F474048

General Info

Members Datasets Scaffolds Average Seq Length
669 411 589 463

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_188172_c1|nmdc:mga05p37_188172_c1_175_1770
Length 531
Sequence VSTSHHLDIHQRASAESDVEAPATQTSPNGVLRFPEGFLWGAATAAYQIEGAAATDGRTPSIWDTFSERPGAVVGGHTGHVAVDHYHRYRDDVALMRRMGLNSYRFSVSWSRVQPAGAGPANPAGLDFYRRLVDELLDNGIQPWLTLYHWDLPQPIEDAGGWPARDTAARFADYAALVHHALGDRVNAFTTLNEPWCSAFLGYASGEHAPGRRDVVSAVRAAHHLLLGHGLAVDAIRAQRADAQVGITLNLYAISAASASPADQDAARRIDGIGNRFFLDPVLLGRYPADVVRDLSSITDFSHVKDGDLAVISRPLSMLGINYYSRHVLAAPAPAGDSEGASQRSEERTERGASPNGYVDTSQSDGAIDWRGTGIVNPYPGSEAVRFVQRGVPVTAMDWEIDAPGLAEVLRRVSREYPAVPLYITENGAAFQDEVAPDGSVQDADRRAYFEAHLRACHEAIAAGVPLRGYFAWSLLDNFEWAWGYTRRFGLVHVDYQSQVRTPKASAHWYSDVIRRHGLLDHTPQGAGATP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221556 Massilia sp. Root1485 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221684 Massilia sp. Root133 Isolate Unclassified
12 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
13 2738541297 Duganella sp. GV083 Isolate Unclassified
14 2738541357 Duganella sp. GV053 Isolate Unclassified
15 2738543003 Duganella sp. GV066 Isolate Unclassified
16 2738543026 Duganella sp. GV089 Isolate Unclassified
17 2738543029 Duganella sp. GV039 Isolate Unclassified
18 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
19 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
20 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
21 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
22 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
23 2808606448 Streptomyces sp. 193411 Isolate Unclassified
24 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
25 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
26 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
27 2821131069 Duganella sp. 1224 Isolate Unclassified
28 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
29 2842711865 Duganella sp. R-73148 Isolate Unclassified
30 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
31 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
32 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
33 2855683550 Micromonospora sp. RP3T Isolate Unclassified
34 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
35 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
36 2857564685 Duganella sp. R-74599 Isolate Unclassified
37 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
38 2858868258 Micromonospora sp. MH33 Isolate Unclassified
39 2858882152 Micromonospora noduli MED15 Isolate Nodule
40 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
41 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
42 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
43 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
44 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
45 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
46 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
47 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
48 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
49 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
50 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
51 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
52 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
53 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
54 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
55 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
56 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
57 2902582711 Micromonospora sp. AP08 Isolate Unclassified
58 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
59 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
60 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
61 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
62 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
63 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
64 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
65 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
66 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
67 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
68 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
69 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
70 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
71 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
76 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
81 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
86 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
91 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
