 |
| 626 | 3300009036 | Ga0105244_10354900 | Ga0105244_103549001 | 125 |
| 627 | 3300009093 | Ga0105240_10033861 | Ga0105240_100338614 | 125 |
| 628 | 3300009176 | Ga0105242_10002960 | Ga0105242_1000296011 | 125 |
| 629 | 3300009177 | Ga0105248_10103953 | Ga0105248_101039535 | 125 |
| 630 | 3300009551 | Ga0105238_10079657 | Ga0105238_100796574 | 125 |
| 631 | 3300025273 | Ga0209673_1027678 | Ga0209673_10276782 | 125 |
| 632 | 3300025273 | Ga0209673_1037594 | Ga0209673_10375943 | 125 |
| 633 | 3300025303 | Ga0209051_1000055 | Ga0209051_100005535 | 125 |
| 634 | 3300025304 | Ga0209257_1000101 | Ga0209257_10001019 | 125 |
| 635 | 3300025909 | Ga0207705_10176113 | Ga0207705_101761133 | 125 |
| 636 | 3300025909 | Ga0207705_10238103 | Ga0207705_102381031 | 125 |
| 637 | 3300025913 | Ga0207695_10093746 | Ga0207695_100937463 | 125 |
| 638 | 3300025921 | Ga0207652_10032128 | Ga0207652_100321284 | 125 |
| 639 | 3300025924 | Ga0207694_10042687 | Ga0207694_100426874 | 125 |
| 640 | 3300025925 | Ga0207650_10842234 | Ga0207650_108422342 | 125 |
| 641 | 3300025929 | Ga0207664_11131630 | Ga0207664_111316302 | 125 |
| 642 | 3300025932 | Ga0207690_10293503 | Ga0207690_102935032 | 125 |
| 643 | 3300025934 | Ga0207686_10004118 | Ga0207686_100041182 | 125 |
| 644 | 3300025941 | Ga0207711_10181176 | Ga0207711_101811762 | 125 |
| 645 | 3300025949 | Ga0207667_10021805 | Ga0207667_100218058 | 125 |
| 646 | 3300025972 | Ga0207668_11260504 | Ga0207668_112605042 | 125 |
| 647 | 3300026088 | Ga0207641_10128355 | Ga0207641_101283551 | 125 |
| 648 | 3300026095 | Ga0207676_10542052 | Ga0207676_105420522 | 125 |
| 649 | 3300027876 | Ga0209974_10013793 | Ga0209974_100137933 | 125 |
| 650 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006180 | 125 |
| 651 | 3300031548 | Ga0307408_100267340 | Ga0307408_1002673402 | 125 |
| 652 | 3300031731 | Ga0307405_10654156 | Ga0307405_106541561 | 125 |
| 653 | 3300035691 | Ga0373931_0384122 | Ga0373931_0384122_79_486 | 125 |
| 654 | 3300044673 | Ga0453683_0014003 | Ga0453683_0014003_3595_4008 | 125 |
| 655 | 3300044673 | Ga0453683_0194382 | Ga0453683_0194382_350_763 | 125 |
| 656 | 3300044712 | Ga0453684_0550258 | Ga0453684_0550258_164_574 | 125 |
| 657 | 3300045051 | Ga0451576_0021797 | Ga0451576_0021797_5413_5826 | 125 |
| 658 | 3300046528 | Ga0495642_0123659 | Ga0495642_0123659_388_801 | 125 |
| 659 | 3300046558 | Ga0495633_0204064 | Ga0495633_0204064_388_801 | 125 |
| 660 | 3300046615 | Ga0495656_0010192 | Ga0495656_0010192_2291_2704 | 125 |
| 661 | 3300046615 | Ga0495656_0203641 | Ga0495656_0203641_358_771 | 125 |
| 662 | 3300047318 | Ga0495636_0061074 | Ga0495636_0061074_17_430 | 125 |
| 663 | 3300047445 | Ga0495677_0139063 | Ga0495677_0139063_322_735 | 125 |
| 664 | 3300047447 | Ga0495685_014825 | Ga0495685_014825_67_480 | 125 |
| 665 | 3300048090 | Ga0495615_0017987 | Ga0495615_0017987_40_453 | 125 |
| 666 | 3300049671 | Ga0501238_015379 | Ga0501238_015379_428_844 | 125 |
| 667 | 3300049682 | Ga0501252_021242 | Ga0501252_021242_17_436 | 125 |
| 668 | 3300050491 | nmdc:mga00v17_923148_c1 | nmdc:mga00v17_923148_c1_73_480 | 125 |
| 669 | 3300053093 | Ga0500651_0040760 | Ga0500651_0040760_2298_2708 | 125 |
| 670 | 3300053161 | Ga0500634_0105752 | Ga0500634_0105752_63_473 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f4h-assembly1.cif.gz_A | crystal structure of a glutamine dependent nad+ synthetase from burkholderia thailandensis | 0.86 | 87 | 122 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8525 | 50 | 121 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8316 | 50 | 121 |
| 2jwl-assembly1.cif.gz_B | solution structure of periplasmic domain of tolr from h. influenzae with saxs data | 0.793 | 51 | 116 |
| 1vdm-assembly1.cif.gz_I | crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 | 0.7726 | 89 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jwlB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.793 | 51 | 116 | 3.30.420.270 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7534 | 52 | 119 | 3.30.420.270 |
| af_Q58240_5_163_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7435 | 70 | 125 | 3.40.50.620 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.7277 | 52 | 119 | 3.30.420.270 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7131 | 89 | 122 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519LWY9-F1-model_v4 | Biopolymer transporter ExbD | 0.9719 | 43 | 125 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A2M7X866-F1-model_v4 | Biopolymer transporter ExbD | 0.9652 | 52 | 125 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A7X8V0M5-F1-model_v4 | deleted | 0.9633 | 48 | 125 |
|
| AF-A0A192D7G6-F1-model_v4 | Biopolymer transporter ExbD | 0.9586 | 51 | 121 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A519LWY9-F1-model_v4 | Biopolymer transporter ExbD | 0.9494 | 43 | 125 |
GO:0005886
GO:0015031 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar