F474048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 411 | 589 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_188172_c1|nmdc:mga05p37_188172_c1_175_1770 |
| Length | 531 |
| Sequence | VSTSHHLDIHQRASAESDVEAPATQTSPNGVLRFPEGFLWGAATAAYQIEGAAATDGRTPSIWDTFSERPGAVVGGHTGHVAVDHYHRYRDDVALMRRMGLNSYRFSVSWSRVQPAGAGPANPAGLDFYRRLVDELLDNGIQPWLTLYHWDLPQPIEDAGGWPARDTAARFADYAALVHHALGDRVNAFTTLNEPWCSAFLGYASGEHAPGRRDVVSAVRAAHHLLLGHGLAVDAIRAQRADAQVGITLNLYAISAASASPADQDAARRIDGIGNRFFLDPVLLGRYPADVVRDLSSITDFSHVKDGDLAVISRPLSMLGINYYSRHVLAAPAPAGDSEGASQRSEERTERGASPNGYVDTSQSDGAIDWRGTGIVNPYPGSEAVRFVQRGVPVTAMDWEIDAPGLAEVLRRVSREYPAVPLYITENGAAFQDEVAPDGSVQDADRRAYFEAHLRACHEAIAAGVPLRGYFAWSLLDNFEWAWGYTRRFGLVHVDYQSQVRTPKASAHWYSDVIRRHGLLDHTPQGAGATP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 3 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 4 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 8 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 9 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 10 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 11 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 12 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 13 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 14 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 15 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 16 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 17 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 18 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 19 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 20 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 21 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 22 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 23 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 24 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 25 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 26 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 27 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 28 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 29 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 30 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 31 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 32 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 33 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 34 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 35 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 36 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 37 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 38 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 39 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 40 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 41 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 42 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 43 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 44 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 45 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 46 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 47 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 48 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 49 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 50 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 51 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 52 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 53 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 54 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 55 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 56 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 57 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 58 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 59 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 60 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 61 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 62 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 63 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 64 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 65 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 66 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 67 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 68 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 69 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 70 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 71 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 73 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 74 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 75 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 81 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 86 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 89 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 126 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 127 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 128 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 129 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 130 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 131 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 132 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 133 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 134 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 162 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 223 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 224 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 238 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 242 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 246 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 391 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 392 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 395 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 401 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 402 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 403 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 404 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 405 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 406 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 407 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 408 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 409 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 410 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 411 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.74 |
| Metatranscriptomes | 0.15 |
| Isolates | 12.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.19 |
| Nodule | 1.05 |
| Rhizoplane | 3.14 |
| Rhizosphere | 79.22 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 12.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10030411 | 3300003203 | Bacteria | 2032 |
| 2 | rootH1_10044769 | 3300003316 | Bacteria | 5616 |
| 3 | rootL2_10106560 | 3300003322 | Bacteria | 3020 |
| 4 | rootH1_10004943 | 3300003316 | Bacteria | 35922 |
| 5 | rootH1_10004943 | 3300003323 | Bacteria | 7849 |
| 6 | Ga0055525_1000025 | 3300003759 | Bacteria | 347582 |
| 7 | Ga0055529_1000133 | 3300003763 | Bacteria | 104484 |
| 8 | Ga0055526_1000487 | 3300003771 | Bacteria | 31529 |
| 9 | Ga0055537_1000035 | 3300003773 | Bacteria | 96274 |
| 10 | Ga0055524_1005183 | 3300003775 | Bacteria | 5869 |
| 11 | Ga0055534_1000325 | 3300003784 | Bacteria | 31562 |
| 12 | Ga0055528_1000058 | 3300003790 | Bacteria | 88086 |
| 13 | Ga0070658_10001438 | 3300005327 | Bacteria | 20307 |
| 14 | Ga0070658_10015585 | 3300005327 | Bacteria | 6079 |
| 15 | Ga0070683_100000951 | 3300005329 | Bacteria | 21575 |
| 16 | Ga0070683_100007512 | 3300005329 | Bacteria | 9212 |
| 17 | Ga0070683_100007980 | 3300005329 | Bacteria | 8981 |
| 18 | Ga0070683_100010242 | 3300005329 | Bacteria | 8054 |
| 19 | Ga0070670_100015451 | 3300005331 | Bacteria | 6557 |
| 20 | Ga0068869_100002123 | 3300005334 | Bacteria | 11920 |
| 21 | Ga0068869_100134671 | 3300005334 | Bacteria | 1902 |
| 22 | Ga0070680_100156387 | 3300005336 | Bacteria | 1915 |
| 23 | Ga0070682_100002956 | 3300005337 | Bacteria | 9440 |
| 24 | Ga0068868_100010999 | 3300005338 | Bacteria | 6575 |
| 25 | Ga0068868_100028918 | 3300005338 | Bacteria | 4242 |
| 26 | Ga0070660_100002035 | 3300005339 | Bacteria | 13951 |
| 27 | Ga0070691_10011255 | 3300005341 | Bacteria | 4083 |
| 28 | Ga0070661_100016713 | 3300005344 | Bacteria | 5193 |
| 29 | Ga0070661_100049817 | 3300005344 | Bacteria | 3066 |
| 30 | Ga0070692_10000081 | 3300005345 | Bacteria | 20037 |
| 31 | Ga0070692_10012284 | 3300005345 | Bacteria | 3959 |
| 32 | Ga0070692_10014463 | 3300005345 | Bacteria | 3708 |
| 33 | Ga0070668_100088582 | 3300005347 | Bacteria | 2437 |
| 34 | Ga0070675_100000500 | 3300005354 | Bacteria | 26911 |
| 35 | Ga0070675_100003832 | 3300005354 | Bacteria | 11409 |
| 36 | Ga0070675_100006199 | 3300005354 | Bacteria | 9172 |
| 37 | Ga0070671_100000610 | 3300005355 | Bacteria | 25520 |
| 38 | Ga0070688_100085797 | 3300005365 | Bacteria | 2047 |
| 39 | Ga0070659_100001502 | 3300005366 | Bacteria | 16813 |
| 40 | Ga0070659_100042397 | 3300005366 | Bacteria | 3557 |
| 41 | Ga0070709_10030767 | 3300005434 | Bacteria | 3224 |
| 42 | Ga0070714_100007850 | 3300005435 | Bacteria | 8310 |
| 43 | Ga0070710_10001747 | 3300005437 | Bacteria | 10280 |
| 44 | Ga0070710_10008929 | 3300005437 | Bacteria | 4894 |
| 45 | Ga0070700_100007623 | 3300005441 | Bacteria | 5856 |
| 46 | Ga0070694_100040884 | 3300005444 | Bacteria | 3091 |
| 47 | Ga0070663_100006893 | 3300005455 | Bacteria | 6877 |
| 48 | Ga0070663_100011692 | 3300005455 | Bacteria | 5521 |
| 49 | Ga0070663_100038366 | 3300005455 | Bacteria | 3342 |
| 50 | Ga0070678_100171683 | 3300005456 | Bacteria | 1767 |
| 51 | Ga0070681_10031754 | 3300005458 | Bacteria | 5301 |
| 52 | Ga0070685_10006225 | 3300005466 | Bacteria | 6077 |
| 53 | Ga0070679_100010283 | 3300005530 | Bacteria | 8869 |
| 54 | Ga0070684_100009947 | 3300005535 | Bacteria | 7519 |
| 55 | Ga0070684_100027367 | 3300005535 | Bacteria | 4811 |
| 56 | Ga0070684_100039817 | 3300005535 | Bacteria | 4044 |
| 57 | Ga0068853_100004376 | 3300005539 | Bacteria | 10933 |
| 58 | Ga0068853_100008565 | 3300005539 | Bacteria | 8221 |
| 59 | Ga0068853_100100097 | 3300005539 | Bacteria | 2562 |
| 60 | Ga0070693_100010660 | 3300005547 | Bacteria | 4608 |
| 61 | Ga0070665_100014500 | 3300005548 | Bacteria | 7906 |
| 62 | Ga0070665_100254515 | 3300005548 | Bacteria | 1757 |
| 63 | Ga0068855_100177959 | 3300005563 | Bacteria | 2405 |
| 64 | Ga0070664_100000986 | 3300005564 | Bacteria | 22287 |
| 65 | Ga0070664_100001017 | 3300005564 | Bacteria | 22018 |
| 66 | Ga0070664_100011712 | 3300005564 | Bacteria | 7118 |
| 67 | Ga0070664_100091397 | 3300005564 | Bacteria | 2635 |
| 68 | Ga0068857_100001211 | 3300005577 | Bacteria | 20120 |
| 69 | Ga0068856_100018360 | 3300005614 | Bacteria | 6778 |
| 70 | Ga0068856_100069747 | 3300005614 | Bacteria | 3476 |
| 71 | Ga0070702_100001137 | 3300005615 | Bacteria | 10670 |
| 72 | Ga0070702_100007666 | 3300005615 | Bacteria | 5178 |
| 73 | Ga0070702_100028520 | 3300005615 | Bacteria | 3026 |
| 74 | Ga0068852_100013223 | 3300005616 | Bacteria | 6309 |
| 75 | Ga0068852_100037469 | 3300005616 | Bacteria | 4066 |
| 76 | Ga0068859_100000001 | 3300005617 | Bacteria | 545224 |
| 77 | Ga0068859_100016831 | 3300005617 | Bacteria | 7339 |
| 78 | Ga0068864_100029219 | 3300005618 | Bacteria | 4665 |
| 79 | Ga0068864_100077496 | 3300005618 | Bacteria | 2907 |