92 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
93 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
94 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
101 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
102 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
223 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
246 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
391 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
394 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
395 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
401 649633069 Micromonospora sp. L5 Isolate Unclassified
402 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
403 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
404 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
405 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
406 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
407 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
408 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
409 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
410 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
411 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.74
Metatranscriptomes 0.15
Isolates 12.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 1.05
Rhizoplane 3.14
Rhizosphere 79.22
Stem 0
Stem Tuber 0.15
Unclassified 12.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10030411 3300003203 Bacteria 2032
2 rootH1_10044769 3300003316 Bacteria 5616
3 rootL2_10106560 3300003322 Bacteria 3020
4 rootH1_10004943 3300003316 Bacteria 35922
5 rootH1_10004943 3300003323 Bacteria 7849
6 Ga0055525_1000025 3300003759 Bacteria 347582
7 Ga0055529_1000133 3300003763 Bacteria 104484
8 Ga0055526_1000487 3300003771 Bacteria 31529
9 Ga0055537_1000035 3300003773 Bacteria 96274
10 Ga0055524_1005183 3300003775 Bacteria 5869
11 Ga0055534_1000325 3300003784 Bacteria 31562
12 Ga0055528_1000058 3300003790 Bacteria 88086
13 Ga0070658_10001438 3300005327 Bacteria 20307
14 Ga0070658_10015585 3300005327 Bacteria 6079
15 Ga0070683_100000951 3300005329 Bacteria 21575
16 Ga0070683_100007512 3300005329 Bacteria 9212
17 Ga0070683_100007980 3300005329 Bacteria 8981
18 Ga0070683_100010242 3300005329 Bacteria 8054
19 Ga0070670_100015451 3300005331 Bacteria 6557
20 Ga0068869_100002123 3300005334 Bacteria 11920
21 Ga0068869_100134671 3300005334 Bacteria 1902
22 Ga0070680_100156387 3300005336 Bacteria 1915
23 Ga0070682_100002956 3300005337 Bacteria 9440
24 Ga0068868_100010999 3300005338 Bacteria 6575
25 Ga0068868_100028918 3300005338 Bacteria 4242
26 Ga0070660_100002035 3300005339 Bacteria 13951
27 Ga0070691_10011255 3300005341 Bacteria 4083
28 Ga0070661_100016713 3300005344 Bacteria 5193
29 Ga0070661_100049817 3300005344 Bacteria 3066
30 Ga0070692_10000081 3300005345 Bacteria 20037
31 Ga0070692_10012284 3300005345 Bacteria 3959
32 Ga0070692_10014463 3300005345 Bacteria 3708
33 Ga0070668_100088582 3300005347 Bacteria 2437
34 Ga0070675_100000500 3300005354 Bacteria 26911
35 Ga0070675_100003832 3300005354 Bacteria 11409
36 Ga0070675_100006199 3300005354 Bacteria 9172
37 Ga0070671_100000610 3300005355 Bacteria 25520
38 Ga0070688_100085797 3300005365 Bacteria 2047
39 Ga0070659_100001502 3300005366 Bacteria 16813
40 Ga0070659_100042397 3300005366 Bacteria 3557
41 Ga0070709_10030767 3300005434 Bacteria 3224
42 Ga0070714_100007850 3300005435 Bacteria 8310
43 Ga0070710_10001747 3300005437 Bacteria 10280
44 Ga0070710_10008929 3300005437 Bacteria 4894
45 Ga0070700_100007623 3300005441 Bacteria 5856
46 Ga0070694_100040884 3300005444 Bacteria 3091
47 Ga0070663_100006893 3300005455 Bacteria 6877
48 Ga0070663_100011692 3300005455 Bacteria 5521
49 Ga0070663_100038366 3300005455 Bacteria 3342
50 Ga0070678_100171683 3300005456 Bacteria 1767
51 Ga0070681_10031754 3300005458 Bacteria 5301
52 Ga0070685_10006225 3300005466 Bacteria 6077
53 Ga0070679_100010283 3300005530 Bacteria 8869
54 Ga0070684_100009947 3300005535 Bacteria 7519
55 Ga0070684_100027367 3300005535 Bacteria 4811
56 Ga0070684_100039817 3300005535 Bacteria 4044
57 Ga0068853_100004376 3300005539 Bacteria 10933
58 Ga0068853_100008565 3300005539 Bacteria 8221
59 Ga0068853_100100097 3300005539 Bacteria 2562
60 Ga0070693_100010660 3300005547 Bacteria 4608
61 Ga0070665_100014500 3300005548 Bacteria 7906
62 Ga0070665_100254515 3300005548 Bacteria 1757
63 Ga0068855_100177959 3300005563 Bacteria 2405
64 Ga0070664_100000986 3300005564 Bacteria 22287
65 Ga0070664_100001017 3300005564 Bacteria 22018
66 Ga0070664_100011712 3300005564 Bacteria 7118
67 Ga0070664_100091397 3300005564 Bacteria 2635
68 Ga0068857_100001211 3300005577 Bacteria 20120
69 Ga0068856_100018360 3300005614 Bacteria 6778
70 Ga0068856_100069747 3300005614 Bacteria 3476
71 Ga0070702_100001137 3300005615 Bacteria 10670
72 Ga0070702_100007666 3300005615 Bacteria 5178
73 Ga0070702_100028520 3300005615 Bacteria 3026
74 Ga0068852_100013223 3300005616 Bacteria 6309
75 Ga0068852_100037469 3300005616 Bacteria 4066
76 Ga0068859_100000001 3300005617 Bacteria 545224
77 Ga0068859_100016831 3300005617 Bacteria 7339
78 Ga0068864_100029219 3300005618 Bacteria 4665
79 Ga0068864_100077496 3300005618 Bacteria 2907
80 Ga0068870_10000675 3300005840 Bacteria 13011
81 Ga0068863_100006338 3300005841 Bacteria 11602
82 Ga0068863_100055968 3300005841 Bacteria 3734
83 Ga0068858_100048426 3300005842 Bacteria 3939
84 Ga0068858_100140953 3300005842 Bacteria 2263
85 Ga0068858_100198276 3300005842 Bacteria 1898
86 Ga0068862_100003795 3300005844 Bacteria 12873
87 Ga0068862_100183893 3300005844 Bacteria 1877
88 Ga0081455_10000157 3300005937 Bacteria 82320
89 Ga0081455_10000487 3300005937 Bacteria 51494
90 Ga0081539_10000128 3300005985 Bacteria 179041
91 Ga0081539_10002184 3300005985 Bacteria 28707
92 Ga0081539_10031245 3300005985 Bacteria 3287
93 Ga0068871_100010156 3300006358 Bacteria 6855
94 Ga0075428_100000249 3300006844 Bacteria 52754
95 Ga0075428_100007485 3300006844 Bacteria 12101
96 Ga0075428_100008826 3300006844 Bacteria 11185
97 Ga0075428_100087839 3300006844 Bacteria 3391
98 Ga0075430_100013782 3300006846 Bacteria 6888
99 Ga0075430_100025090 3300006846 Bacteria 5071
100 Ga0075430_100068710 3300006846 Bacteria 2972
101 Ga0075431_100004085 3300006847 Bacteria 14240
102 Ga0075431_100012731 3300006847 Bacteria 8493
103 Ga0075431_100032957 3300006847 Bacteria 5339
104 Ga0075433_10008500 3300006852 Bacteria 8194
105 Ga0075434_100006079 3300006871 Bacteria 11043
106 Ga0075429_100002277 3300006880 Bacteria 16101
107 Ga0075429_100014279 3300006880 Bacteria 6888
108 Ga0075429_100027382 3300006880 Bacteria 4947
109 Ga0075429_100040299 3300006880 Bacteria 4066
110 Ga0068865_100035342 3300006881 Bacteria 3359
111 Ga0075436_100000859 3300006914 Bacteria 20188
112 Ga0097620_100000001 3300006931 Bacteria 545224
113 Ga0097620_100016831 3300006931 Bacteria 7339
114 Ga0075435_100041843 3300007076 Bacteria 3663
115 Ga0105240_10063784 3300009093 Bacteria 4581
116 Ga0111539_10001734 3300009094 Bacteria 29031
117 Ga0111539_10002939 3300009094 Bacteria 22595
118 Ga0105245_10001884 3300009098 Bacteria 19038
119 Ga0105245_10006225 3300009098 Bacteria 10498
120 Ga0105245_10045501 3300009098 Bacteria 3920
121 Ga0105247_10011226 3300009101 Bacteria 5403
122 Ga0114129_10000352 3300009147 Bacteria 53517
123 Ga0114129_10044528 3300009147 Bacteria 6243
124 Ga0114129_10081816 3300009147 Bacteria 4488
125 Ga0105243_10124359 3300009148 Bacteria 2180
126 Ga0105241_10002930 3300009174 Bacteria 12741
127 Ga0105237_10052495 3300009545 Bacteria 4092
128 Ga0105239_10059327 3300010375 Bacteria 4199
129 Ga0105246_10002248 3300011119 Bacteria 11646
130 Ga0157371_10000003 3300013102 Bacteria 543317
131 Ga0157371_10013441 3300013102 Bacteria 6215
132 Ga0157369_10033434 3300013105 Bacteria 5651
133 Ga0157374_10083478 3300013296 Bacteria 3035
134 Ga0157378_10170949 3300013297 Bacteria 2038
135 Ga0157372_10039874 3300013307 Bacteria 5185
136 Ga0157372_10046203 3300013307 Bacteria 4833
137 Ga0157372_10052701 3300013307 Bacteria 4531
138 Ga0157375_10056496 3300013308 Bacteria 3875
139 Ga0163163_10002454 3300014325 Bacteria 15679
140 Ga0182008_10009447 3300014497 Bacteria 5260
141 Ga0182008_10032816 3300014497 Bacteria 2606
142 Ga0157377_10007093 3300014745 Bacteria 5386
143 Ga0157379_10152151 3300014968 Bacteria 2087
144 Ga0157376_10098036 3300014969 Bacteria 2555
145 Ga0183367_1006 3300015688 Bacteria 648044
146 Ga0163161_10087091 3300017792 Bacteria 2306
147 Ga0206354_10748882 3300020081 Bacteria 2089
148 Ga0213875_10000499 3300021388 Bacteria 32899
149 Ga0209563_100003 3300025230 Bacteria 1932942
150 Ga0207425_1000202 3300025245 Bacteria 47483
151 Ga0209677_104852 3300025253 Bacteria 3706
152 Ga0209148_1000590 3300025254 Bacteria 33089
153 Ga0209565_1000009 3300025263 Bacteria 751701
154 Ga0209455_1000063 3300025272 Bacteria 333019
155 Ga0209673_1000036 3300025273 Bacteria 323162
156 Ga0209675_1000013 3300025291 Bacteria 448220
157 Ga0209025_1001180 3300025294 Bacteria 36969
158 Ga0209564_1000122 3300025295 Bacteria 203709