| 80 | Ga0068870_10000675 | 3300005840 | Bacteria | 13011 |
| 81 | Ga0068863_100006338 | 3300005841 | Bacteria | 11602 |
| 82 | Ga0068863_100055968 | 3300005841 | Bacteria | 3734 |
| 83 | Ga0068858_100048426 | 3300005842 | Bacteria | 3939 |
| 84 | Ga0068858_100140953 | 3300005842 | Bacteria | 2263 |
| 85 | Ga0068858_100198276 | 3300005842 | Bacteria | 1898 |
| 86 | Ga0068862_100003795 | 3300005844 | Bacteria | 12873 |
| 87 | Ga0068862_100183893 | 3300005844 | Bacteria | 1877 |
| 88 | Ga0081455_10000157 | 3300005937 | Bacteria | 82320 |
| 89 | Ga0081455_10000487 | 3300005937 | Bacteria | 51494 |
| 90 | Ga0081539_10000128 | 3300005985 | Bacteria | 179041 |
| 91 | Ga0081539_10002184 | 3300005985 | Bacteria | 28707 |
| 92 | Ga0081539_10031245 | 3300005985 | Bacteria | 3287 |
| 93 | Ga0068871_100010156 | 3300006358 | Bacteria | 6855 |
| 94 | Ga0075428_100000249 | 3300006844 | Bacteria | 52754 |
| 95 | Ga0075428_100007485 | 3300006844 | Bacteria | 12101 |
| 96 | Ga0075428_100008826 | 3300006844 | Bacteria | 11185 |
| 97 | Ga0075428_100087839 | 3300006844 | Bacteria | 3391 |
| 98 | Ga0075430_100013782 | 3300006846 | Bacteria | 6888 |
| 99 | Ga0075430_100025090 | 3300006846 | Bacteria | 5071 |
| 100 | Ga0075430_100068710 | 3300006846 | Bacteria | 2972 |
| 101 | Ga0075431_100004085 | 3300006847 | Bacteria | 14240 |
| 102 | Ga0075431_100012731 | 3300006847 | Bacteria | 8493 |
| 103 | Ga0075431_100032957 | 3300006847 | Bacteria | 5339 |
| 104 | Ga0075433_10008500 | 3300006852 | Bacteria | 8194 |
| 105 | Ga0075434_100006079 | 3300006871 | Bacteria | 11043 |
| 106 | Ga0075429_100002277 | 3300006880 | Bacteria | 16101 |
| 107 | Ga0075429_100014279 | 3300006880 | Bacteria | 6888 |
| 108 | Ga0075429_100027382 | 3300006880 | Bacteria | 4947 |
| 109 | Ga0075429_100040299 | 3300006880 | Bacteria | 4066 |
| 110 | Ga0068865_100035342 | 3300006881 | Bacteria | 3359 |
| 111 | Ga0075436_100000859 | 3300006914 | Bacteria | 20188 |
| 112 | Ga0097620_100000001 | 3300006931 | Bacteria | 545224 |
| 113 | Ga0097620_100016831 | 3300006931 | Bacteria | 7339 |
| 114 | Ga0075435_100041843 | 3300007076 | Bacteria | 3663 |
| 115 | Ga0105240_10063784 | 3300009093 | Bacteria | 4581 |
| 116 | Ga0111539_10001734 | 3300009094 | Bacteria | 29031 |
| 117 | Ga0111539_10002939 | 3300009094 | Bacteria | 22595 |
| 118 | Ga0105245_10001884 | 3300009098 | Bacteria | 19038 |
| 119 | Ga0105245_10006225 | 3300009098 | Bacteria | 10498 |
| 120 | Ga0105245_10045501 | 3300009098 | Bacteria | 3920 |
| 121 | Ga0105247_10011226 | 3300009101 | Bacteria | 5403 |
| 122 | Ga0114129_10000352 | 3300009147 | Bacteria | 53517 |
| 123 | Ga0114129_10044528 | 3300009147 | Bacteria | 6243 |
| 124 | Ga0114129_10081816 | 3300009147 | Bacteria | 4488 |
| 125 | Ga0105243_10124359 | 3300009148 | Bacteria | 2180 |
| 126 | Ga0105241_10002930 | 3300009174 | Bacteria | 12741 |
| 127 | Ga0105237_10052495 | 3300009545 | Bacteria | 4092 |
| 128 | Ga0105239_10059327 | 3300010375 | Bacteria | 4199 |
| 129 | Ga0105246_10002248 | 3300011119 | Bacteria | 11646 |
| 130 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 131 | Ga0157371_10013441 | 3300013102 | Bacteria | 6215 |
| 132 | Ga0157369_10033434 | 3300013105 | Bacteria | 5651 |
| 133 | Ga0157374_10083478 | 3300013296 | Bacteria | 3035 |
| 134 | Ga0157378_10170949 | 3300013297 | Bacteria | 2038 |
| 135 | Ga0157372_10039874 | 3300013307 | Bacteria | 5185 |
| 136 | Ga0157372_10046203 | 3300013307 | Bacteria | 4833 |
| 137 | Ga0157372_10052701 | 3300013307 | Bacteria | 4531 |
| 138 | Ga0157375_10056496 | 3300013308 | Bacteria | 3875 |
| 139 | Ga0163163_10002454 | 3300014325 | Bacteria | 15679 |
| 140 | Ga0182008_10009447 | 3300014497 | Bacteria | 5260 |
| 141 | Ga0182008_10032816 | 3300014497 | Bacteria | 2606 |
| 142 | Ga0157377_10007093 | 3300014745 | Bacteria | 5386 |
| 143 | Ga0157379_10152151 | 3300014968 | Bacteria | 2087 |
| 144 | Ga0157376_10098036 | 3300014969 | Bacteria | 2555 |
| 145 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 146 | Ga0163161_10087091 | 3300017792 | Bacteria | 2306 |
| 147 | Ga0206354_10748882 | 3300020081 | Bacteria | 2089 |
| 148 | Ga0213875_10000499 | 3300021388 | Bacteria | 32899 |
| 149 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 150 | Ga0207425_1000202 | 3300025245 | Bacteria | 47483 |
| 151 | Ga0209677_104852 | 3300025253 | Bacteria | 3706 |
| 152 | Ga0209148_1000590 | 3300025254 | Bacteria | 33089 |
| 153 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 154 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 155 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 156 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 157 | Ga0209025_1001180 | 3300025294 | Bacteria | 36969 |
| 158 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 159 | Ga0209758_1000372 | 3300025297 | Bacteria | 78825 |
| 160 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 161 | Ga0209051_1017704 | 3300025303 | Bacteria | 3177 |
| 162 | Ga0207692_10001543 | 3300025898 | Bacteria | 8654 |
| 163 | Ga0207692_10084359 | 3300025898 | Bacteria | 1707 |
| 164 | Ga0207710_10040443 | 3300025900 | Bacteria | 2066 |
| 165 | Ga0207688_10001656 | 3300025901 | Bacteria | 11779 |
| 166 | Ga0207699_10082168 | 3300025906 | Bacteria | 2001 |
| 167 | Ga0207699_10085472 | 3300025906 | Bacteria | 1968 |
| 168 | Ga0207699_10119288 | 3300025906 | Bacteria | 1703 |
| 169 | Ga0207643_10000243 | 3300025908 | Bacteria | 37871 |
| 170 | Ga0207705_10002403 | 3300025909 | Bacteria | 14458 |
| 171 | Ga0207654_10010981 | 3300025911 | Bacteria | 4610 |
| 172 | Ga0207660_10016326 | 3300025917 | Bacteria | 4914 |
| 173 | Ga0207657_10005761 | 3300025919 | Bacteria | 12919 |
| 174 | Ga0207657_10010908 | 3300025919 | Bacteria | 9043 |
| 175 | Ga0207657_10053857 | 3300025919 | Bacteria | 3482 |
| 176 | Ga0207649_10033048 | 3300025920 | Bacteria | 3088 |
| 177 | Ga0207649_10034910 | 3300025920 | Bacteria | 3017 |
| 178 | Ga0207652_10027175 | 3300025921 | Bacteria | 4767 |
| 179 | Ga0207659_10001668 | 3300025926 | Bacteria | 13192 |
| 180 | Ga0207659_10013895 | 3300025926 | Bacteria | 5176 |
| 181 | Ga0207687_10007814 | 3300025927 | Bacteria | 7014 |
| 182 | Ga0207687_10019413 | 3300025927 | Bacteria | 4504 |
| 183 | Ga0207700_10041362 | 3300025928 | Bacteria | 3371 |
| 184 | Ga0207700_10046870 | 3300025928 | Bacteria | 3200 |
| 185 | Ga0207690_10044452 | 3300025932 | Bacteria | 2928 |
| 186 | Ga0207690_10130173 | 3300025932 | Bacteria | 1840 |
| 187 | Ga0207690_10134550 | 3300025932 | Bacteria | 1813 |
| 188 | Ga0207706_10004525 | 3300025933 | Bacteria | 13058 |
| 189 | Ga0207709_10063270 | 3300025935 | Bacteria | 2318 |
| 190 | Ga0207670_10016736 | 3300025936 | Bacteria | 4415 |
| 191 | Ga0207704_10034889 | 3300025938 | Bacteria | 2876 |
| 192 | Ga0207711_10036486 | 3300025941 | Bacteria | 4171 |
| 193 | Ga0207689_10000249 | 3300025942 | Bacteria | 48288 |
| 194 | Ga0207689_10022071 | 3300025942 | Bacteria | 5353 |
| 195 | Ga0207661_10003256 | 3300025944 | Bacteria | 11255 |
| 196 | Ga0207661_10015667 | 3300025944 | Bacteria | 5586 |
| 197 | Ga0207661_10022967 | 3300025944 | Bacteria | 4707 |
| 198 | Ga0207661_10040245 | 3300025944 | Bacteria | 3673 |
| 199 | Ga0207661_10042483 | 3300025944 | Bacteria | 3584 |
| 200 | Ga0207679_10003806 | 3300025945 | Bacteria | 9355 |
| 201 | Ga0207679_10006523 | 3300025945 | Bacteria | 7378 |
| 202 | Ga0207679_10034266 | 3300025945 | Bacteria | 3580 |
| 203 | Ga0207679_10060464 | 3300025945 | Bacteria | 2815 |
| 204 | Ga0207668_10078930 | 3300025972 | Bacteria | 2379 |
| 205 | Ga0207658_10180934 | 3300025986 | Bacteria | 1745 |
| 206 | Ga0207677_10004582 | 3300026023 | Bacteria | 7433 |
| 207 | Ga0207677_10009501 | 3300026023 | Bacteria | 5474 |
| 208 | Ga0207703_10111408 | 3300026035 | Bacteria | 2336 |
| 209 | Ga0207639_10002566 | 3300026041 | Bacteria | 12182 |
| 210 | Ga0207678_10000437 | 3300026067 | Bacteria | 37849 |
| 211 | Ga0207678_10010910 | 3300026067 | Bacteria | 7982 |
| 212 | Ga0207678_10022373 | 3300026067 | Bacteria | 5537 |
| 213 | Ga0207708_10002920 | 3300026075 | Bacteria | 12589 |
| 214 | Ga0207708_10003232 | 3300026075 | Bacteria | 11997 |
| 215 | Ga0207702_10004711 | 3300026078 | Bacteria | 12055 |
| 216 | Ga0207641_10031439 | 3300026088 | Bacteria | 4403 |
| 217 | Ga0207676_10004625 | 3300026095 | Bacteria | 9744 |
| 218 | Ga0207676_10088794 | 3300026095 | Bacteria | 2531 |
| 219 | Ga0207674_10003876 | 3300026116 | Bacteria | 18233 |
| 220 | Ga0207674_10029511 | 3300026116 | Bacteria | 5774 |
| 221 | Ga0207674_10118652 | 3300026116 | Bacteria | 2615 |
| 222 | Ga0207683_10000612 | 3300026121 | Bacteria | 32925 |
| 223 | Ga0207683_10077049 | 3300026121 | Bacteria | 2953 |
| 224 | Ga0207698_10073646 | 3300026142 | Bacteria | 2720 |
| 225 | Ga0207428_10013648 | 3300027907 | Bacteria | 7087 |
| 226 | Ga0268266_10078385 | 3300028379 | Bacteria | 2875 |
| 227 | Ga0268265_10003188 | 3300028380 | Bacteria | 11917 |
| 228 | Ga0268265_10083036 | 3300028380 | Bacteria | 2535 |
| 229 | Ga0268264_10256982 | 3300028381 | Bacteria | 1625 |
| 230 | Ga0307517_10008362 | 3300028786 | Bacteria | 14853 |
| 231 | Ga0307515_10008666 | 3300028794 | Bacteria | 19791 |
| 232 | Ga0307511_10001845 | 3300030521 | Bacteria | 22256 |
| 233 | Ga0307512_10028172 | 3300030522 | Bacteria | 4929 |
| 234 | Ga0265320_10009848 | 3300031240 | Bacteria | 5727 |
| 235 | Ga0307513_10020885 | 3300031456 | Bacteria | 7748 |
| 236 | Ga0307509_10009951 | 3300031507 | Bacteria | 11748 |
| 237 | Ga0307509_10011427 | 3300031507 | Bacteria | 10748 |
| 238 | Ga0307514_10057602 | 3300031649 | Bacteria | 2975 |
| 239 | Ga0307514_10063459 | 3300031649 | Bacteria | 2805 |
| 240 | Ga0316575_10000010 | 3300031665 | Bacteria | 51771 |
| 241 | Ga0316576_10007855 | 3300031727 | Bacteria | 6745 |
| 242 | Ga0307413_10005800 | 3300031824 | Bacteria | 5561 |
| 243 | Ga0307413_10054688 | 3300031824 | Bacteria | 2424 |
| 244 | Ga0307518_10028309 | 3300031838 | Bacteria | 4044 |
| 245 | Ga0307406_10017304 | 3300031901 | Bacteria | 4198 |
| 246 | Ga0307409_100048517 | 3300031995 | Bacteria | 3232 |
| 247 | Ga0307409_100079780 | 3300031995 | Bacteria | 2639 |
| 248 | Ga0307507_10007393 | 3300033179 | Bacteria | 16030 |
| 249 | Ga0307507_10016591 | 3300033179 | Bacteria | 8550 |
| 250 | Ga0307510_10007347 | 3300033180 | Bacteria | 13129 |
| 251 | Ga0307510_10053173 | 3300033180 | Bacteria | 4260 |
| 252 | Ga0395899_0070221 | 3300037312 | Bacteria | 2563 |
| 253 | Ga0395900_0000324 | 3300037418 | Bacteria | 70682 |
| 254 | Ga0395900_0029681 | 3300037418 | Bacteria | 5611 |
| 255 | Ga0395900_0185206 | 3300037418 | Bacteria | 2113 |
| 256 | Ga0395898_0022655 | 3300037466 | Bacteria | 6359 |
| 257 | Ga0395898_0051003 | 3300037466 | Bacteria | 4047 |
| 258 | Ga0395905_0080751 | 3300037471 | Bacteria | 3048 |
| 259 | Ga0395905_0135372 | 3300037471 | Bacteria | 2317 |
| 260 | Ga0436364_1386442 | 3300037853 | Bacteria | 37433 |
| 261 | Ga0395901_0000089 | 3300038443 | Bacteria | 124305 |
| 262 | Ga0395901_0005824 | 3300038443 | Bacteria | 12476 |
| 263 | Ga0395901_0159532 | 3300038443 | Bacteria | 2368 |
| 264 | Ga0439436_0000330 | 3300041404 | Bacteria | 11642 |
| 265 | Ga0439436_0002440 | 3300041404 | Bacteria | 5585 |
| 266 | Ga0439439_0012517 | 3300041406 | Bacteria | 2052 |
| 267 | Ga0451853_1301325 | 3300041512 | Bacteria | 7962 |
| 268 | Ga0439448_0000868 | 3300042005 | Bacteria | 7386 |
| 269 | Ga0439449_0000183 | 3300042007 | Bacteria | 21770 |
| 270 | Ga0439455_0001890 | 3300042012 | Bacteria | 3668 |
| 271 | Ga0439457_000427 | 3300042014 | Bacteria | 12122 |
| 272 | Ga0439457_000664 | 3300042014 | Bacteria | 10181 |
| 273 | Ga0439462_0015749 | 3300042015 | Bacteria | 1951 |
| 274 | Ga0450894_000879 | 3300042131 | Bacteria | 4797 |
| 275 | Ga0439458_0003723 | 3300042157 | Bacteria | 3535 |
| 276 | Ga0439458_0015381 | 3300042157 | Bacteria | 1733 |
| 277 | Ga0451577_0000012 | 3300042876 | Bacteria | 575467 |
| 278 | Ga0466969_0005538 | 3300044656 | Bacteria | 6711 |
| 279 | Ga0466969_0071787 | 3300044656 | Bacteria | 1664 |
| 280 | Ga0466972_0001015 | 3300044658 | Bacteria | 13449 |
| 281 | Ga0466972_0001798 | 3300044658 | Bacteria | 10506 |
| 282 | Ga0466972_0003739 | 3300044658 | Bacteria | 7566 |
| 283 | Ga0466965_0001465 | 3300044683 | Bacteria | 9537 |
| 284 | Ga0466965_0006602 | 3300044683 | Bacteria | 5284 |
| 285 | Ga0466965_0008661 | 3300044683 | Bacteria | 4708 |
| 286 | Ga0466965_0019858 | 3300044683 | Bacteria | 3226 |
| 287 | Ga0466965_0098090 | 3300044683 | Bacteria | 1496 |
| 288 | Ga0466966_0003922 | 3300044684 | Bacteria | 9824 |
| 289 | Ga0466966_0019005 | 3300044684 | Bacteria | 4528 |
| 290 | Ga0466966_0045675 | 3300044684 | Bacteria | 2799 |
| 291 | Ga0466966_0052762 | 3300044684 | Bacteria | 2581 |
| 292 | Ga0466961_0014839 | 3300044693 | Bacteria | 5004 |
| 293 | Ga0466963_0006646 | 3300044694 | Bacteria | 6866 |
| 294 | Ga0466963_0091633 | 3300044694 | Bacteria | 2070 |
| 295 | Ga0466964_0001817 | 3300044706 | Bacteria | 7425 |
| 296 | Ga0466964_0001830 | 3300044706 | Bacteria | 7405 |
| 297 | Ga0466964_0062452 | 3300044706 | Bacteria | 1553 |
| 298 | Ga0453684_0038591 | 3300044712 | Bacteria | 6525 |
| 299 | Ga0466971_0010922 | 3300044719 | Bacteria | 3972 |
| 300 | Ga0466971_0032906 | 3300044719 | Bacteria | 2322 |
| 301 | Ga0466968_0017129 | 3300044735 | Bacteria | 2892 |
| 302 | Ga0466968_0021696 | 3300044735 | Bacteria | 2602 |
| 303 | Ga0466970_0001976 | 3300044765 | Bacteria | 9917 |
| 304 | Ga0466970_0028670 | 3300044765 | Bacteria | 2927 |
| 305 | Ga0466957_0003544 | 3300044842 | Bacteria | 8595 |
| 306 | Ga0466957_0003950 | 3300044842 | Bacteria | 8195 |
| 307 | Ga0466960_0004876 | 3300044901 | Bacteria | 5276 |
| 308 | Ga0466959_0020684 | 3300045049 | Bacteria | 4849 |
| 309 | Ga0466959_0111052 | 3300045049 | Bacteria | 1956 |
| 310 | Ga0466958_0022637 | 3300045836 | Bacteria | 3683 |
| 311 | Ga0466967_0009040 | 3300045976 | Bacteria | 7363 |
| 312 | Ga0466967_0064223 | 3300045976 | Bacteria | 3264 |
| 313 | Ga0466967_0163414 | 3300045976 | Bacteria | 2091 |
| 314 | Ga0495617_000139 | 3300046452 | Bacteria | 47951 |
| 315 | Ga0495592_0002377 | 3300046454 | Bacteria | 13265 |
| 316 | Ga0495603_0001033 | 3300046455 | Bacteria | 16095 |
| 317 | Ga0495603_0001268 | 3300046455 | Bacteria | 14708 |
| 318 | Ga0495603_0003077 | 3300046455 | Bacteria | 9907 |
| 319 | Ga0495603_0004977 | 3300046455 | Bacteria | 7953 |
| 320 | Ga0495590_0000314 | 3300046457 | Bacteria | 25322 |
| 321 | Ga0495629_0007045 | 3300046459 | Bacteria | 8284 |
| 322 | Ga0495629_0007808 | 3300046459 | Bacteria | 7875 |
| 323 | Ga0495629_0008014 | 3300046459 | Bacteria | 7773 |
| 324 | Ga0495629_0010442 | 3300046459 | Bacteria | 6754 |
| 325 | Ga0495629_0010634 | 3300046459 | Bacteria | 6694 |
| 326 | Ga0495629_0017542 | 3300046459 | Bacteria | 5131 |
| 327 | Ga0495638_0000067 | 3300046460 | Bacteria | 167869 |
| 328 | Ga0495638_0058219 | 3300046460 | Bacteria | 2395 |
| 329 | Ga0495651_0001434 | 3300046462 | Bacteria | 18454 |
| 330 | Ga0495653_0000018 | 3300046463 | Bacteria | 185787 |
| 331 | Ga0495653_0024485 | 3300046463 | Bacteria | 4863 |
| 332 | Ga0495650_0000239 | 3300046471 | Bacteria | 109891 |
| 333 | Ga0495650_0000305 | 3300046471 | Bacteria | 88924 |
| 334 | Ga0495650_0000472 | 3300046471 | Bacteria | 62014 |
| 335 | Ga0495650_0002496 | 3300046471 | Bacteria | 14773 |
| 336 | Ga0495650_0013594 | 3300046471 | Bacteria | 4294 |
| 337 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 338 | Ga0495605_0000117 | 3300046474 | Bacteria | 103262 |
| 339 | Ga0495605_0011372 | 3300046474 | Bacteria | 4967 |
| 340 | Ga0495605_0027462 | 3300046474 | Bacteria | 2948 |
| 341 | Ga0495605_0028670 | 3300046474 | Bacteria | 2872 |
| 342 | Ga0495639_0015258 | 3300046475 | Bacteria | 3330 |
| 343 | Ga0495639_0025491 | 3300046475 | Bacteria | 2608 |
| 344 | Ga0495662_0000316 | 3300046476 | Bacteria | 21004 |
| 345 | Ga0495662_0016113 | 3300046476 | Bacteria | 3624 |
| 346 | Ga0495664_0001280 | 3300046477 | Bacteria | 13167 |
| 347 | Ga0495664_0143757 | 3300046477 | Bacteria | 1446 |
| 348 | Ga0495584_0000186 | 3300046491 | Bacteria | 43887 |
| 349 | Ga0495584_0005832 | 3300046491 | Bacteria | 6488 |
| 350 | Ga0495585_0000418 | 3300046492 | Bacteria | 40978 |
| 351 | Ga0495594_0002866 | 3300046499 | Bacteria | 8964 |
| 352 | Ga0495594_0002972 | 3300046499 | Bacteria | 8788 |
| 353 | Ga0495596_0003323 | 3300046500 | Bacteria | 8194 |
| 354 | Ga0495596_0004822 | 3300046500 | Bacteria | 6485 |
| 355 | Ga0495607_0018097 | 3300046501 | Bacteria | 4501 |
| 356 | Ga0495607_0021878 | 3300046501 | Bacteria | 4021 |
| 357 | Ga0495607_0052757 | 3300046501 | Bacteria | 2353 |
| 358 | Ga0495583_0000160 | 3300046506 | Bacteria | 113560 |
| 359 | Ga0495583_0000162 | 3300046506 | Bacteria | 112598 |
| 360 | Ga0495606_0000269 | 3300046507 | Bacteria | 91558 |
| 361 | Ga0495606_0000783 | 3300046507 | Bacteria | 48693 |
| 362 | Ga0495606_0001207 | 3300046507 | Bacteria | 36311 |
| 363 | Ga0495606_0003466 | 3300046507 | Bacteria | 16724 |
| 364 | Ga0495606_0007008 | 3300046507 | Bacteria | 10229 |
| 365 | Ga0495606_0086159 | 3300046507 | Bacteria | 1942 |
| 366 | Ga0495608_0001532 | 3300046511 | Bacteria | 16465 |
| 367 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 368 | Ga0495610_0015782 | 3300046512 | Bacteria | 4375 |
| 369 | Ga0495610_0075302 | 3300046512 | Bacteria | 1563 |
| 370 | Ga0495616_0013425 | 3300046513 | Bacteria | 4619 |
| 371 | Ga0495616_0026271 | 3300046513 | Bacteria | 3101 |
| 372 | Ga0495616_0026651 | 3300046513 | Bacteria | 3073 |
| 373 | Ga0495618_0035076 | 3300046514 | Bacteria | 3148 |
| 374 | Ga0495620_0004115 | 3300046515 | Bacteria | 8251 |
| 375 | Ga0495620_0010011 | 3300046515 | Bacteria | 5015 |
| 376 | Ga0495628_0004838 | 3300046516 | Bacteria | 11847 |
| 377 | Ga0495628_0011400 | 3300046516 | Bacteria | 7521 |
| 378 | Ga0495631_0008030 | 3300046518 | Bacteria | 5333 |
| 379 | Ga0495632_0011173 | 3300046519 | Bacteria | 5258 |
| 380 | Ga0495637_0000057 | 3300046520 | Bacteria | 97433 |
| 381 | Ga0495643_0000118 | 3300046522 | Bacteria | 127939 |
| 382 | Ga0495643_0000212 | 3300046522 | Bacteria | 89287 |
| 383 | Ga0495643_0000263 | 3300046522 | Bacteria | 76248 |
| 384 | Ga0495643_0001396 | 3300046522 | Bacteria | 22518 |
| 385 | Ga0495643_0004726 | 3300046522 | Bacteria | 9428 |
| 386 | Ga0495644_0014730 | 3300046523 | Bacteria | 2993 |
| 387 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 388 | Ga0495648_0003084 | 3300046524 | Bacteria | 14880 |
| 389 | Ga0495648_0012918 | 3300046524 | Bacteria | 6201 |
| 390 | Ga0495648_0023170 | 3300046524 | Bacteria | 4259 |
| 391 | Ga0495666_0001077 | 3300046526 | Bacteria | 12999 |
| 392 | Ga0495642_0006502 | 3300046528 | Bacteria | 4484 |
| 393 | Ga0495652_0057679 | 3300046529 | Bacteria | 3291 |
| 394 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 395 | Ga0495654_0009991 | 3300046530 | Bacteria | 5183 |
| 396 | Ga0495665_0000346 | 3300046531 | Bacteria | 23339 |
| 397 | Ga0495640_0008329 | 3300046533 | Bacteria | 8128 |
| 398 | Ga0495640_0017241 | 3300046533 | Bacteria | 5385 |
| 399 | Ga0495586_0011130 | 3300046535 | Bacteria | 4780 |
| 400 | Ga0495587_0012333 | 3300046536 | Bacteria | 5384 |
| 401 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 402 | Ga0495609_0000269 | 3300046538 | Bacteria | 48750 |
| 403 | Ga0495597_0000027 | 3300046542 | Bacteria | 139281 |
| 404 | Ga0495597_0000917 | 3300046542 | Bacteria | 22841 |
| 405 | Ga0495597_0021607 | 3300046542 | Bacteria | 2990 |
| 406 | Ga0495645_0002377 | 3300046543 | Bacteria | 12768 |
| 407 | Ga0495622_0000060 | 3300046557 | Bacteria | 96603 |
| 408 | Ga0495633_0000128 | 3300046558 | Bacteria | 101213 |
| 409 | Ga0495633_0001536 | 3300046558 | Bacteria | 17721 |
| 410 | Ga0495633_0003289 | 3300046558 | Bacteria | 10858 |
| 411 | Ga0495633_0079309 | 3300046558 | Bacteria | 1528 |
| 412 | Ga0495633_0083155 | 3300046558 | Bacteria | 1489 |
| 413 | Ga0495667_0001088 | 3300046559 | Bacteria | 17635 |
| 414 | Ga0495667_0057688 | 3300046559 | Bacteria | 2552 |
| 415 | Ga0495656_0021085 | 3300046615 | Bacteria | 2534 |
| 416 | Ga0495668_0000144 | 3300046616 | Bacteria | 106951 |
| 417 | Ga0495668_0001247 | 3300046616 | Bacteria | 25528 |
| 418 | Ga0495668_0002800 | 3300046616 | Bacteria | 13877 |
| 419 | Ga0495668_0082152 | 3300046616 | Bacteria | 1767 |
| 420 | Ga0495634_0004825 | 3300046642 | Bacteria | 10474 |
| 421 | Ga0495634_0038089 | 3300046642 | Bacteria | 3279 |
| 422 | Ga0495634_0139173 | 3300046642 | Bacteria | 1542 |
| 423 | Ga0495611_0021232 | 3300046648 | Bacteria | 2803 |
| 424 | Ga0495625_0000192 | 3300046660 | Bacteria | 97193 |
| 425 | Ga0495625_0003424 | 3300046660 | Bacteria | 15832 |
| 426 | Ga0495625_0011290 | 3300046660 | Bacteria | 7296 |
| 427 | Ga0495635_0000558 | 3300046663 | Bacteria | 23721 |
| 428 | Ga0495635_0010158 | 3300046663 | Bacteria | 6583 |
| 429 | Ga0495661_0000663 | 3300046665 | Bacteria | 34526 |
| 430 | Ga0495661_0000872 | 3300046665 | Bacteria | 27928 |
| 431 | Ga0495661_0058750 | 3300046665 | Bacteria | 2291 |
| 432 | Ga0495661_0078861 | 3300046665 | Bacteria | 1904 |
| 433 | Ga0495588_0000089 | 3300046674 | Bacteria | 191894 |
| 434 | Ga0495657_0001523 | 3300046675 | Bacteria | 19960 |
| 435 | Ga0495657_0005278 | 3300046675 | Bacteria | 10225 |
| 436 | Ga0495657_0011223 | 3300046675 | Bacteria | 6710 |
| 437 | Ga0495599_0002673 | 3300046678 | Bacteria | 10406 |
| 438 | Ga0495623_0039407 | 3300046679 | Bacteria | 3019 |
| 439 | Ga0495646_0002071 | 3300046680 | Bacteria | 12161 |
| 440 | Ga0495646_0075470 | 3300046680 | Bacteria | 1976 |
| 441 | Ga0495613_0001444 | 3300046689 | Bacteria | 18157 |
| 442 | Ga0495613_0022476 | 3300046689 | Bacteria | 4698 |
| 443 | Ga0495670_0045592 | 3300046691 | Bacteria | 2189 |
| 444 | Ga0495671_0000024 | 3300046692 | Bacteria | 246812 |
| 445 | Ga0495671_0005439 | 3300046692 | Bacteria | 7454 |
| 446 | Ga0495649_0000715 | 3300046694 | Bacteria | 27013 |
| 447 | Ga0495649_0002538 | 3300046694 | Bacteria | 12794 |
| 448 | Ga0495649_0023132 | 3300046694 | Bacteria | 3471 |
| 449 | Ga0495649_0041662 | 3300046694 | Bacteria | 2510 |
| 450 | Ga0495589_0000027 | 3300046794 | Bacteria | 181084 |
| 451 | Ga0495589_0000974 | 3300046794 | Bacteria | 17471 |
| 452 | Ga0495589_0026299 | 3300046794 | Bacteria | 2949 |
| 453 | Ga0495589_0061067 | 3300046794 | Bacteria | 1850 |
| 454 | Ga0495589_0079158 | 3300046794 | Bacteria | 1599 |
| 455 | Ga0495600_0012846 | 3300046809 | Bacteria | 5245 |
| 456 | Ga0495660_0000054 | 3300046810 | Bacteria | 135325 |
| 457 | Ga0495660_0034429 | 3300046810 | Bacteria | 2834 |
| 458 | Ga0495660_0072915 | 3300046810 | Bacteria | 1817 |
| 459 | Ga0495581_0005609 | 3300047315 | Bacteria | 7275 |
| 460 | Ga0495581_0039742 | 3300047315 | Bacteria | 2724 |
| 461 | Ga0495604_0001376 | 3300047317 | Bacteria | 19927 |
| 462 | Ga0495604_0002526 | 3300047317 | Bacteria | 14589 |
| 463 | Ga0495636_0004016 | 3300047318 | Bacteria | 5750 |
| 464 | Ga0495674_0031949 | 3300047319 | Bacteria | 4777 |