159 Ga0209758_1000372 3300025297 Bacteria 78825
160 Ga0209256_1000106 3300025299 Bacteria 187258
161 Ga0209051_1017704 3300025303 Bacteria 3177
162 Ga0207692_10001543 3300025898 Bacteria 8654
163 Ga0207692_10084359 3300025898 Bacteria 1707
164 Ga0207710_10040443 3300025900 Bacteria 2066
165 Ga0207688_10001656 3300025901 Bacteria 11779
166 Ga0207699_10082168 3300025906 Bacteria 2001
167 Ga0207699_10085472 3300025906 Bacteria 1968
168 Ga0207699_10119288 3300025906 Bacteria 1703
169 Ga0207643_10000243 3300025908 Bacteria 37871
170 Ga0207705_10002403 3300025909 Bacteria 14458
171 Ga0207654_10010981 3300025911 Bacteria 4610
172 Ga0207660_10016326 3300025917 Bacteria 4914
173 Ga0207657_10005761 3300025919 Bacteria 12919
174 Ga0207657_10010908 3300025919 Bacteria 9043
175 Ga0207657_10053857 3300025919 Bacteria 3482
176 Ga0207649_10033048 3300025920 Bacteria 3088
177 Ga0207649_10034910 3300025920 Bacteria 3017
178 Ga0207652_10027175 3300025921 Bacteria 4767
179 Ga0207659_10001668 3300025926 Bacteria 13192
180 Ga0207659_10013895 3300025926 Bacteria 5176
181 Ga0207687_10007814 3300025927 Bacteria 7014
182 Ga0207687_10019413 3300025927 Bacteria 4504
183 Ga0207700_10041362 3300025928 Bacteria 3371
184 Ga0207700_10046870 3300025928 Bacteria 3200
185 Ga0207690_10044452 3300025932 Bacteria 2928
186 Ga0207690_10130173 3300025932 Bacteria 1840
187 Ga0207690_10134550 3300025932 Bacteria 1813
188 Ga0207706_10004525 3300025933 Bacteria 13058
189 Ga0207709_10063270 3300025935 Bacteria 2318
190 Ga0207670_10016736 3300025936 Bacteria 4415
191 Ga0207704_10034889 3300025938 Bacteria 2876
192 Ga0207711_10036486 3300025941 Bacteria 4171
193 Ga0207689_10000249 3300025942 Bacteria 48288
194 Ga0207689_10022071 3300025942 Bacteria 5353
195 Ga0207661_10003256 3300025944 Bacteria 11255
196 Ga0207661_10015667 3300025944 Bacteria 5586
197 Ga0207661_10022967 3300025944 Bacteria 4707
198 Ga0207661_10040245 3300025944 Bacteria 3673
199 Ga0207661_10042483 3300025944 Bacteria 3584
200 Ga0207679_10003806 3300025945 Bacteria 9355
201 Ga0207679_10006523 3300025945 Bacteria 7378
202 Ga0207679_10034266 3300025945 Bacteria 3580
203 Ga0207679_10060464 3300025945 Bacteria 2815
204 Ga0207668_10078930 3300025972 Bacteria 2379
205 Ga0207658_10180934 3300025986 Bacteria 1745
206 Ga0207677_10004582 3300026023 Bacteria 7433
207 Ga0207677_10009501 3300026023 Bacteria 5474
208 Ga0207703_10111408 3300026035 Bacteria 2336
209 Ga0207639_10002566 3300026041 Bacteria 12182
210 Ga0207678_10000437 3300026067 Bacteria 37849
211 Ga0207678_10010910 3300026067 Bacteria 7982
212 Ga0207678_10022373 3300026067 Bacteria 5537
213 Ga0207708_10002920 3300026075 Bacteria 12589
214 Ga0207708_10003232 3300026075 Bacteria 11997
215 Ga0207702_10004711 3300026078 Bacteria 12055
216 Ga0207641_10031439 3300026088 Bacteria 4403
217 Ga0207676_10004625 3300026095 Bacteria 9744
218 Ga0207676_10088794 3300026095 Bacteria 2531
219 Ga0207674_10003876 3300026116 Bacteria 18233
220 Ga0207674_10029511 3300026116 Bacteria 5774
221 Ga0207674_10118652 3300026116 Bacteria 2615
222 Ga0207683_10000612 3300026121 Bacteria 32925
223 Ga0207683_10077049 3300026121 Bacteria 2953
224 Ga0207698_10073646 3300026142 Bacteria 2720
225 Ga0207428_10013648 3300027907 Bacteria 7087
226 Ga0268266_10078385 3300028379 Bacteria 2875
227 Ga0268265_10003188 3300028380 Bacteria 11917
228 Ga0268265_10083036 3300028380 Bacteria 2535
229 Ga0268264_10256982 3300028381 Bacteria 1625
230 Ga0307517_10008362 3300028786 Bacteria 14853
231 Ga0307515_10008666 3300028794 Bacteria 19791
232 Ga0307511_10001845 3300030521 Bacteria 22256
233 Ga0307512_10028172 3300030522 Bacteria 4929
234 Ga0265320_10009848 3300031240 Bacteria 5727
235 Ga0307513_10020885 3300031456 Bacteria 7748
236 Ga0307509_10009951 3300031507 Bacteria 11748
237 Ga0307509_10011427 3300031507 Bacteria 10748
238 Ga0307514_10057602 3300031649 Bacteria 2975
239 Ga0307514_10063459 3300031649 Bacteria 2805
240 Ga0316575_10000010 3300031665 Bacteria 51771
241 Ga0316576_10007855 3300031727 Bacteria 6745
242 Ga0307413_10005800 3300031824 Bacteria 5561
243 Ga0307413_10054688 3300031824 Bacteria 2424
244 Ga0307518_10028309 3300031838 Bacteria 4044
245 Ga0307406_10017304 3300031901 Bacteria 4198
246 Ga0307409_100048517 3300031995 Bacteria 3232
247 Ga0307409_100079780 3300031995 Bacteria 2639
248 Ga0307507_10007393 3300033179 Bacteria 16030
249 Ga0307507_10016591 3300033179 Bacteria 8550
250 Ga0307510_10007347 3300033180 Bacteria 13129
251 Ga0307510_10053173 3300033180 Bacteria 4260
252 Ga0395899_0070221 3300037312 Bacteria 2563