| 465 | Ga0495672_0000253 | 3300047320 | Bacteria | 74560 |
| 466 | Ga0495672_0001329 | 3300047320 | Bacteria | 24574 |
| 467 | Ga0495672_0002190 | 3300047320 | Bacteria | 18196 |
| 468 | Ga0495676_0003549 | 3300047321 | Bacteria | 14139 |
| 469 | Ga0495676_0007630 | 3300047321 | Bacteria | 9922 |
| 470 | Ga0495676_0024841 | 3300047321 | Bacteria | 5179 |
| 471 | Ga0495676_0032458 | 3300047321 | Bacteria | 4406 |
| 472 | Ga0495683_0004438 | 3300047323 | Bacteria | 7969 |
| 473 | Ga0495683_0010058 | 3300047323 | Bacteria | 5017 |
| 474 | Ga0495683_0025422 | 3300047323 | Bacteria | 3035 |
| 475 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 476 | Ga0495687_000023 | 3300047443 | Bacteria | 317750 |
| 477 | Ga0495687_000287 | 3300047443 | Bacteria | 66402 |
| 478 | Ga0495687_000358 | 3300047443 | Bacteria | 57250 |
| 479 | Ga0495687_000412 | 3300047443 | Bacteria | 52902 |
| 480 | Ga0495687_019705 | 3300047443 | Bacteria | 3301 |
| 481 | Ga0495687_059624 | 3300047443 | Bacteria | 1577 |
| 482 | Ga0495675_0025269 | 3300047444 | Bacteria | 3787 |
| 483 | Ga0495677_0000020 | 3300047445 | Bacteria | 107093 |
| 484 | Ga0495677_0000451 | 3300047445 | Bacteria | 17521 |
| 485 | Ga0495677_0000779 | 3300047445 | Bacteria | 12855 |
| 486 | Ga0495679_007559 | 3300047446 | Bacteria | 4514 |
| 487 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 488 | Ga0495673_0000120 | 3300047469 | Bacteria | 144972 |
| 489 | Ga0495681_0000354 | 3300047470 | Bacteria | 35817 |
| 490 | Ga0495681_0011640 | 3300047470 | Bacteria | 5224 |
| 491 | Ga0495684_0013971 | 3300047471 | Bacteria | 6176 |
| 492 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 493 | Ga0495686_0003153 | 3300047472 | Bacteria | 14540 |
| 494 | Ga0495686_0009746 | 3300047472 | Bacteria | 6893 |
| 495 | Ga0495593_0002940 | 3300047673 | Bacteria | 10254 |
| 496 | Ga0495593_0076456 | 3300047673 | Bacteria | 1735 |
| 497 | Ga0495602_0117958 | 3300048088 | Bacteria | 2141 |
| 498 | Ga0495614_0002100 | 3300048089 | Bacteria | 8803 |
| 499 | Ga0495614_0008179 | 3300048089 | Bacteria | 4651 |
| 500 | Ga0495614_0067665 | 3300048089 | Bacteria | 1537 |
| 501 | Ga0495626_0000800 | 3300048091 | Bacteria | 28478 |
| 502 | Ga0495626_0001889 | 3300048091 | Bacteria | 15658 |
| 503 | Ga0495626_0008085 | 3300048091 | Bacteria | 5802 |
| 504 | Ga0495626_0016619 | 3300048091 | Bacteria | 3734 |
| 505 | Ga0495626_0018630 | 3300048091 | Bacteria | 3482 |
| 506 | Ga0495626_0038432 | 3300048091 | Bacteria | 2269 |
| 507 | Ga0496102_0042564 | 3300048905 | Bacteria | 4115 |
| 508 | Ga0496102_0161297 | 3300048905 | Bacteria | 2109 |
| 509 | Ga0496104_0025309 | 3300048907 | Bacteria | 5470 |
| 510 | Ga0496104_0031219 | 3300048907 | Bacteria | 4953 |
| 511 | Ga0496105_0002913 | 3300048908 | Bacteria | 12555 |
| 512 | Ga0496106_0001057 | 3300048909 | Bacteria | 20282 |
| 513 | Ga0496106_0010225 | 3300048909 | Bacteria | 6935 |
| 514 | Ga0496107_0069056 | 3300048910 | Bacteria | 2564 |
| 515 | Ga0496108_0005277 | 3300048911 | Bacteria | 10430 |
| 516 | Ga0496108_0008291 | 3300048911 | Bacteria | 8428 |
| 517 | Ga0496109_0005868 | 3300048912 | Bacteria | 10299 |
| 518 | Ga0496109_0079316 | 3300048912 | Bacteria | 3024 |
| 519 | Ga0496110_0001600 | 3300048913 | Bacteria | 16555 |
| 520 | Ga0496110_0016585 | 3300048913 | Bacteria | 6151 |
| 521 | Ga0496110_0170806 | 3300048913 | Bacteria | 1973 |
| 522 | Ga0496111_0002018 | 3300048914 | Bacteria | 12077 |
| 523 | Ga0496111_0030388 | 3300048914 | Bacteria | 3840 |
| 524 | Ga0496112_0012152 | 3300048915 | Bacteria | 7901 |
| 525 | Ga0496113_0001957 | 3300048916 | Bacteria | 11799 |
| 526 | Ga0496113_0002354 | 3300048916 | Bacteria | 10938 |
| 527 | Ga0496114_0031403 | 3300048917 | Bacteria | 4371 |
| 528 | Ga0496118_0093858 | 3300048921 | Bacteria | 2054 |
| 529 | Ga0496119_0000595 | 3300048922 | Bacteria | 48961 |
| 530 | Ga0496120_0012750 | 3300048923 | Bacteria | 5699 |
| 531 | Ga0496121_0030178 | 3300048924 | Bacteria | 4986 |
| 532 | Ga0496121_0104169 | 3300048924 | Bacteria | 2181 |
| 533 | Ga0496122_0046284 | 3300048925 | Bacteria | 3371 |
| 534 | Ga0496122_0076329 | 3300048925 | Bacteria | 2358 |
| 535 | Ga0496123_0001793 | 3300048926 | Bacteria | 28269 |
| 536 | Ga0496123_0002950 | 3300048926 | Bacteria | 19865 |
| 537 | Ga0496124_0090698 | 3300048927 | Bacteria | 2492 |
| 538 | Ga0496124_0093334 | 3300048927 | Bacteria | 2450 |
| 539 | Ga0496124_0097533 | 3300048927 | Bacteria | 2386 |
| 540 | Ga0496124_0131746 | 3300048927 | Bacteria | 1985 |
| 541 | Ga0496124_0184131 | 3300048927 | Bacteria | 1604 |
| 542 | Ga0496124_0220577 | 3300048927 | Bacteria | 1426 |
| 543 | Ga0495678_000154 | 3300049459 | Bacteria | 82494 |
| 544 | Ga0501033_0008365 | 3300049570 | Bacteria | 8012 |
| 545 | Ga0501033_0051945 | 3300049570 | Bacteria | 3038 |
| 546 | Ga0501037_0152417 | 3300049573 | Bacteria | 1651 |
| 547 | Ga0501039_0063964 | 3300049575 | Bacteria | 2851 |
| 548 | Ga0501042_0110097 | 3300049578 | Bacteria | 1983 |
| 549 | Ga0501043_0042827 | 3300049579 | Bacteria | 3558 |
| 550 | Ga0501046_0132310 | 3300049580 | Bacteria | 1891 |
| 551 | Ga0501047_0241337 | 3300049581 | Bacteria | 1657 |
| 552 | Ga0501048_0042396 | 3300049582 | Bacteria | 3258 |
| 553 | Ga0501075_0012265 | 3300049591 | Bacteria | 6086 |
| 554 | Ga0501076_0020851 | 3300049592 | Bacteria | 5019 |
| 555 | Ga0501035_0002652 | 3300049822 | Bacteria | 17407 |
| 556 | Ga0501035_0005722 | 3300049822 | Bacteria | 11722 |
| 557 | Ga0501044_0001832 | 3300049823 | Bacteria | 24751 |
| 558 | Ga0501044_0039888 | 3300049823 | Bacteria | 4895 |
| 559 | nmdc:mga05p37_188172_c1 | 3300050507 | Bacteria | 2508 |
| 560 | nmdc:mga05p37_21243_c1 | 3300050507 | Bacteria | 7858 |
| 561 | nmdc:mga05p37_24_c1 | 3300050507 | Bacteria | 118187 |
| 562 | nmdc:mga09592_149_c1 | 3300050508 | Bacteria | 31477 |
| 563 | nmdc:mga09592_15640_c1 | 3300050508 | Bacteria | 6199 |
| 564 | nmdc:mga09592_1957_c1 | 3300050508 | Bacteria | 16597 |
| 565 | nmdc:mga09592_39874_c1 | 3300050508 | Bacteria | 3945 |
| 566 | nmdc:mga0qj67_57_c2 | 3300050509 | Bacteria | 38742 |
| 567 | nmdc:mga06r32_22_c1 | 3300050510 | Bacteria | 54748 |
| 568 | nmdc:mga06r32_258837_c1 | 3300050510 | Bacteria | 1728 |
| 569 | nmdc:mga06r32_4692_c1 | 3300050510 | Bacteria | 12275 |
| 570 | nmdc:mga08y16_1631_c1 | 3300050511 | Bacteria | 22731 |
| 571 | nmdc:mga08y16_73832_c1 | 3300050511 | Bacteria | 3554 |
| 572 | nmdc:mga0n895_5324_c1 | 3300050512 | Bacteria | 10718 |
| 573 | nmdc:mga0rr50_173053_c1 | 3300050513 | Bacteria | 1761 |
| 574 | nmdc:mga0a205_3903_c1 | 3300050515 | Bacteria | 13340 |
| 575 | Ga0495601_0035036 | 3300053077 | Bacteria | 3132 |
| 576 | Ga0495619_0031433 | 3300053085 | Bacteria | 3440 |
| 577 | Ga0495619_0035818 | 3300053085 | Bacteria | 3230 |
| 578 | Ga0500583_0044263 | 3300053092 | Bacteria | 2038 |
| 579 | Ga0500560_001901 | 3300053107 | Bacteria | 3816 |
| 580 | Ga0500594_0002809 | 3300053118 | Bacteria | 3793 |
| 581 | Ga0500618_000284 | 3300053125 | Bacteria | 38522 |
| 582 | Ga0500586_000057 | 3300053145 | Bacteria | 20024 |
| 583 | Ga0500588_0001588 | 3300053146 | Bacteria | 4376 |
| 584 | Ga0500616_0007334 | 3300053153 | Bacteria | 7029 |
| 585 | Ga0500634_0000179 | 3300053161 | Bacteria | 21017 |
| 586 | Ga0501084_0054291 | 3300054114 | Bacteria | 3352 |
| 587 | Ga0466962_0030309 | 3300061719 | Bacteria | 2590 |
| 588 | Ga0466962_0044305 | 3300061719 | Bacteria | 2128 |
| 589 | Ga0530510_0003599 | 3300061734 | Bacteria | 10668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046536 | Ga0495587_0012333 | Ga0495587_0012333_45_1238 | 389 |
| 2 | 3300048088 | Ga0495602_0117958 | Ga0495602_0117958_904_2097 | 389 |
| 3 | iso_pu_bacteria | 2899370129 | 2899376140 | 408 |
| 4 | 3300005937 | Ga0081455_10000487 | Ga0081455_1000048723 | 412 |
| 5 | 3300031995 | Ga0307409_100048517 | Ga0307409_1000485173 | 415 |
| 6 | 3300005937 | Ga0081455_10000157 | Ga0081455_1000015770 | 423 |
| 7 | iso_pu_bacteria | 2512564039 | 2512730740 | 424 |
| 8 | 3300046507 | Ga0495606_0086159 | Ga0495606_0086159_260_1594 | 425 |
| 9 | 3300048927 | Ga0496124_0093334 | Ga0496124_0093334_1066_2409 | 426 |
| 10 | iso_pu_bacteria | 2866612099 | 2866615891 | 426 |
| 11 | 3300005617 | Ga0068859_100000001 | Ga0068859_100000001128 | 428 |
| 12 | 3300006931 | Ga0097620_100000001 | Ga0097620_100000001128 | 428 |
| 13 | 3300033180 | Ga0307510_10007347 | Ga0307510_100073476 | 428 |
| 14 | 3300048921 | Ga0496118_0093858 | Ga0496118_0093858_715_2025 | 428 |
| 15 | 3300049591 | Ga0501075_0012265 | Ga0501075_0012265_3267_4607 | 428 |
| 16 | 3300049592 | Ga0501076_0020851 | Ga0501076_0020851_1739_3079 | 428 |
| 17 | 3300054114 | Ga0501084_0054291 | Ga0501084_0054291_1172_2512 | 428 |
| 18 | 3300061734 | Ga0530510_0003599 | Ga0530510_0003599_4793_6133 | 428 |
| 19 | 3300006844 | Ga0075428_100007485 | Ga0075428_1000074856 | 429 |
| 20 | 3300048922 | Ga0496119_0000595 | Ga0496119_0000595_31128_32495 | 429 |
| 21 | 3300048923 | Ga0496120_0012750 | Ga0496120_0012750_2196_3563 | 429 |
| 22 | 3300017792 | Ga0163161_10087091 | Ga0163161_100870911 | 430 |
| 23 | 3300031727 | Ga0316576_10007855 | Ga0316576_100078553 | 430 |
| 24 | 3300046475 | Ga0495639_0025491 | Ga0495639_0025491_1093_2430 | 430 |
| 25 | 3300005327 | Ga0070658_10001438 | Ga0070658_100014387 | 431 |
| 26 | 3300005327 | Ga0070658_10015585 | Ga0070658_100155852 | 431 |
| 27 | 3300005339 | Ga0070660_100002035 | Ga0070660_1000020352 | 431 |
| 28 | 3300005344 | Ga0070661_100016713 | Ga0070661_1000167133 | 431 |
| 29 | 3300005539 | Ga0068853_100008565 | Ga0068853_1000085654 | 431 |
| 30 | 3300005985 | Ga0081539_10031245 | Ga0081539_100312452 | 431 |
| 31 | 3300013102 | Ga0157371_10013441 | Ga0157371_100134414 | 431 |
| 32 | 3300013105 | Ga0157369_10033434 | Ga0157369_100334342 | 431 |
| 33 | 3300013307 | Ga0157372_10039874 | Ga0157372_100398742 | 431 |
| 34 | 3300013307 | Ga0157372_10046203 | Ga0157372_100462034 | 431 |
| 35 | 3300025909 | Ga0207705_10002403 | Ga0207705_100024032 | 431 |
| 36 | 3300025919 | Ga0207657_10005761 | Ga0207657_100057616 | 431 |
| 37 | 3300025920 | Ga0207649_10034910 | Ga0207649_100349102 | 431 |
| 38 | 3300026116 | Ga0207674_10029511 | Ga0207674_100295115 | 431 |
| 39 | 3300005444 | Ga0070694_100040884 | Ga0070694_1000408842 | 432 |
| 40 | 3300006846 | Ga0075430_100068710 | Ga0075430_1000687102 | 432 |
| 41 | 3300006847 | Ga0075431_100004085 | Ga0075431_1000040857 | 432 |
| 42 | 3300006880 | Ga0075429_100002277 | Ga0075429_1000022778 | 432 |
| 43 | 3300006880 | Ga0075429_100040299 | Ga0075429_1000402992 | 432 |
| 44 | 3300050508 | nmdc:mga09592_15640_c1 | nmdc:mga09592_15640_c1_235_1599 | 432 |
| 45 | 3300050508 | nmdc:mga09592_1957_c1 | nmdc:mga09592_1957_c1_13418_14776 | 432 |
| 46 | 3300003771 | Ga0055526_1000487 | Ga0055526_10004878 | 433 |
| 47 | 3300003773 | Ga0055537_1000035 | Ga0055537_100003557 | 433 |
| 48 | 3300003775 | Ga0055524_1005183 | Ga0055524_10051834 | 433 |
| 49 | 3300003784 | Ga0055534_1000325 | Ga0055534_100032519 | 433 |
| 50 | 3300003790 | Ga0055528_1000058 | Ga0055528_100005828 | 433 |
| 51 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009625 | 433 |
| 52 | 3300025273 | Ga0209673_1000036 | Ga0209673_100003658 | 433 |
| 53 | 3300025291 | Ga0209675_1000013 | Ga0209675_100001358 | 433 |
| 54 | 3300025295 | Ga0209564_1000122 | Ga0209564_100012258 | 433 |
| 55 | 3300025299 | Ga0209256_1000106 | Ga0209256_1000106118 | 433 |
| 56 | iso_pu_bacteria | 2821131069 | 2821135508 | 433 |
| 57 | iso_pu_bacteria | 2895427314 | 2895433817 | 433 |
| 58 | 3300003316 | rootH1_10044769 | rootH1_100447693 | 435 |
| 59 | 3300005530 | Ga0070679_100010283 | Ga0070679_1000102832 | 435 |
| 60 | 3300044712 | Ga0453684_0038591 | Ga0453684_0038591_3221_4570 | 435 |
| 61 | 3300046694 | Ga0495649_0041662 | Ga0495649_0041662_1017_2342 | 435 |
| 62 | 3300047445 | Ga0495677_0000451 | Ga0495677_0000451_7225_8547 | 435 |
| 63 | iso_pu_bacteria | 2738541297 | 2738825866 | 435 |
| 64 | iso_pu_bacteria | 2738541357 | 2739149663 | 435 |
| 65 | iso_pu_bacteria | 2738543003 | 2739191582 | 435 |
| 66 | iso_pu_bacteria | 2738543026 | 2739318059 | 435 |
| 67 | iso_pu_bacteria | 2738543029 | 2739336300 | 435 |
| 68 | iso_pu_bacteria | 2808606418 | 2809142852 | 435 |
| 69 | iso_pu_bacteria | 2842711865 | 2842713905 | 435 |
| 70 | iso_pu_bacteria | 2857564685 | 2857566268 | 435 |
| 71 | iso_pu_bacteria | 8047673197 | 8047679089 | 435 |
| 72 | 3300013102 | Ga0157371_10000003 | Ga0157371_10000003443 | 436 |
| 73 | 3300014497 | Ga0182008_10009447 | Ga0182008_100094472 | 436 |
| 74 | 3300031240 | Ga0265320_10009848 | Ga0265320_100098482 | 436 |
| 75 | 3300042876 | Ga0451577_0000012 | Ga0451577_0000012_339145_340518 | 436 |
| 76 | 3300046477 | Ga0495664_0143757 | Ga0495664_0143757_84_1436 | 436 |
| 77 | 3300046558 | Ga0495633_0003289 | Ga0495633_0003289_1141_2490 | 436 |
| 78 | 3300046665 | Ga0495661_0078861 | Ga0495661_0078861_301_1650 | 436 |
| 79 | 3300048924 | Ga0496121_0030178 | Ga0496121_0030178_724_2058 | 436 |
| 80 | 3300048927 | Ga0496124_0097533 | Ga0496124_0097533_844_2187 | 436 |
| 81 | 3300053161 | Ga0500634_0000179 | Ga0500634_0000179_8925_10274 | 436 |
| 82 | iso_pu_bacteria | 2643221556 | 2643800991 | 436 |
| 83 | iso_pu_bacteria | 2643221684 | 2644473359 | 436 |
| 84 | 3300003323 | rootH1_10004943 | rootH1_100049433 | 437 |
| 85 | 3300033179 | Ga0307507_10007393 | Ga0307507_100073939 | 437 |
| 86 | 3300033180 | Ga0307510_10053173 | Ga0307510_100531733 | 437 |
| 87 | 3300046452 | Ga0495617_000139 | Ga0495617_000139_39056_40393 | 437 |
| 88 | 3300046463 | Ga0495653_0000018 | Ga0495653_0000018_87575_88912 | 437 |
| 89 | 3300046492 | Ga0495585_0000418 | Ga0495585_0000418_3667_5004 | 437 |
| 90 | 3300046507 | Ga0495606_0000269 | Ga0495606_0000269_64475_65812 | 437 |
| 91 | 3300046524 | Ga0495648_0003084 | Ga0495648_0003084_13064_14401 | 437 |
| 92 | 3300046530 | Ga0495654_0009991 | Ga0495654_0009991_1944_3281 | 437 |
| 93 | 3300047323 | Ga0495683_0025422 | Ga0495683_0025422_767_2104 | 437 |
| 94 | 3300047469 | Ga0495673_0000120 | Ga0495673_0000120_103824_105161 | 437 |
| 95 | 3300003759 | Ga0055525_1000025 | Ga0055525_100002560 | 438 |
| 96 | 3300003763 | Ga0055529_1000133 | Ga0055529_100013330 | 438 |
| 97 | 3300005564 | Ga0070664_100091397 | Ga0070664_1000913972 | 438 |
| 98 | 3300025230 | Ga0209563_100003 | Ga0209563_100003835 | 438 |
| 99 | 3300025245 | Ga0207425_1000202 | Ga0207425_100020234 | 438 |
| 100 | 3300025253 | Ga0209677_104852 | Ga0209677_1048523 | 438 |
| 101 | 3300025254 | Ga0209148_1000590 | Ga0209148_100059023 | 438 |
| 102 | 3300025272 | Ga0209455_1000063 | Ga0209455_1000063159 | 438 |
| 103 | 3300025294 | Ga0209025_1001180 | Ga0209025_100118024 | 438 |
| 104 | 3300025297 | Ga0209758_1000372 | Ga0209758_100037271 | 438 |
| 105 | 3300025919 | Ga0207657_10010908 | Ga0207657_100109083 | 438 |
| 106 | 3300025945 | Ga0207679_10060464 | Ga0207679_100604642 | 438 |
| 107 | 3300037312 | Ga0395899_0070221 | Ga0395899_0070221_910_2247 | 438 |
| 108 | 3300037418 | Ga0395900_0185206 | Ga0395900_0185206_413_1750 | 438 |
| 109 | 3300037471 | Ga0395905_0135372 | Ga0395905_0135372_132_1469 | 438 |
| 110 | 3300038443 | Ga0395901_0159532 | Ga0395901_0159532_910_2247 | 438 |
| 111 | 3300044658 | Ga0466972_0001798 | Ga0466972_0001798_736_2073 | 438 |
| 112 | 3300044683 | Ga0466965_0006602 | Ga0466965_0006602_1093_2430 | 438 |
| 113 | 3300044683 | Ga0466965_0019858 | Ga0466965_0019858_561_1898 | 438 |
| 114 | 3300044684 | Ga0466966_0019005 | Ga0466966_0019005_1506_2843 | 438 |
| 115 | 3300044684 | Ga0466966_0052762 | Ga0466966_0052762_320_1657 | 438 |
| 116 | 3300044706 | Ga0466964_0001830 | Ga0466964_0001830_3978_5315 | 438 |
| 117 | 3300044735 | Ga0466968_0021696 | Ga0466968_0021696_295_1632 | 438 |
| 118 | 3300044842 | Ga0466957_0003950 | Ga0466957_0003950_6692_8029 | 438 |
| 119 | 3300045049 | Ga0466959_0020684 | Ga0466959_0020684_2384_3721 | 438 |
| 120 | 3300046457 | Ga0495590_0000314 | Ga0495590_0000314_12121_13461 | 438 |
| 121 | 3300046460 | Ga0495638_0000067 | Ga0495638_0000067_1625_2965 | 438 |
| 122 | 3300046460 | Ga0495638_0058219 | Ga0495638_0058219_527_1867 | 438 |
| 123 | 3300046471 | Ga0495650_0000239 | Ga0495650_0000239_10082_11431 | 438 |
| 124 | 3300046471 | Ga0495650_0000305 | Ga0495650_0000305_51156_52496 | 438 |
| 125 | 3300046471 | Ga0495650_0000472 | Ga0495650_0000472_45983_47323 | 438 |
| 126 | 3300046471 | Ga0495650_0002496 | Ga0495650_0002496_11877_13217 | 438 |
| 127 | 3300046471 | Ga0495650_0013594 | Ga0495650_0013594_497_1837 | 438 |
| 128 | 3300046474 | Ga0495605_0000005 | Ga0495605_0000005_194381_195721 | 438 |
| 129 | 3300046474 | Ga0495605_0000117 | Ga0495605_0000117_28499_29836 | 438 |
| 130 | 3300046474 | Ga0495605_0027462 | Ga0495605_0027462_1056_2393 | 438 |
| 131 | 3300046474 | Ga0495605_0028670 | Ga0495605_0028670_260_1609 | 438 |
| 132 | 3300046500 | Ga0495596_0003323 | Ga0495596_0003323_155_1504 | 438 |
| 133 | 3300046500 | Ga0495596_0004822 | Ga0495596_0004822_4391_5728 | 438 |
| 134 | 3300046501 | Ga0495607_0021878 | Ga0495607_0021878_888_2225 | 438 |
| 135 | 3300046506 | Ga0495583_0000160 | Ga0495583_0000160_37988_39325 | 438 |
| 136 | 3300046506 | Ga0495583_0000162 | Ga0495583_0000162_109661_111001 | 438 |
| 137 | 3300046507 | Ga0495606_0000783 | Ga0495606_0000783_34736_36076 | 438 |
| 138 | 3300046507 | Ga0495606_0001207 | Ga0495606_0001207_34791_36131 | 438 |
| 139 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_162338_163678 | 438 |
| 140 | 3300046512 | Ga0495610_0015782 | Ga0495610_0015782_2469_3809 | 438 |
| 141 | 3300046513 | Ga0495616_0026271 | Ga0495616_0026271_921_2258 | 438 |
| 142 | 3300046518 | Ga0495631_0008030 | Ga0495631_0008030_1214_2551 | 438 |
| 143 | 3300046519 | Ga0495632_0011173 | Ga0495632_0011173_1321_2658 | 438 |
| 144 | 3300046520 | Ga0495637_0000057 | Ga0495637_0000057_56569_57909 | 438 |
| 145 | 3300046522 | Ga0495643_0000118 | Ga0495643_0000118_71257_72597 | 438 |
| 146 | 3300046522 | Ga0495643_0000212 | Ga0495643_0000212_14841_16181 | 438 |
| 147 | 3300046522 | Ga0495643_0000263 | Ga0495643_0000263_61178_62515 | 438 |
| 148 | 3300046522 | Ga0495643_0001396 | Ga0495643_0001396_6105_7442 | 438 |
| 149 | 3300046523 | Ga0495644_0014730 | Ga0495644_0014730_791_2128 | 438 |
| 150 | 3300046524 | Ga0495648_0000008 | Ga0495648_0000008_229552_230892 | 438 |
| 151 | 3300046524 | Ga0495648_0012918 | Ga0495648_0012918_2481_3830 | 438 |
| 152 | 3300046528 | Ga0495642_0006502 | Ga0495642_0006502_1547_2887 | 438 |
| 153 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_135621_136961 | 438 |
| 154 | 3300046538 | Ga0495609_0000269 | Ga0495609_0000269_10065_11414 | 438 |
| 155 | 3300046542 | Ga0495597_0000027 | Ga0495597_0000027_54218_55558 | 438 |
| 156 | 3300046542 | Ga0495597_0000917 | Ga0495597_0000917_7098_8438 | 438 |
| 157 | 3300046557 | Ga0495622_0000060 | Ga0495622_0000060_93594_94934 | 438 |
| 158 | 3300046558 | Ga0495633_0000128 | Ga0495633_0000128_57041_58381 | 438 |
| 159 | 3300046558 | Ga0495633_0001536 | Ga0495633_0001536_14713_16053 | 438 |
| 160 | 3300046558 | Ga0495633_0079309 | Ga0495633_0079309_167_1507 | 438 |
| 161 | 3300046558 | Ga0495633_0083155 | Ga0495633_0083155_40_1380 | 438 |
| 162 | 3300046616 | Ga0495668_0000144 | Ga0495668_0000144_8941_10281 | 438 |
| 163 | 3300046616 | Ga0495668_0001247 | Ga0495668_0001247_11466_12806 | 438 |
| 164 | 3300046616 | Ga0495668_0002800 | Ga0495668_0002800_6508_7848 | 438 |
| 165 | 3300046616 | Ga0495668_0082152 | Ga0495668_0082152_415_1752 | 438 |
| 166 | 3300046660 | Ga0495625_0000192 | Ga0495625_0000192_94185_95525 | 438 |
| 167 | 3300046660 | Ga0495625_0003424 | Ga0495625_0003424_7628_8968 | 438 |
| 168 | 3300046665 | Ga0495661_0000872 | Ga0495661_0000872_1402_2739 | 438 |
| 169 | 3300046691 | Ga0495670_0045592 | Ga0495670_0045592_472_1812 | 438 |
| 170 | 3300046692 | Ga0495671_0000024 | Ga0495671_0000024_32998_34338 | 438 |
| 171 | 3300046694 | Ga0495649_0000715 | Ga0495649_0000715_10475_11812 | 438 |
| 172 | 3300046694 | Ga0495649_0002538 | Ga0495649_0002538_2806_4146 | 438 |
| 173 | 3300046794 | Ga0495589_0000974 | Ga0495589_0000974_2304_3641 | 438 |
| 174 | 3300046794 | Ga0495589_0026299 | Ga0495589_0026299_1359_2708 | 438 |
| 175 | 3300046794 | Ga0495589_0061067 | Ga0495589_0061067_391_1728 | 438 |
| 176 | 3300046810 | Ga0495660_0000054 | Ga0495660_0000054_13734_15071 | 438 |
| 177 | 3300046810 | Ga0495660_0034429 | Ga0495660_0034429_604_1944 | 438 |
| 178 | 3300046810 | Ga0495660_0072915 | Ga0495660_0072915_406_1746 | 438 |
| 179 | 3300047320 | Ga0495672_0000253 | Ga0495672_0000253_54497_55837 | 438 |
| 180 | 3300047320 | Ga0495672_0001329 | Ga0495672_0001329_15657_16994 | 438 |
| 181 | 3300047320 | Ga0495672_0002190 | Ga0495672_0002190_10046_11395 | 438 |
| 182 | 3300047323 | Ga0495683_0004438 | Ga0495683_0004438_3893_5242 | 438 |
| 183 | 3300047323 | Ga0495683_0010058 | Ga0495683_0010058_1122_2459 | 438 |
| 184 | 3300047443 | Ga0495687_000287 | Ga0495687_000287_9924_11261 | 438 |
| 185 | 3300047443 | Ga0495687_000358 | Ga0495687_000358_36191_37531 | 438 |
| 186 | 3300047443 | Ga0495687_000412 | Ga0495687_000412_24775_26115 | 438 |
| 187 | 3300047445 | Ga0495677_0000779 | Ga0495677_0000779_2249_3586 | 438 |
| 188 | 3300047446 | Ga0495679_007559 | Ga0495679_007559_1284_2621 | 438 |
| 189 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_152754_154094 | 438 |
| 190 | 3300047470 | Ga0495681_0011640 | Ga0495681_0011640_545_1882 | 438 |
| 191 | 3300047472 | Ga0495686_0000054 | Ga0495686_0000054_211332_212669 | 438 |
| 192 | 3300047472 | Ga0495686_0009746 | Ga0495686_0009746_1994_3334 | 438 |
| 193 | 3300048091 | Ga0495626_0000800 | Ga0495626_0000800_7541_8878 | 438 |
| 194 | 3300048091 | Ga0495626_0008085 | Ga0495626_0008085_3850_5187 | 438 |
| 195 | 3300048091 | Ga0495626_0016619 | Ga0495626_0016619_478_1815 | 438 |
| 196 | 3300048091 | Ga0495626_0018630 | Ga0495626_0018630_611_1948 | 438 |
| 197 | 3300048091 | Ga0495626_0038432 | Ga0495626_0038432_111_1448 | 438 |
| 198 | 3300048925 | Ga0496122_0046284 | Ga0496122_0046284_733_2073 | 438 |
| 199 | 3300048925 | Ga0496122_0076329 | Ga0496122_0076329_819_2156 | 438 |
| 200 | 3300048926 | Ga0496123_0001793 | Ga0496123_0001793_22799_24136 | 438 |
| 201 | 3300048926 | Ga0496123_0002950 | Ga0496123_0002950_15845_17185 | 438 |
| 202 | 3300048927 | Ga0496124_0090698 | Ga0496124_0090698_972_2309 | 438 |
| 203 | 3300048927 | Ga0496124_0184131 | Ga0496124_0184131_211_1548 | 438 |
| 204 | 3300048927 | Ga0496124_0220577 | Ga0496124_0220577_40_1380 | 438 |
| 205 | 3300049459 | Ga0495678_000154 | Ga0495678_000154_8819_10159 | 438 |
| 206 | 3300053118 | Ga0500594_0002809 | Ga0500594_0002809_2417_3757 | 438 |
| 207 | 3300053125 | Ga0500618_000284 | Ga0500618_000284_27816_29156 | 438 |
| 208 | 3300053145 | Ga0500586_000057 | Ga0500586_000057_10075_11415 | 438 |
| 209 | 3300005329 | Ga0070683_100010242 | Ga0070683_1000102423 | 439 |
| 210 | 3300005535 | Ga0070684_100039817 | Ga0070684_1000398172 | 439 |
| 211 | 3300025944 | Ga0207661_10015667 | Ga0207661_100156671 | 439 |
| 212 | 3300031838 | Ga0307518_10028309 | Ga0307518_100283094 | 439 |