253 Ga0395900_0000324 3300037418 Bacteria 70682
254 Ga0395900_0029681 3300037418 Bacteria 5611
255 Ga0395900_0185206 3300037418 Bacteria 2113
256 Ga0395898_0022655 3300037466 Bacteria 6359
257 Ga0395898_0051003 3300037466 Bacteria 4047
258 Ga0395905_0080751 3300037471 Bacteria 3048
259 Ga0395905_0135372 3300037471 Bacteria 2317
260 Ga0436364_1386442 3300037853 Bacteria 37433
261 Ga0395901_0000089 3300038443 Bacteria 124305
262 Ga0395901_0005824 3300038443 Bacteria 12476
263 Ga0395901_0159532 3300038443 Bacteria 2368
264 Ga0439436_0000330 3300041404 Bacteria 11642
265 Ga0439436_0002440 3300041404 Bacteria 5585
266 Ga0439439_0012517 3300041406 Bacteria 2052
267 Ga0451853_1301325 3300041512 Bacteria 7962
268 Ga0439448_0000868 3300042005 Bacteria 7386
269 Ga0439449_0000183 3300042007 Bacteria 21770
270 Ga0439455_0001890 3300042012 Bacteria 3668
271 Ga0439457_000427 3300042014 Bacteria 12122
272 Ga0439457_000664 3300042014 Bacteria 10181
273 Ga0439462_0015749 3300042015 Bacteria 1951
274 Ga0450894_000879 3300042131 Bacteria 4797
275 Ga0439458_0003723 3300042157 Bacteria 3535
276 Ga0439458_0015381 3300042157 Bacteria 1733
277 Ga0451577_0000012 3300042876 Bacteria 575467
278 Ga0466969_0005538 3300044656 Bacteria 6711
279 Ga0466969_0071787 3300044656 Bacteria 1664
280 Ga0466972_0001015 3300044658 Bacteria 13449
281 Ga0466972_0001798 3300044658 Bacteria 10506
282 Ga0466972_0003739 3300044658 Bacteria 7566
283 Ga0466965_0001465 3300044683 Bacteria 9537
284 Ga0466965_0006602 3300044683 Bacteria 5284
285 Ga0466965_0008661 3300044683 Bacteria 4708
286 Ga0466965_0019858 3300044683 Bacteria 3226
287 Ga0466965_0098090 3300044683 Bacteria 1496
288 Ga0466966_0003922 3300044684 Bacteria 9824
289 Ga0466966_0019005 3300044684 Bacteria 4528
290 Ga0466966_0045675 3300044684 Bacteria 2799
291 Ga0466966_0052762 3300044684 Bacteria 2581
292 Ga0466961_0014839 3300044693 Bacteria 5004
293 Ga0466963_0006646 3300044694 Bacteria 6866
294 Ga0466963_0091633 3300044694 Bacteria 2070
295 Ga0466964_0001817 3300044706 Bacteria 7425
296 Ga0466964_0001830 3300044706 Bacteria 7405
297 Ga0466964_0062452 3300044706 Bacteria 1553
298 Ga0453684_0038591 3300044712 Bacteria 6525
299 Ga0466971_0010922 3300044719 Bacteria 3972
300 Ga0466971_0032906 3300044719 Bacteria 2322
301 Ga0466968_0017129 3300044735 Bacteria 2892
302 Ga0466968_0021696 3300044735 Bacteria 2602
303 Ga0466970_0001976 3300044765 Bacteria 9917
304 Ga0466970_0028670 3300044765 Bacteria 2927
305 Ga0466957_0003544 3300044842 Bacteria 8595
306 Ga0466957_0003950 3300044842 Bacteria 8195
307 Ga0466960_0004876 3300044901 Bacteria 5276
308 Ga0466959_0020684 3300045049 Bacteria 4849
309 Ga0466959_0111052 3300045049 Bacteria 1956
310 Ga0466958_0022637 3300045836 Bacteria 3683
311 Ga0466967_0009040 3300045976 Bacteria 7363
312 Ga0466967_0064223 3300045976 Bacteria 3264
313 Ga0466967_0163414 3300045976 Bacteria 2091
314 Ga0495617_000139 3300046452 Bacteria 47951
315 Ga0495592_0002377 3300046454 Bacteria 13265
316 Ga0495603_0001033 3300046455 Bacteria 16095
317 Ga0495603_0001268 3300046455 Bacteria 14708
318 Ga0495603_0003077 3300046455 Bacteria 9907
319 Ga0495603_0004977 3300046455 Bacteria 7953
320 Ga0495590_0000314 3300046457 Bacteria 25322
321 Ga0495629_0007045 3300046459 Bacteria 8284
322 Ga0495629_0007808 3300046459 Bacteria 7875
323 Ga0495629_0008014 3300046459 Bacteria 7773
324 Ga0495629_0010442 3300046459 Bacteria 6754
325 Ga0495629_0010634 3300046459 Bacteria 6694
326 Ga0495629_0017542 3300046459 Bacteria 5131
327 Ga0495638_0000067 3300046460 Bacteria 167869
328 Ga0495638_0058219 3300046460 Bacteria 2395
329 Ga0495651_0001434 3300046462 Bacteria 18454
330 Ga0495653_0000018 3300046463 Bacteria 185787
331 Ga0495653_0024485 3300046463 Bacteria 4863
332 Ga0495650_0000239 3300046471 Bacteria 109891
333 Ga0495650_0000305 3300046471 Bacteria 88924
334 Ga0495650_0000472 3300046471 Bacteria 62014
335 Ga0495650_0002496 3300046471 Bacteria 14773
336 Ga0495650_0013594 3300046471 Bacteria 4294
337 Ga0495605_0000005 3300046474 Bacteria 376973
338 Ga0495605_0000117 3300046474 Bacteria 103262
339 Ga0495605_0011372 3300046474 Bacteria 4967
340 Ga0495605_0027462 3300046474 Bacteria 2948
341 Ga0495605_0028670 3300046474 Bacteria 2872
342 Ga0495639_0015258 3300046475 Bacteria 3330
343 Ga0495639_0025491 3300046475 Bacteria 2608
344 Ga0495662_0000316 3300046476 Bacteria 21004
345 Ga0495662_0016113 3300046476 Bacteria 3624
346 Ga0495664_0001280 3300046477 Bacteria 13167
347 Ga0495664_0143757 3300046477 Bacteria 1446
348 Ga0495584_0000186 3300046491 Bacteria 43887
349 Ga0495584_0005832 3300046491 Bacteria 6488
350 Ga0495585_0000418 3300046492 Bacteria 40978
351 Ga0495594_0002866 3300046499 Bacteria 8964
352 Ga0495594_0002972 3300046499 Bacteria 8788
353 Ga0495596_0003323 3300046500 Bacteria 8194
354 Ga0495596_0004822 3300046500 Bacteria 6485
355 Ga0495607_0018097 3300046501 Bacteria 4501
356 Ga0495607_0021878 3300046501 Bacteria 4021
357 Ga0495607_0052757 3300046501 Bacteria 2353
358 Ga0495583_0000160 3300046506 Bacteria 113560
359 Ga0495583_0000162 3300046506 Bacteria 112598
360 Ga0495606_0000269 3300046507 Bacteria 91558
361 Ga0495606_0000783 3300046507 Bacteria 48693
362 Ga0495606_0001207 3300046507 Bacteria 36311
363 Ga0495606_0003466 3300046507 Bacteria 16724
364 Ga0495606_0007008 3300046507 Bacteria 10229
365 Ga0495606_0086159 3300046507 Bacteria 1942
366 Ga0495608_0001532 3300046511 Bacteria 16465
367 Ga0495610_0000021 3300046512 Bacteria 336300
368 Ga0495610_0015782 3300046512 Bacteria 4375
369 Ga0495610_0075302 3300046512 Bacteria 1563
370 Ga0495616_0013425 3300046513 Bacteria 4619
371 Ga0495616_0026271 3300046513 Bacteria 3101
372 Ga0495616_0026651 3300046513 Bacteria 3073
373 Ga0495618_0035076 3300046514 Bacteria 3148
374 Ga0495620_0004115 3300046515 Bacteria 8251
375 Ga0495620_0010011 3300046515 Bacteria 5015
376 Ga0495628_0004838 3300046516 Bacteria 11847
377 Ga0495628_0011400 3300046516 Bacteria 7521
378 Ga0495631_0008030 3300046518 Bacteria 5333
379 Ga0495632_0011173 3300046519 Bacteria 5258
380 Ga0495637_0000057 3300046520 Bacteria 97433
381 Ga0495643_0000118 3300046522 Bacteria 127939
382 Ga0495643_0000212 3300046522 Bacteria 89287
383 Ga0495643_0000263 3300046522 Bacteria 76248
384 Ga0495643_0001396 3300046522 Bacteria 22518
385 Ga0495643_0004726 3300046522 Bacteria 9428
386 Ga0495644_0014730 3300046523 Bacteria 2993
387 Ga0495648_0000008 3300046524 Bacteria 336584
388 Ga0495648_0003084 3300046524 Bacteria 14880
389 Ga0495648_0012918 3300046524 Bacteria 6201
390 Ga0495648_0023170 3300046524 Bacteria 4259
391 Ga0495666_0001077 3300046526 Bacteria 12999
392 Ga0495642_0006502 3300046528 Bacteria 4484
393 Ga0495652_0057679 3300046529 Bacteria 3291
394 Ga0495654_0000005 3300046530 Bacteria 491381
395 Ga0495654_0009991 3300046530 Bacteria 5183
396 Ga0495665_0000346 3300046531 Bacteria 23339
397 Ga0495640_0008329 3300046533 Bacteria 8128
398 Ga0495640_0017241 3300046533 Bacteria 5385
399 Ga0495586_0011130 3300046535 Bacteria 4780
400 Ga0495587_0012333 3300046536 Bacteria 5384
401 Ga0495609_0000001 3300046538 Bacteria 1060094
402 Ga0495609_0000269 3300046538 Bacteria 48750
403 Ga0495597_0000027 3300046542 Bacteria 139281
404 Ga0495597_0000917 3300046542 Bacteria 22841
405 Ga0495597_0021607 3300046542 Bacteria 2990
406 Ga0495645_0002377 3300046543 Bacteria 12768
407 Ga0495622_0000060 3300046557 Bacteria 96603
408 Ga0495633_0000128 3300046558 Bacteria 101213
409 Ga0495633_0001536 3300046558 Bacteria 17721
410 Ga0495633_0003289 3300046558 Bacteria 10858
411 Ga0495633_0079309 3300046558 Bacteria 1528
412 Ga0495633_0083155 3300046558 Bacteria 1489
413 Ga0495667_0001088 3300046559 Bacteria 17635
414 Ga0495667_0057688 3300046559 Bacteria 2552
415 Ga0495656_0021085 3300046615 Bacteria 2534
416 Ga0495668_0000144 3300046616 Bacteria 106951
417 Ga0495668_0001247 3300046616 Bacteria 25528
418 Ga0495668_0002800 3300046616 Bacteria 13877
419 Ga0495668_0082152 3300046616 Bacteria 1767
420 Ga0495634_0004825 3300046642 Bacteria 10474
421 Ga0495634_0038089 3300046642 Bacteria 3279
422 Ga0495634_0139173 3300046642 Bacteria 1542
423 Ga0495611_0021232 3300046648 Bacteria 2803
424 Ga0495625_0000192 3300046660 Bacteria 97193
425 Ga0495625_0003424 3300046660 Bacteria 15832
426 Ga0495625_0011290 3300046660 Bacteria 7296
427 Ga0495635_0000558 3300046663 Bacteria 23721
428 Ga0495635_0010158 3300046663 Bacteria 6583
429 Ga0495661_0000663 3300046665 Bacteria 34526
430 Ga0495661_0000872 3300046665 Bacteria 27928
431 Ga0495661_0058750 3300046665 Bacteria 2291
432 Ga0495661_0078861 3300046665 Bacteria 1904
433 Ga0495588_0000089 3300046674 Bacteria 191894
434 Ga0495657_0001523 3300046675 Bacteria 19960
435 Ga0495657_0005278 3300046675 Bacteria 10225
436 Ga0495657_0011223 3300046675 Bacteria 6710
437 Ga0495599_0002673 3300046678 Bacteria 10406
438 Ga0495623_0039407 3300046679 Bacteria 3019
439 Ga0495646_0002071 3300046680 Bacteria 12161
440 Ga0495646_0075470 3300046680 Bacteria 1976
441 Ga0495613_0001444 3300046689 Bacteria 18157
442 Ga0495613_0022476 3300046689 Bacteria 4698
443 Ga0495670_0045592 3300046691 Bacteria 2189