| 213 | 3300046665 | Ga0495661_0058750 | Ga0495661_0058750_433_1773 | 439 |
| 214 | 3300046674 | Ga0495588_0000089 | Ga0495588_0000089_105329_106669 | 439 |
| 215 | 3300048924 | Ga0496121_0104169 | Ga0496121_0104169_680_2020 | 439 |
| 216 | 3300049570 | Ga0501033_0008365 | Ga0501033_0008365_6016_7356 | 440 |
| 217 | 3300049823 | Ga0501044_0001832 | Ga0501044_0001832_3607_4947 | 440 |
| 218 | iso_pu_bacteria | 2675903059 | 2676481948 | 440 |
| 219 | 3300003322 | rootL2_10106560 | rootL2_101065602 | 442 |
| 220 | 3300048927 | Ga0496124_0131746 | Ga0496124_0131746_373_1776 | 442 |
| 221 | 3300037418 | Ga0395900_0000324 | Ga0395900_0000324_31609_33006 | 443 |
| 222 | 3300038443 | Ga0395901_0000089 | Ga0395901_0000089_91787_93184 | 443 |
| 223 | 3300042005 | Ga0439448_0000868 | Ga0439448_0000868_2759_4171 | 443 |
| 224 | 3300042012 | Ga0439455_0001890 | Ga0439455_0001890_136_1548 | 443 |
| 225 | 3300044706 | Ga0466964_0001817 | Ga0466964_0001817_4646_6058 | 443 |
| 226 | 3300045976 | Ga0466967_0009040 | Ga0466967_0009040_1138_2550 | 443 |
| 227 | 3300045976 | Ga0466967_0064223 | Ga0466967_0064223_1740_3176 | 443 |
| 228 | 3300046474 | Ga0495605_0011372 | Ga0495605_0011372_3003_4442 | 443 |
| 229 | 3300046491 | Ga0495584_0005832 | Ga0495584_0005832_3260_4699 | 443 |
| 230 | 3300046501 | Ga0495607_0018097 | Ga0495607_0018097_11_1687 | 443 |
| 231 | 3300046513 | Ga0495616_0013425 | Ga0495616_0013425_355_1794 | 443 |
| 232 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_246164_247603 | 443 |
| 233 | 3300046665 | Ga0495661_0000663 | Ga0495661_0000663_29799_31238 | 443 |
| 234 | 3300046794 | Ga0495589_0000027 | Ga0495589_0000027_3435_4874 | 443 |
| 235 | 3300047443 | Ga0495687_000019 | Ga0495687_000019_246164_247603 | 443 |
| 236 | 3300047445 | Ga0495677_0000020 | Ga0495677_0000020_75364_76803 | 443 |
| 237 | 3300048091 | Ga0495626_0001889 | Ga0495626_0001889_12564_14003 | 443 |
| 238 | 3300048909 | Ga0496106_0001057 | Ga0496106_0001057_8671_10059 | 443 |
| 239 | 3300048913 | Ga0496110_0170806 | Ga0496110_0170806_502_1872 | 443 |
| 240 | 3300048916 | Ga0496113_0001957 | Ga0496113_0001957_1053_2489 | 443 |
| 241 | 3300049822 | Ga0501035_0002652 | Ga0501035_0002652_1898_3295 | 443 |
| 242 | 3300046491 | Ga0495584_0000186 | Ga0495584_0000186_16038_17426 | 444 |
| 243 | 3300046507 | Ga0495606_0003466 | Ga0495606_0003466_8727_10115 | 444 |
| 244 | 3300047443 | Ga0495687_000023 | Ga0495687_000023_298993_300381 | 444 |
| 245 | 3300005329 | Ga0070683_100007980 | Ga0070683_1000079807 | 445 |
| 246 | 3300005334 | Ga0068869_100002123 | Ga0068869_1000021232 | 445 |
| 247 | 3300005338 | Ga0068868_100010999 | Ga0068868_1000109993 | 445 |
| 248 | 3300005345 | Ga0070692_10012284 | Ga0070692_100122842 | 445 |
| 249 | 3300005354 | Ga0070675_100000500 | Ga0070675_1000005003 | 445 |
| 250 | 3300005366 | Ga0070659_100042397 | Ga0070659_1000423972 | 445 |
| 251 | 3300005455 | Ga0070663_100011692 | Ga0070663_1000116924 | 445 |
| 252 | 3300005535 | Ga0070684_100027367 | Ga0070684_1000273674 | 445 |
| 253 | 3300005564 | Ga0070664_100000986 | Ga0070664_10000098620 | 445 |
| 254 | 3300005577 | Ga0068857_100001211 | Ga0068857_1000012116 | 445 |
| 255 | 3300005614 | Ga0068856_100069747 | Ga0068856_1000697472 | 445 |
| 256 | 3300005615 | Ga0070702_100007666 | Ga0070702_1000076662 | 445 |
| 257 | 3300005844 | Ga0068862_100183893 | Ga0068862_1001838931 | 445 |
| 258 | 3300006881 | Ga0068865_100035342 | Ga0068865_1000353422 | 445 |
| 259 | 3300009094 | Ga0111539_10001734 | Ga0111539_1000173413 | 445 |
| 260 | 3300009098 | Ga0105245_10001884 | Ga0105245_100018845 | 445 |
| 261 | 3300025926 | Ga0207659_10013895 | Ga0207659_100138954 | 445 |
| 262 | 3300025927 | Ga0207687_10007814 | Ga0207687_100078143 | 445 |
| 263 | 3300025932 | Ga0207690_10044452 | Ga0207690_100444522 | 445 |
| 264 | 3300025938 | Ga0207704_10034889 | Ga0207704_100348892 | 445 |
| 265 | 3300025942 | Ga0207689_10022071 | Ga0207689_100220712 | 445 |
| 266 | 3300025944 | Ga0207661_10040245 | Ga0207661_100402452 | 445 |
| 267 | 3300025945 | Ga0207679_10034266 | Ga0207679_100342662 | 445 |
| 268 | 3300026067 | Ga0207678_10022373 | Ga0207678_100223732 | 445 |
| 269 | 3300026075 | Ga0207708_10003232 | Ga0207708_100032326 | 445 |
| 270 | 3300026116 | Ga0207674_10003876 | Ga0207674_1000387615 | 445 |
| 271 | 3300026142 | Ga0207698_10073646 | Ga0207698_100736462 | 445 |
| 272 | 3300027907 | Ga0207428_10013648 | Ga0207428_100136483 | 445 |
| 273 | 3300028380 | Ga0268265_10083036 | Ga0268265_100830362 | 445 |
| 274 | 3300031995 | Ga0307409_100079780 | Ga0307409_1000797802 | 445 |
| 275 | 3300050511 | nmdc:mga08y16_1631_c1 | nmdc:mga08y16_1631_c1_10483_11844 | 445 |
| 276 | 3300031649 | Ga0307514_10063459 | Ga0307514_100634593 | 447 |
| 277 | 3300044683 | Ga0466965_0008661 | Ga0466965_0008661_713_2077 | 448 |
| 278 | 3300005329 | Ga0070683_100007512 | Ga0070683_1000075128 | 449 |
| 279 | 3300005344 | Ga0070661_100049817 | Ga0070661_1000498173 | 449 |
| 280 | 3300005345 | Ga0070692_10014463 | Ga0070692_100144632 | 449 |
| 281 | 3300005347 | Ga0070668_100088582 | Ga0070668_1000885822 | 449 |
| 282 | 3300005354 | Ga0070675_100003832 | Ga0070675_1000038326 | 449 |
| 283 | 3300005366 | Ga0070659_100001502 | Ga0070659_1000015026 | 449 |
| 284 | 3300005455 | Ga0070663_100038366 | Ga0070663_1000383662 | 449 |
| 285 | 3300005535 | Ga0070684_100009947 | Ga0070684_1000099473 | 449 |
| 286 | 3300005564 | Ga0070664_100001017 | Ga0070664_1000010178 | 449 |
| 287 | 3300005615 | Ga0070702_100028520 | Ga0070702_1000285202 | 449 |
| 288 | 3300005616 | Ga0068852_100037469 | Ga0068852_1000374693 | 449 |
| 289 | 3300005842 | Ga0068858_100140953 | Ga0068858_1001409533 | 449 |
| 290 | 3300005844 | Ga0068862_100003795 | Ga0068862_1000037959 | 449 |
| 291 | 3300009094 | Ga0111539_10002939 | Ga0111539_100029399 | 449 |
| 292 | 3300009098 | Ga0105245_10006225 | Ga0105245_100062256 | 449 |
| 293 | 3300010375 | Ga0105239_10059327 | Ga0105239_100593273 | 449 |
| 294 | 3300013308 | Ga0157375_10056496 | Ga0157375_100564962 | 449 |
| 295 | 3300014745 | Ga0157377_10007093 | Ga0157377_100070933 | 449 |
| 296 | 3300021388 | Ga0213875_10000499 | Ga0213875_1000049920 | 449 |
| 297 | 3300025926 | Ga0207659_10001668 | Ga0207659_100016687 | 449 |
| 298 | 3300025933 | Ga0207706_10004525 | Ga0207706_100045259 | 449 |
| 299 | 3300025944 | Ga0207661_10042483 | Ga0207661_100424832 | 449 |
| 300 | 3300025972 | Ga0207668_10078930 | Ga0207668_100789302 | 449 |
| 301 | 3300026023 | Ga0207677_10009501 | Ga0207677_100095012 | 449 |
| 302 | 3300026035 | Ga0207703_10111408 | Ga0207703_101114083 | 449 |
| 303 | 3300026067 | Ga0207678_10010910 | Ga0207678_100109106 | 449 |
| 304 | 3300026121 | Ga0207683_10077049 | Ga0207683_100770492 | 449 |
| 305 | 3300028380 | Ga0268265_10003188 | Ga0268265_100031884 | 449 |
| 306 | 3300037853 | Ga0436364_1386442 | Ga0436364_1386442_25670_27079 | 449 |
| 307 | 3300050511 | nmdc:mga08y16_73832_c1 | nmdc:mga08y16_73832_c1_789_2162 | 449 |
| 308 | 3300005985 | Ga0081539_10000128 | Ga0081539_1000012814 | 451 |
| 309 | 3300048905 | Ga0496102_0161297 | Ga0496102_0161297_178_1545 | 451 |
| 310 | 3300048917 | Ga0496114_0031403 | Ga0496114_0031403_1172_2539 | 451 |
| 311 | iso_pu_bacteria | 2997600082 | 2997607995 | 451 |
| 312 | iso_pu_bacteria | 2751185734 | 2753071236 | 452 |
| 313 | iso_pu_bacteria | 2870721527 | 2870721961 | 452 |
| 314 | iso_pu_bacteria | 8047710418 | 8047712707 | 452 |
| 315 | 3300031665 | Ga0316575_10000010 | Ga0316575_1000001013 | 453 |
| 316 | 3300046454 | Ga0495592_0002377 | Ga0495592_0002377_3658_5082 | 453 |
| 317 | 3300046462 | Ga0495651_0001434 | Ga0495651_0001434_8206_9630 | 453 |
| 318 | 3300046463 | Ga0495653_0024485 | Ga0495653_0024485_2964_4388 | 453 |
| 319 | 3300046476 | Ga0495662_0000316 | Ga0495662_0000316_9322_10746 | 453 |
| 320 | 3300046477 | Ga0495664_0001280 | Ga0495664_0001280_3385_4809 | 453 |
| 321 | 3300046511 | Ga0495608_0001532 | Ga0495608_0001532_14597_16021 | 453 |
| 322 | 3300046516 | Ga0495628_0004838 | Ga0495628_0004838_6307_7731 | 453 |
| 323 | 3300046526 | Ga0495666_0001077 | Ga0495666_0001077_10044_11468 | 453 |
| 324 | 3300046531 | Ga0495665_0000346 | Ga0495665_0000346_15070_16494 | 453 |
| 325 | 3300046533 | Ga0495640_0008329 | Ga0495640_0008329_1431_2855 | 453 |
| 326 | 3300046535 | Ga0495586_0011130 | Ga0495586_0011130_1431_2855 | 453 |
| 327 | 3300046543 | Ga0495645_0002377 | Ga0495645_0002377_1206_2630 | 453 |
| 328 | 3300046559 | Ga0495667_0001088 | Ga0495667_0001088_10898_12322 | 453 |
| 329 | 3300046642 | Ga0495634_0038089 | Ga0495634_0038089_1538_2962 | 453 |
| 330 | 3300046663 | Ga0495635_0010158 | Ga0495635_0010158_2835_4259 | 453 |
| 331 | 3300046675 | Ga0495657_0005278 | Ga0495657_0005278_318_1742 | 453 |
| 332 | 3300046678 | Ga0495599_0002673 | Ga0495599_0002673_776_2200 | 453 |
| 333 | 3300046679 | Ga0495623_0039407 | Ga0495623_0039407_476_1900 | 453 |
| 334 | 3300046680 | Ga0495646_0002071 | Ga0495646_0002071_3581_5005 | 453 |
| 335 | 3300046809 | Ga0495600_0012846 | Ga0495600_0012846_2578_4002 | 453 |
| 336 | 3300047315 | Ga0495581_0005609 | Ga0495581_0005609_1275_2699 | 453 |
| 337 | 3300047317 | Ga0495604_0001376 | Ga0495604_0001376_10145_11569 | 453 |
| 338 | 3300047319 | Ga0495674_0031949 | Ga0495674_0031949_776_2200 | 453 |
| 339 | 3300047444 | Ga0495675_0025269 | Ga0495675_0025269_1244_2668 | 453 |
| 340 | 3300047471 | Ga0495684_0013971 | Ga0495684_0013971_2196_3620 | 453 |
| 341 | 3300053077 | Ga0495601_0035036 | Ga0495601_0035036_1416_2840 | 453 |
| 342 | 3300053085 | Ga0495619_0031433 | Ga0495619_0031433_18_1442 | 453 |
| 343 | 3300005434 | Ga0070709_10030767 | Ga0070709_100307674 | 454 |
| 344 | 3300005435 | Ga0070714_100007850 | Ga0070714_1000078507 | 454 |
| 345 | 3300005437 | Ga0070710_10001747 | Ga0070710_100017476 | 454 |
| 346 | 3300025898 | Ga0207692_10001543 | Ga0207692_100015435 | 454 |
| 347 | 3300025906 | Ga0207699_10085472 | Ga0207699_100854722 | 454 |
| 348 | 3300044694 | Ga0466963_0006646 | Ga0466963_0006646_1973_3412 | 454 |
| 349 | 3300005437 | Ga0070710_10008929 | Ga0070710_100089294 | 455 |
| 350 | 3300006844 | Ga0075428_100008826 | Ga0075428_1000088266 | 455 |
| 351 | 3300006846 | Ga0075430_100025090 | Ga0075430_1000250902 | 455 |
| 352 | 3300006847 | Ga0075431_100032957 | Ga0075431_1000329572 | 455 |
| 353 | 3300006880 | Ga0075429_100027382 | Ga0075429_1000273825 | 455 |
| 354 | 3300009147 | Ga0114129_10044528 | Ga0114129_100445282 | 455 |
| 355 | 3300025898 | Ga0207692_10084359 | Ga0207692_100843592 | 455 |
| 356 | 3300025928 | Ga0207700_10046870 | Ga0207700_100468702 | 455 |
| 357 | 3300050507 | nmdc:mga05p37_21243_c1 | nmdc:mga05p37_21243_c1_1151_2578 | 455 |
| 358 | 3300050508 | nmdc:mga09592_39874_c1 | nmdc:mga09592_39874_c1_2080_3507 | 455 |
| 359 | 3300050510 | nmdc:mga06r32_4692_c1 | nmdc:mga06r32_4692_c1_10593_12020 | 455 |
| 360 | iso_pu_bacteria | 2946003308 | 2946005813 | 455 |
| 361 | 3300005329 | Ga0070683_100000951 | Ga0070683_1000009513 | 456 |
| 362 | 3300005564 | Ga0070664_100011712 | Ga0070664_1000117123 | 456 |
| 363 | 3300025944 | Ga0207661_10003256 | Ga0207661_100032568 | 456 |
| 364 | 3300025945 | Ga0207679_10003806 | Ga0207679_100038064 | 456 |
| 365 | iso_pu_bacteria | 2808606700 | 2810362853 | 456 |
| 366 | iso_pu_bacteria | 2873151551 | 2873156316 | 456 |
| 367 | iso_pu_bacteria | 2905926851 | 2905929494 | 456 |
| 368 | 3300031824 | Ga0307413_10054688 | Ga0307413_100546882 | 457 |
| 369 | 3300046459 | Ga0495629_0010634 | Ga0495629_0010634_3306_4715 | 457 |