444 Ga0495671_0000024 3300046692 Bacteria 246812
445 Ga0495671_0005439 3300046692 Bacteria 7454
446 Ga0495649_0000715 3300046694 Bacteria 27013
447 Ga0495649_0002538 3300046694 Bacteria 12794
448 Ga0495649_0023132 3300046694 Bacteria 3471
449 Ga0495649_0041662 3300046694 Bacteria 2510
450 Ga0495589_0000027 3300046794 Bacteria 181084
451 Ga0495589_0000974 3300046794 Bacteria 17471
452 Ga0495589_0026299 3300046794 Bacteria 2949
453 Ga0495589_0061067 3300046794 Bacteria 1850
454 Ga0495589_0079158 3300046794 Bacteria 1599
455 Ga0495600_0012846 3300046809 Bacteria 5245
456 Ga0495660_0000054 3300046810 Bacteria 135325
457 Ga0495660_0034429 3300046810 Bacteria 2834
458 Ga0495660_0072915 3300046810 Bacteria 1817
459 Ga0495581_0005609 3300047315 Bacteria 7275
460 Ga0495581_0039742 3300047315 Bacteria 2724
461 Ga0495604_0001376 3300047317 Bacteria 19927
462 Ga0495604_0002526 3300047317 Bacteria 14589
463 Ga0495636_0004016 3300047318 Bacteria 5750
464 Ga0495674_0031949 3300047319 Bacteria 4777
465 Ga0495672_0000253 3300047320 Bacteria 74560
466 Ga0495672_0001329 3300047320 Bacteria 24574
467 Ga0495672_0002190 3300047320 Bacteria 18196
468 Ga0495676_0003549 3300047321 Bacteria 14139
469 Ga0495676_0007630 3300047321 Bacteria 9922
470 Ga0495676_0024841 3300047321 Bacteria 5179
471 Ga0495676_0032458 3300047321 Bacteria 4406
472 Ga0495683_0004438 3300047323 Bacteria 7969
473 Ga0495683_0010058 3300047323 Bacteria 5017
474 Ga0495683_0025422 3300047323 Bacteria 3035
475 Ga0495687_000019 3300047443 Bacteria 341756
476 Ga0495687_000023 3300047443 Bacteria 317750
477 Ga0495687_000287 3300047443 Bacteria 66402
478 Ga0495687_000358 3300047443 Bacteria 57250
479 Ga0495687_000412 3300047443 Bacteria 52902
480 Ga0495687_019705 3300047443 Bacteria 3301
481 Ga0495687_059624 3300047443 Bacteria 1577
482 Ga0495675_0025269 3300047444 Bacteria 3787
483 Ga0495677_0000020 3300047445 Bacteria 107093
484 Ga0495677_0000451 3300047445 Bacteria 17521
485 Ga0495677_0000779 3300047445 Bacteria 12855
486 Ga0495679_007559 3300047446 Bacteria 4514
487 Ga0495673_0000033 3300047469 Bacteria 354152
488 Ga0495673_0000120 3300047469 Bacteria 144972
489 Ga0495681_0000354 3300047470 Bacteria 35817
490 Ga0495681_0011640 3300047470 Bacteria 5224
491 Ga0495684_0013971 3300047471 Bacteria 6176
492 Ga0495686_0000054 3300047472 Bacteria 259400
493 Ga0495686_0003153 3300047472 Bacteria 14540
494 Ga0495686_0009746 3300047472 Bacteria 6893
495 Ga0495593_0002940 3300047673 Bacteria 10254
496 Ga0495593_0076456 3300047673 Bacteria 1735
497 Ga0495602_0117958 3300048088 Bacteria 2141
498 Ga0495614_0002100 3300048089 Bacteria 8803
499 Ga0495614_0008179 3300048089 Bacteria 4651
500 Ga0495614_0067665 3300048089 Bacteria 1537
501 Ga0495626_0000800 3300048091 Bacteria 28478
502 Ga0495626_0001889 3300048091 Bacteria 15658
503 Ga0495626_0008085 3300048091 Bacteria 5802
504 Ga0495626_0016619 3300048091 Bacteria 3734
505 Ga0495626_0018630 3300048091 Bacteria 3482
506 Ga0495626_0038432 3300048091 Bacteria 2269
507 Ga0496102_0042564 3300048905 Bacteria 4115
508 Ga0496102_0161297 3300048905 Bacteria 2109
509 Ga0496104_0025309 3300048907 Bacteria 5470
510 Ga0496104_0031219 3300048907 Bacteria 4953
511 Ga0496105_0002913 3300048908 Bacteria 12555
512 Ga0496106_0001057 3300048909 Bacteria 20282
513 Ga0496106_0010225 3300048909 Bacteria 6935
514 Ga0496107_0069056 3300048910 Bacteria 2564
515 Ga0496108_0005277 3300048911 Bacteria 10430
516 Ga0496108_0008291 3300048911 Bacteria 8428
517 Ga0496109_0005868 3300048912 Bacteria 10299
518 Ga0496109_0079316 3300048912 Bacteria 3024
519 Ga0496110_0001600 3300048913 Bacteria 16555
520 Ga0496110_0016585 3300048913 Bacteria 6151
521 Ga0496110_0170806 3300048913 Bacteria 1973
522 Ga0496111_0002018 3300048914 Bacteria 12077
523 Ga0496111_0030388 3300048914 Bacteria 3840
524 Ga0496112_0012152 3300048915 Bacteria 7901
525 Ga0496113_0001957 3300048916 Bacteria 11799
526 Ga0496113_0002354 3300048916 Bacteria 10938
527 Ga0496114_0031403 3300048917 Bacteria 4371
528 Ga0496118_0093858 3300048921 Bacteria 2054
529 Ga0496119_0000595 3300048922 Bacteria 48961
530 Ga0496120_0012750 3300048923 Bacteria 5699
531 Ga0496121_0030178 3300048924 Bacteria 4986
532 Ga0496121_0104169 3300048924 Bacteria 2181
533 Ga0496122_0046284 3300048925 Bacteria 3371
534 Ga0496122_0076329 3300048925 Bacteria 2358
535 Ga0496123_0001793 3300048926 Bacteria 28269
536 Ga0496123_0002950 3300048926 Bacteria 19865
537 Ga0496124_0090698 3300048927 Bacteria 2492
538 Ga0496124_0093334 3300048927 Bacteria 2450
539 Ga0496124_0097533 3300048927 Bacteria 2386
540 Ga0496124_0131746 3300048927 Bacteria 1985
541 Ga0496124_0184131 3300048927 Bacteria 1604
542 Ga0496124_0220577 3300048927 Bacteria 1426
543 Ga0495678_000154 3300049459 Bacteria 82494
544 Ga0501033_0008365 3300049570 Bacteria 8012
545 Ga0501033_0051945 3300049570 Bacteria 3038
546 Ga0501037_0152417 3300049573 Bacteria 1651
547 Ga0501039_0063964 3300049575 Bacteria 2851
548 Ga0501042_0110097 3300049578 Bacteria 1983
549 Ga0501043_0042827 3300049579 Bacteria 3558
550 Ga0501046_0132310 3300049580 Bacteria 1891
551 Ga0501047_0241337 3300049581 Bacteria 1657
552 Ga0501048_0042396 3300049582 Bacteria 3258
553 Ga0501075_0012265 3300049591 Bacteria 6086
554 Ga0501076_0020851 3300049592 Bacteria 5019
555 Ga0501035_0002652 3300049822 Bacteria 17407
556 Ga0501035_0005722 3300049822 Bacteria 11722
557 Ga0501044_0001832 3300049823 Bacteria 24751
558 Ga0501044_0039888 3300049823 Bacteria 4895
559 nmdc:mga05p37_188172_c1 3300050507 Bacteria 2508
560 nmdc:mga05p37_21243_c1 3300050507 Bacteria 7858
561 nmdc:mga05p37_24_c1 3300050507 Bacteria 118187
562 nmdc:mga09592_149_c1 3300050508 Bacteria 31477
563 nmdc:mga09592_15640_c1 3300050508 Bacteria 6199
564 nmdc:mga09592_1957_c1 3300050508 Bacteria 16597
565 nmdc:mga09592_39874_c1 3300050508 Bacteria 3945
566 nmdc:mga0qj67_57_c2 3300050509 Bacteria 38742
567 nmdc:mga06r32_22_c1 3300050510 Bacteria 54748
568 nmdc:mga06r32_258837_c1 3300050510 Bacteria 1728
569 nmdc:mga06r32_4692_c1 3300050510 Bacteria 12275
570 nmdc:mga08y16_1631_c1 3300050511 Bacteria 22731
571 nmdc:mga08y16_73832_c1 3300050511 Bacteria 3554
572 nmdc:mga0n895_5324_c1 3300050512 Bacteria 10718
573 nmdc:mga0rr50_173053_c1 3300050513 Bacteria 1761
574 nmdc:mga0a205_3903_c1 3300050515 Bacteria 13340
575 Ga0495601_0035036 3300053077 Bacteria 3132
576 Ga0495619_0031433 3300053085 Bacteria 3440
577 Ga0495619_0035818 3300053085 Bacteria 3230
578 Ga0500583_0044263 3300053092 Bacteria 2038
579 Ga0500560_001901 3300053107 Bacteria 3816
580 Ga0500594_0002809 3300053118 Bacteria 3793
581 Ga0500618_000284 3300053125 Bacteria 38522
582 Ga0500586_000057 3300053145 Bacteria 20024
583 Ga0500588_0001588 3300053146 Bacteria 4376
584 Ga0500616_0007334 3300053153 Bacteria 7029
585 Ga0500634_0000179 3300053161 Bacteria 21017
586 Ga0501084_0054291 3300054114 Bacteria 3352
587 Ga0466962_0030309 3300061719 Bacteria 2590
588 Ga0466962_0044305 3300061719 Bacteria 2128
589 Ga0530510_0003599 3300061734 Bacteria 10668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0012333 Ga0495587_0012333_45_1238 389
2 3300048088 Ga0495602_0117958 Ga0495602_0117958_904_2097 389
3 iso_pu_bacteria 2899370129 2899376140 408
4 3300005937 Ga0081455_10000487 Ga0081455_1000048723 412
5 3300031995 Ga0307409_100048517 Ga0307409_1000485173 415
6 3300005937 Ga0081455_10000157 Ga0081455_1000015770 423
7 iso_pu_bacteria 2512564039 2512730740 424
8 3300046507 Ga0495606_0086159 Ga0495606_0086159_260_1594 425
9 3300048927 Ga0496124_0093334 Ga0496124_0093334_1066_2409 426
10 iso_pu_bacteria 2866612099 2866615891 426
11 3300005617 Ga0068859_100000001 Ga0068859_100000001128 428
12 3300006931 Ga0097620_100000001 Ga0097620_100000001128 428
13 3300033180 Ga0307510_10007347 Ga0307510_100073476 428
14 3300048921 Ga0496118_0093858 Ga0496118_0093858_715_2025 428
15 3300049591 Ga0501075_0012265 Ga0501075_0012265_3267_4607 428
16 3300049592 Ga0501076_0020851 Ga0501076_0020851_1739_3079 428
17 3300054114 Ga0501084_0054291 Ga0501084_0054291_1172_2512 428
18 3300061734 Ga0530510_0003599 Ga0530510_0003599_4793_6133 428
19 3300006844 Ga0075428_100007485 Ga0075428_1000074856 429
20 3300048922 Ga0496119_0000595 Ga0496119_0000595_31128_32495 429
21 3300048923 Ga0496120_0012750 Ga0496120_0012750_2196_3563 429
22 3300017792 Ga0163161_10087091 Ga0163161_100870911 430
23 3300031727 Ga0316576_10007855 Ga0316576_100078553 430
24 3300046475 Ga0495639_0025491 Ga0495639_0025491_1093_2430 430
25 3300005327 Ga0070658_10001438 Ga0070658_100014387 431
26 3300005327 Ga0070658_10015585 Ga0070658_100155852 431
27 3300005339 Ga0070660_100002035 Ga0070660_1000020352 431
28 3300005344 Ga0070661_100016713 Ga0070661_1000167133 431
29 3300005539 Ga0068853_100008565 Ga0068853_1000085654 431
30 3300005985 Ga0081539_10031245 Ga0081539_100312452 431
31 3300013102 Ga0157371_10013441 Ga0157371_100134414 431
32 3300013105 Ga0157369_10033434 Ga0157369_100334342 431
33 3300013307 Ga0157372_10039874 Ga0157372_100398742 431
34 3300013307 Ga0157372_10046203 Ga0157372_100462034 431
35 3300025909 Ga0207705_10002403 Ga0207705_100024032 431
36 3300025919 Ga0207657_10005