| 370 | iso_pu_bacteria | 3006493962 | 3006496350 | 457 |
| 371 | 3300025303 | Ga0209051_1017704 | Ga0209051_10177043 | 458 |
| 372 | 3300031824 | Ga0307413_10005800 | Ga0307413_100058003 | 458 |
| 373 | 3300053085 | Ga0495619_0035818 | Ga0495619_0035818_437_1849 | 458 |
| 374 | iso_pu_bacteria | 2912723979 | 2912724814 | 458 |
| 375 | 3300049570 | Ga0501033_0051945 | Ga0501033_0051945_164_1582 | 459 |
| 376 | 3300049573 | Ga0501037_0152417 | Ga0501037_0152417_116_1534 | 459 |
| 377 | 3300049578 | Ga0501042_0110097 | Ga0501042_0110097_207_1625 | 459 |
| 378 | 3300049579 | Ga0501043_0042827 | Ga0501043_0042827_288_1706 | 459 |
| 379 | 3300049580 | Ga0501046_0132310 | Ga0501046_0132310_270_1688 | 459 |
| 380 | 3300049581 | Ga0501047_0241337 | Ga0501047_0241337_148_1566 | 459 |
| 381 | 3300049582 | Ga0501048_0042396 | Ga0501048_0042396_1571_2989 | 459 |
| 382 | 3300049822 | Ga0501035_0005722 | Ga0501035_0005722_6958_8376 | 459 |
| 383 | 3300049823 | Ga0501044_0039888 | Ga0501044_0039888_506_1924 | 459 |
| 384 | iso_pu_bacteria | 2622736626 | 2623587463 | 459 |
| 385 | iso_pu_bacteria | 2811994879 | 2812358756 | 459 |
| 386 | iso_pu_bacteria | 2852635781 | 2852641953 | 459 |
| 387 | iso_pu_bacteria | 2862281513 | 2862287885 | 459 |
| 388 | iso_pu_bacteria | 2912715099 | 2912720649 | 459 |
| 389 | iso_pu_bacteria | 2946064051 | 2946067121 | 459 |
| 390 | iso_pu_bacteria | 2947224130 | 2947230117 | 459 |
| 391 | 3300046455 | Ga0495603_0001268 | Ga0495603_0001268_1761_3179 | 460 |
| 392 | 3300046459 | Ga0495629_0010442 | Ga0495629_0010442_1997_3415 | 460 |
| 393 | 3300046475 | Ga0495639_0015258 | Ga0495639_0015258_56_1474 | 460 |
| 394 | 3300046559 | Ga0495667_0057688 | Ga0495667_0057688_422_1879 | 460 |
| 395 | iso_pu_bacteria | 2547132111 | 2547407018 | 460 |
| 396 | iso_pu_bacteria | 2582581314 | 2585319736 | 460 |
| 397 | iso_pu_bacteria | 2616644814 | 2616697600 | 460 |
| 398 | iso_pu_bacteria | 2772190715 | 2772643850 | 460 |
| 399 | iso_pu_bacteria | 2784132148 | 2784588057 | 460 |
| 400 | iso_pu_bacteria | 2784746763 | 2785344002 | 460 |
| 401 | iso_pu_bacteria | 2808606448 | 2809231657 | 460 |
| 402 | iso_pu_bacteria | 2855670206 | 2855672832 | 460 |
| 403 | iso_pu_bacteria | 2855676851 | 2855677292 | 460 |
| 404 | iso_pu_bacteria | 2857288857 | 2857294835 | 460 |
| 405 | iso_pu_bacteria | 2858848962 | 2858855470 | 460 |
| 406 | iso_pu_bacteria | 2858882152 | 2858885443 | 460 |
| 407 | iso_pu_bacteria | 2858888857 | 2858892239 | 460 |
| 408 | iso_pu_bacteria | 2858895516 | 2858902072 | 460 |
| 409 | iso_pu_bacteria | 2862382967 | 2862392899 | 460 |
| 410 | iso_pu_bacteria | 2863404153 | 2863405292 | 460 |
| 411 | iso_pu_bacteria | 2869048445 | 2869055193 | 460 |
| 412 | iso_pu_bacteria | 2869061728 | 2869062895 | 460 |
| 413 | iso_pu_bacteria | 2869068681 | 2869072509 | 460 |
| 414 | iso_pu_bacteria | 2880489317 | 2880492765 | 460 |
| 415 | iso_pu_bacteria | 2880495981 | 2880499549 | 460 |
| 416 | iso_pu_bacteria | 2929226422 | 2929228140 | 460 |
| 417 | iso_pu_bacteria | 2990059506 | 2990065560 | 460 |
| 418 | iso_pu_bacteria | 8003870546 | 8003875351 | 460 |
| 419 | iso_pu_bacteria | 8008558824 | 8008559786 | 460 |
| 420 | iso_pu_bacteria | 8023623736 | 8023631057 | 460 |
| 421 | iso_pu_bacteria | 8048406513 | 8048413303 | 460 |
| 422 | iso_pu_bacteria | 8054704163 | 8054705988 | 460 |
| 423 | iso_pu_bacteria | 8054727385 | 8054732188 | 460 |
| 424 | iso_pu_bacteria | 8054734606 | 8054740939 | 460 |
| 425 | 3300005618 | Ga0068864_100029219 | Ga0068864_1000292195 | 461 |
| 426 | 3300005841 | Ga0068863_100055968 | Ga0068863_1000559683 | 461 |
| 427 | 3300005842 | Ga0068858_100048426 | Ga0068858_1000484262 | 461 |
| 428 | 3300006844 | Ga0075428_100000249 | Ga0075428_10000024929 | 461 |
| 429 | 3300006846 | Ga0075430_100013782 | Ga0075430_1000137823 | 461 |
| 430 | 3300006847 | Ga0075431_100012731 | Ga0075431_1000127314 | 461 |
| 431 | 3300006880 | Ga0075429_100014279 | Ga0075429_1000142793 | 461 |
| 432 | 3300009147 | Ga0114129_10000352 | Ga0114129_1000035228 | 461 |
| 433 | 3300014325 | Ga0163163_10002454 | Ga0163163_100024547 | 461 |
| 434 | 3300014968 | Ga0157379_10152151 | Ga0157379_101521512 | 461 |
| 435 | 3300025906 | Ga0207699_10082168 | Ga0207699_100821682 | 461 |
| 436 | 3300025932 | Ga0207690_10134550 | Ga0207690_101345502 | 461 |
| 437 | 3300025941 | Ga0207711_10036486 | Ga0207711_100364862 | 461 |
| 438 | 3300026095 | Ga0207676_10088794 | Ga0207676_100887942 | 461 |
| 439 | 3300026116 | Ga0207674_10118652 | Ga0207674_101186522 | 461 |
| 440 | 3300044656 | Ga0466969_0071787 | Ga0466969_0071787_22_1455 | 461 |
| 441 | 3300044658 | Ga0466972_0001015 | Ga0466972_0001015_1315_2748 | 461 |
| 442 | 3300044683 | Ga0466965_0098090 | Ga0466965_0098090_38_1471 | 461 |
| 443 | 3300044684 | Ga0466966_0045675 | Ga0466966_0045675_33_1466 | 461 |
| 444 | 3300044719 | Ga0466971_0010922 | Ga0466971_0010922_1094_2527 | 461 |
| 445 | 3300044735 | Ga0466968_0017129 | Ga0466968_0017129_1441_2874 | 461 |
| 446 | 3300044765 | Ga0466970_0001976 | Ga0466970_0001976_3552_5021 | 461 |
| 447 | 3300048907 | Ga0496104_0031219 | Ga0496104_0031219_394_1905 | 461 |
| 448 | 3300048911 | Ga0496108_0008291 | Ga0496108_0008291_3703_5214 | 461 |
| 449 | 3300048912 | Ga0496109_0005868 | Ga0496109_0005868_2419_3930 | 461 |
| 450 | 3300048913 | Ga0496110_0016585 | Ga0496110_0016585_3578_5089 | 461 |
| 451 | 3300048914 | Ga0496111_0030388 | Ga0496111_0030388_1913_3424 | 461 |
| 452 | 3300048915 | Ga0496112_0012152 | Ga0496112_0012152_3210_4721 | 461 |
| 453 | 3300048916 | Ga0496113_0002354 | Ga0496113_0002354_5707_7218 | 461 |
| 454 | 3300050507 | nmdc:mga05p37_24_c1 | nmdc:mga05p37_24_c1_26512_27918 | 461 |
| 455 | 3300050508 | nmdc:mga09592_149_c1 | nmdc:mga09592_149_c1_23811_25217 | 461 |
| 456 | 3300050509 | nmdc:mga0qj67_57_c2 | nmdc:mga0qj67_57_c2_31076_32482 | 461 |
| 457 | 3300050510 | nmdc:mga06r32_22_c1 | nmdc:mga06r32_22_c1_22353_23759 | 461 |
| 458 | 3300061719 | Ga0466962_0044305 | Ga0466962_0044305_261_1694 | 461 |
| 459 | iso_pu_bacteria | 2501939600 | 2501945714 | 461 |
| 460 | iso_pu_bacteria | 2818991463 | 2819693485 | 461 |
| 461 | iso_pu_bacteria | 2831935698 | 2831938577 | 461 |
| 462 | iso_pu_bacteria | 2855683550 | 2855688159 | 461 |
| 463 | iso_pu_bacteria | 2856858025 | 2856861330 | 461 |
| 464 | iso_pu_bacteria | 2858868258 | 2858875598 | 461 |
| 465 | iso_pu_bacteria | 2867302475 | 2867305814 | 461 |
| 466 | iso_pu_bacteria | 2902582711 | 2902587741 | 461 |
| 467 | iso_pu_bacteria | 2929219909 | 2929221512 | 461 |
| 468 | iso_pu_bacteria | 2966598605 | 2966603102 | 461 |
| 469 | iso_pu_bacteria | 3006425503 | 3006426753 | 461 |
| 470 | iso_pu_bacteria | 649633069 | 649812084 | 461 |
| 471 | iso_pu_bacteria | 8003830390 | 8003830840 | 461 |
| 472 | 3300005618 | Ga0068864_100077496 | Ga0068864_1000774961 | 462 |
| 473 | 3300009148 | Ga0105243_10124359 | Ga0105243_101243591 | 462 |
| 474 | 3300015688 | Ga0183367_1006 | Ga0183367_1006244 | 462 |
| 475 | 3300028786 | Ga0307517_10008362 | Ga0307517_100083627 | 462 |
| 476 | 3300028794 | Ga0307515_10008666 | Ga0307515_1000866618 | 462 |
| 477 | 3300030521 | Ga0307511_10001845 | Ga0307511_1000184517 | 462 |
| 478 | 3300031456 | Ga0307513_10020885 | Ga0307513_100208857 | 462 |
| 479 | 3300031507 | Ga0307509_10009951 | Ga0307509_100099512 | 462 |
| 480 | 3300031507 | Ga0307509_10011427 | Ga0307509_100114273 | 462 |
| 481 | 3300033179 | Ga0307507_10016591 | Ga0307507_100165913 | 462 |
| 482 | 3300037466 | Ga0395898_0051003 | Ga0395898_0051003_2512_3948 | 462 |
| 483 | 3300041404 | Ga0439436_0000330 | Ga0439436_0000330_9297_10733 | 462 |
| 484 | 3300041406 | Ga0439439_0012517 | Ga0439439_0012517_231_1667 | 462 |
| 485 | 3300042007 | Ga0439449_0000183 | Ga0439449_0000183_13523_14959 | 462 |
| 486 | 3300042014 | Ga0439457_000664 | Ga0439457_000664_3033_4469 | 462 |
| 487 | 3300044656 | Ga0466969_0005538 | Ga0466969_0005538_4366_5802 | 462 |
| 488 | 3300044683 | Ga0466965_0001465 | Ga0466965_0001465_6507_7943 | 462 |
| 489 | 3300044684 | Ga0466966_0003922 | Ga0466966_0003922_8271_9707 | 462 |
| 490 | 3300044693 | Ga0466961_0014839 | Ga0466961_0014839_2592_4028 | 462 |
| 491 | 3300044694 | Ga0466963_0091633 | Ga0466963_0091633_256_1692 | 462 |
| 492 | 3300044706 | Ga0466964_0062452 | Ga0466964_0062452_49_1485 | 462 |
| 493 | 3300044719 | Ga0466971_0032906 | Ga0466971_0032906_740_2176 | 462 |
| 494 | 3300044842 | Ga0466957_0003544 | Ga0466957_0003544_3350_4786 | 462 |
| 495 | 3300045049 | Ga0466959_0111052 | Ga0466959_0111052_486_1922 | 462 |
| 496 | 3300045836 | Ga0466958_0022637 | Ga0466958_0022637_89_1525 | 462 |
| 497 | 3300046459 | Ga0495629_0007808 | Ga0495629_0007808_1128_2555 | 462 |
| 498 | 3300046459 | Ga0495629_0017542 | Ga0495629_0017542_1685_3112 | 462 |
| 499 | 3300046514 | Ga0495618_0035076 | Ga0495618_0035076_856_2283 | 462 |
| 500 | 3300046516 | Ga0495628_0011400 | Ga0495628_0011400_6051_7478 | 462 |
| 501 | 3300046529 | Ga0495652_0057679 | Ga0495652_0057679_1847_3274 | 462 |
| 502 | 3300046642 | Ga0495634_0004825 | Ga0495634_0004825_4787_6214 | 462 |
| 503 | 3300046660 | Ga0495625_0011290 | Ga0495625_0011290_1996_3423 | 462 |
| 504 | 3300046663 | Ga0495635_0000558 | Ga0495635_0000558_18_1445 | 462 |
| 505 | 3300046675 | Ga0495657_0011223 | Ga0495657_0011223_4956_6383 | 462 |
| 506 | 3300046680 | Ga0495646_0075470 | Ga0495646_0075470_468_1895 | 462 |
| 507 | 3300046689 | Ga0495613_0022476 | Ga0495613_0022476_2012_3439 | 462 |
| 508 | 3300046692 | Ga0495671_0005439 | Ga0495671_0005439_4080_5507 | 462 |
| 509 | 3300047317 | Ga0495604_0002526 | Ga0495604_0002526_4888_6315 | 462 |
| 510 | 3300047321 | Ga0495676_0032458 | Ga0495676_0032458_1998_3425 | 462 |
| 511 | 3300047443 | Ga0495687_019705 | Ga0495687_019705_1830_3257 | 462 |
| 512 | 3300047470 | Ga0495681_0000354 | Ga0495681_0000354_24136_25563 | 462 |
| 513 | 3300047673 | Ga0495593_0002940 | Ga0495593_0002940_91_1518 | 462 |
| 514 | 3300048089 | Ga0495614_0008179 | Ga0495614_0008179_987_2414 | 462 |
| 515 | 3300053092 | Ga0500583_0044263 | Ga0500583_0044263_248_1672 | 462 |
| 516 | 3300053107 | Ga0500560_001901 | Ga0500560_001901_1950_3377 | 462 |
| 517 | 3300061719 | Ga0466962_0030309 | Ga0466962_0030309_639_2075 | 462 |
| 518 | iso_pu_bacteria | 2582581312 | 2585299941 | 462 |
| 519 | 3300009098 | Ga0105245_10045501 | Ga0105245_100455012 | 463 |
| 520 | 3300025927 | Ga0207687_10019413 | Ga0207687_100194134 | 463 |
| 521 | 3300025935 | Ga0207709_10063270 | Ga0207709_100632702 | 463 |
| 522 | 3300030522 | Ga0307512_10028172 | Ga0307512_100281724 | 463 |
| 523 | 3300031649 | Ga0307514_10057602 | Ga0307514_100576021 | 463 |
| 524 | 3300031901 | Ga0307406_10017304 | Ga0307406_100173043 | 463 |
| 525 | 3300041404 | Ga0439436_0002440 | Ga0439436_0002440_3519_4952 | 463 |
| 526 | 3300041512 | Ga0451853_1301325 | Ga0451853_1301325_4753_6195 | 463 |
| 527 | 3300042014 | Ga0439457_000427 | Ga0439457_000427_5560_6993 | 463 |
| 528 | 3300042015 | Ga0439462_0015749 | Ga0439462_0015749_313_1755 | 463 |
| 529 | 3300042131 | Ga0450894_000879 | Ga0450894_000879_2178_3620 | 463 |
| 530 | 3300045976 | Ga0466967_0163414 | Ga0466967_0163414_482_1912 | 463 |
| 531 | 3300046455 | Ga0495603_0001033 | Ga0495603_0001033_3560_4990 | 463 |
| 532 | 3300046476 | Ga0495662_0016113 | Ga0495662_0016113_810_2240 | 463 |
| 533 | 3300046499 | Ga0495594_0002866 | Ga0495594_0002866_3708_5138 | 463 |
| 534 | 3300046501 | Ga0495607_0052757 | Ga0495607_0052757_831_2267 | 463 |
| 535 | 3300046507 | Ga0495606_0007008 | Ga0495606_0007008_7320_8756 | 463 |
| 536 | 3300046512 | Ga0495610_0075302 | Ga0495610_0075302_35_1471 | 463 |
| 537 | 3300046513 | Ga0495616_0026651 | Ga0495616_0026651_43_1479 | 463 |
| 538 | 3300046515 | Ga0495620_0004115 | Ga0495620_0004115_258_1694 | 463 |
| 539 | 3300046515 | Ga0495620_0010011 | Ga0495620_0010011_83_1519 | 463 |
| 540 | 3300046522 | Ga0495643_0004726 | Ga0495643_0004726_517_1953 | 463 |
| 541 | 3300046524 | Ga0495648_0023170 | Ga0495648_0023170_1585_3021 | 463 |
| 542 | 3300046533 | Ga0495640_0017241 | Ga0495640_0017241_1560_2996 | 463 |
| 543 | 3300046542 | Ga0495597_0021607 | Ga0495597_0021607_990_2426 | 463 |
| 544 | 3300046615 | Ga0495656_0021085 | Ga0495656_0021085_55_1485 | 463 |
| 545 | 3300046642 | Ga0495634_0139173 | Ga0495634_0139173_74_1510 | 463 |
| 546 | 3300046675 | Ga0495657_0001523 | Ga0495657_0001523_901_2331 | 463 |
| 547 | 3300046694 | Ga0495649_0023132 | Ga0495649_0023132_406_1842 | 463 |
| 548 | 3300046794 | Ga0495589_0079158 | Ga0495589_0079158_83_1519 | 463 |
| 549 | 3300047315 | Ga0495581_0039742 | Ga0495581_0039742_804_2240 | 463 |
| 550 | 3300047318 | Ga0495636_0004016 | Ga0495636_0004016_1904_3334 | 463 |
| 551 | 3300047321 | Ga0495676_0007630 | Ga0495676_0007630_989_2425 | 463 |
| 552 | 3300047443 | Ga0495687_059624 | Ga0495687_059624_69_1505 | 463 |
| 553 | 3300048089 | Ga0495614_0067665 | Ga0495614_0067665_61_1497 | 463 |
| 554 | 3300049575 | Ga0501039_0063964 | Ga0501039_0063964_375_1847 | 463 |
| 555 | 3300050507 | nmdc:mga05p37_188172_c1 | nmdc:mga05p37_188172_c1_175_1770 | 463 |
| 556 | 3300053146 | Ga0500588_0001588 | Ga0500588_0001588_2016_3542 | 463 |
| 557 | iso_pu_bacteria | 2643221548 | 2643765288 | 463 |
| 558 | iso_pu_bacteria | 2643221682 | 2644462641 | 463 |
| 559 | 3300042157 | Ga0439458_0003723 | Ga0439458_0003723_1815_3263 | 464 |
| 560 | 3300005539 | Ga0068853_100004376 | Ga0068853_1000043763 | 465 |
| 561 | 3300026041 | Ga0207639_10002566 | Ga0207639_100025662 | 465 |
| 562 | 3300044658 | Ga0466972_0003739 | Ga0466972_0003739_4481_5926 | 465 |
| 563 | 3300044765 | Ga0466970_0028670 | Ga0466970_0028670_959_2404 | 465 |
| 564 | 3300044901 | Ga0466960_0004876 | Ga0466960_0004876_1971_3416 | 465 |
| 565 | 3300047472 | Ga0495686_0003153 | Ga0495686_0003153_2298_3698 | 465 |
| 566 | iso_pu_bacteria | 2868088558 | 2868089063 | 465 |
| 567 | 3300005548 | Ga0070665_100014500 | Ga0070665_1000145002 | 466 |
| 568 | 3300046455 | Ga0495603_0004977 | Ga0495603_0004977_2143_3603 | 466 |
| 569 | 3300046459 | Ga0495629_0008014 | Ga0495629_0008014_4149_5609 | 466 |
| 570 | 3300046689 | Ga0495613_0001444 | Ga0495613_0001444_4014_5474 | 466 |
| 571 | 3300047321 | Ga0495676_0024841 | Ga0495676_0024841_1563_3023 | 466 |
| 572 | 3300047673 | Ga0495593_0076456 | Ga0495593_0076456_60_1520 | 466 |
| 573 | 3300048089 | Ga0495614_0002100 | Ga0495614_0002100_5915_7375 | 466 |
| 574 | 3300005331 | Ga0070670_100015451 | Ga0070670_1000154513 | 467 |
| 575 | 3300005334 | Ga0068869_100134671 | Ga0068869_1001346711 | 467 |
| 576 | 3300005336 | Ga0070680_100156387 | Ga0070680_1001563871 | 467 |
| 577 | 3300005337 | Ga0070682_100002956 | Ga0070682_1000029564 | 467 |
| 578 | 3300005338 | Ga0068868_100028918 | Ga0068868_1000289183 | 467 |
| 579 | 3300005341 | Ga0070691_10011255 | Ga0070691_100112552 | 467 |
| 580 | 3300005345 | Ga0070692_10000081 | Ga0070692_100000817 | 467 |
| 581 | 3300005354 | Ga0070675_100006199 | Ga0070675_1000061993 | 467 |
| 582 | 3300005355 | Ga0070671_100000610 | Ga0070671_10000061010 | 467 |
| 583 | 3300005365 | Ga0070688_100085797 | Ga0070688_1000857971 | 467 |
| 584 | 3300005441 | Ga0070700_100007623 | Ga0070700_1000076231 | 467 |
| 585 | 3300005455 | Ga0070663_100006893 | Ga0070663_1000068932 | 467 |
| 586 | 3300005456 | Ga0070678_100171683 | Ga0070678_1001716831 | 467 |
| 587 | 3300005458 | Ga0070681_10031754 | Ga0070681_100317543 | 467 |
| 588 | 3300005466 | Ga0070685_10006225 | Ga0070685_100062253 | 467 |
| 589 | 3300005539 | Ga0068853_100100097 | Ga0068853_1001000972 | 467 |
| 590 | 3300005547 | Ga0070693_100010660 | Ga0070693_1000106601 | 467 |
| 591 | 3300005548 | Ga0070665_100254515 | Ga0070665_1002545151 | 467 |
| 592 | 3300005563 | Ga0068855_100177959 | Ga0068855_1001779592 | 467 |
| 593 | 3300005614 | Ga0068856_100018360 | Ga0068856_1000183603 | 467 |
| 594 | 3300005615 | Ga0070702_100001137 | Ga0070702_1000011377 | 467 |
| 595 | 3300005616 | Ga0068852_100013223 | Ga0068852_1000132233 | 467 |
| 596 | 3300005617 | Ga0068859_100016831 | Ga0068859_1000168315 | 467 |
| 597 | 3300005840 | Ga0068870_10000675 | Ga0068870_100006758 | 467 |
| 598 | 3300005841 | Ga0068863_100006338 | Ga0068863_1000063385 | 467 |
| 599 | 3300005842 | Ga0068858_100198276 | Ga0068858_1001982762 | 467 |
| 600 | 3300006358 | Ga0068871_100010156 | Ga0068871_1000101563 | 467 |
| 601 | 3300006844 | Ga0075428_100087839 | Ga0075428_1000878392 | 467 |
| 602 | 3300006852 | Ga0075433_10008500 | Ga0075433_100085005 | 467 |
| 603 | 3300006871 | Ga0075434_100006079 | Ga0075434_1000060796 | 467 |
| 604 | 3300006914 | Ga0075436_100000859 | Ga0075436_1000008597 | 467 |
| 605 | 3300006931 | Ga0097620_100016831 | Ga0097620_1000168315 | 467 |
| 606 | 3300007076 | Ga0075435_100041843 | Ga0075435_1000418433 | 467 |
| 607 | 3300009093 | Ga0105240_10063784 | Ga0105240_100637843 | 467 |
| 608 | 3300009101 | Ga0105247_10011226 | Ga0105247_100112264 | 467 |
| 609 | 3300009147 | Ga0114129_10081816 | Ga0114129_100818163 | 467 |
| 610 | 3300009174 | Ga0105241_10002930 | Ga0105241_100029305 | 467 |
| 611 | 3300009545 | Ga0105237_10052495 | Ga0105237_100524951 | 467 |
| 612 | 3300011119 | Ga0105246_10002248 | Ga0105246_100022484 | 467 |
| 613 | 3300013296 | Ga0157374_10083478 | Ga0157374_100834783 | 467 |
| 614 | 3300013297 | Ga0157378_10170949 | Ga0157378_101709492 | 467 |
| 615 | 3300013307 | Ga0157372_10052701 | Ga0157372_100527012 | 467 |
| 616 | 3300014497 | Ga0182008_10032816 | Ga0182008_100328161 | 467 |
| 617 | 3300014969 | Ga0157376_10098036 | Ga0157376_100980362 | 467 |
| 618 | 3300020081 | Ga0206354_10748882 | Ga0206354_107488821 | 467 |
| 619 | 3300025900 | Ga0207710_10040443 | Ga0207710_100404431 | 467 |
| 620 | 3300025901 | Ga0207688_10001656 | Ga0207688_100016568 | 467 |
| 621 | 3300025906 | Ga0207699_10119288 | Ga0207699_101192882 | 467 |
| 622 | 3300025908 | Ga0207643_10000243 | Ga0207643_100002438 | 467 |
| 623 | 3300025911 | Ga0207654_10010981 | Ga0207654_100109813 | 467 |
| 624 | 3300025917 | Ga0207660_10016326 | Ga0207660_100163261 | 467 |
| 625 | 3300025919 | Ga0207657_10053857 | Ga0207657_100538571 | 467 |
| 626 | 3300025920 | Ga0207649_10033048 | Ga0207649_100330482 | 467 |
| 627 | 3300025921 | Ga0207652_10027175 | Ga0207652_100271751 | 467 |
| 628 | 3300025928 | Ga0207700_10041362 | Ga0207700_100413623 | 467 |
| 629 | 3300025932 | Ga0207690_10130173 | Ga0207690_101301731 | 467 |
| 630 | 3300025936 | Ga0207670_10016736 | Ga0207670_100167361 | 467 |
| 631 | 3300025942 | Ga0207689_10000249 | Ga0207689_1000024918 | 467 |
| 632 | 3300025944 | Ga0207661_10022967 | Ga0207661_100229673 | 467 |
| 633 | 3300025945 | Ga0207679_10006523 | Ga0207679_100065231 | 467 |
| 634 | 3300025986 | Ga0207658_10180934 | Ga0207658_101809341 | 467 |
| 635 | 3300026023 | Ga0207677_10004582 | Ga0207677_100045826 | 467 |
| 636 | 3300026067 | Ga0207678_10000437 | Ga0207678_1000043727 | 467 |
| 637 | 3300026075 | Ga0207708_10002920 | Ga0207708_100029207 | 467 |
| 638 | 3300026078 | Ga0207702_10004711 | Ga0207702_100047113 | 467 |
| 639 | 3300026088 | Ga0207641_10031439 | Ga0207641_100314393 | 467 |
| 640 | 3300026095 | Ga0207676_10004625 | Ga0207676_100046257 | 467 |
| 641 | 3300026121 | Ga0207683_10000612 | Ga0207683_100006129 | 467 |
| 642 | 3300028379 | Ga0268266_10078385 | Ga0268266_100783852 | 467 |
| 643 | 3300028381 | Ga0268264_10256982 | Ga0268264_102569821 | 467 |
| 644 | 3300042157 | Ga0439458_0015381 | Ga0439458_0015381_54_1460 | 467 |
| 645 | 3300048905 | Ga0496102_0042564 | Ga0496102_0042564_146_1552 | 467 |
| 646 | 3300048907 | Ga0496104_0025309 | Ga0496104_0025309_3658_5064 | 467 |
| 647 | 3300048908 | Ga0496105_0002913 | Ga0496105_0002913_10793_12199 | 467 |
| 648 | 3300048909 | Ga0496106_0010225 | Ga0496106_0010225_48_1454 | 467 |
| 649 | 3300048910 | Ga0496107_0069056 | Ga0496107_0069056_259_1665 | 467 |
| 650 | 3300048911 | Ga0496108_0005277 | Ga0496108_0005277_6177_7583 | 467 |
| 651 | 3300048912 | Ga0496109_0079316 | Ga0496109_0079316_1515_2921 | 467 |
| 652 | 3300048913 | Ga0496110_0001600 | Ga0496110_0001600_13684_15090 | 467 |
| 653 | 3300048914 | Ga0496111_0002018 | Ga0496111_0002018_3909_5315 | 467 |
| 654 | 3300050510 | nmdc:mga06r32_258837_c1 | nmdc:mga06r32_258837_c1_25_1431 | 467 |
| 655 | 3300050512 | nmdc:mga0n895_5324_c1 | nmdc:mga0n895_5324_c1_220_1626 | 467 |
| 656 | 3300050513 | nmdc:mga0rr50_173053_c1 | nmdc:mga0rr50_173053_c1_69_1475 | 467 |
| 657 | 3300050515 | nmdc:mga0a205_3903_c1 | nmdc:mga0a205_3903_c1_1465_2871 | 467 |
| 658 | 3300046455 | Ga0495603_0003077 | Ga0495603_0003077_6177_7652 | 469 |
| 659 | 3300046459 | Ga0495629_0007045 | Ga0495629_0007045_4604_6079 | 469 |
| 660 | 3300046499 | Ga0495594_0002972 | Ga0495594_0002972_2747_4222 | 469 |
| 661 | 3300046648 | Ga0495611_0021232 | Ga0495611_0021232_1050_2525 | 469 |
| 662 | 3300047321 | Ga0495676_0003549 | Ga0495676_0003549_4618_6093 | 469 |
| 663 | 3300053153 | Ga0500616_0007334 | Ga0500616_0007334_1869_3401 | 469 |
| 664 | 3300037418 | Ga0395900_0029681 | Ga0395900_0029681_1678_3108 | 470 |
| 665 | 3300037466 | Ga0395898_0022655 | Ga0395898_0022655_235_1665 | 470 |
| 666 | 3300037471 | Ga0395905_0080751 | Ga0395905_0080751_915_2345 | 470 |
| 667 | 3300038443 | Ga0395901_0005824 | Ga0395901_0005824_1661_3091 | 470 |
| 668 | 3300003203 | JGI25406J46586_10030411 | JGI25406J46586_100304111 | 472 |
| 669 | 3300005985 | Ga0081539_10002184 | Ga0081539_1000218422 | 472 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gnx-assembly1.cif.gz_B | b-glucosidase from streptomyces sp | 0.9854 | 13 | 468 |
| 1gon-assembly2.cif.gz_B | b-glucosidase from streptomyces sp | 0.9854 | 13 | 468 |
| 7bbs-assembly1.cif.gz_B | structure of bg10: an alcohol-tolerant and glucose-stimulated b-glucosidase | 0.9843 | 14 | 466 |
| 1gon-assembly1.cif.gz_A | b-glucosidase from streptomyces sp | 0.9838 | 13 | 468 |
| 7bbs-assembly1.cif.gz_A | structure of bg10: an alcohol-tolerant and glucose-stimulated b-glucosidase | 0.9824 | 14 | 466 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6PHF5_27_269_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9867 | 15 | 218 | 3.20.20.80 |
| 3ta9B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9779 | 13 | 466 | 3.20.20.80 |
| 2o9rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9772 | 11 | 465 | 3.20.20.80 |
| 5aybA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9765 | 13 | 462 | 3.20.20.80 |
| 3ta9B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9757 | 13 | 466 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A060BWI0-F1-model_v4 | Glyco_hydro_1 | 0.9991 | 370 | 465 |
GO:0005829
GO:0008422 GO:0016052 |
| AF-A0A453SUS3-F1-model_v4 | Uncharacterized protein | 0.9937 | 15 | 143 |
GO:0005975
GO:0008422 GO:0102726 |
| AF-A0A388NUD9-F1-model_v4 | Beta-glucosidase | 0.9925 | 13 | 194 |
GO:0005829
GO:0008422 GO:0030245 |
| AF-A0A3D0STR2-F1-model_v4 | Beta-glucosidase | 0.9921 | 15 | 179 |
GO:0005829
GO:0008422 GO:0030245 |
| AF-Q9X9R4-F1-model_v4 | BGLC protein (EC 3.2.1.21) | 0.9917 | 11 | 240 |
GO:0005829
GO:0008422 GO:0030245 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar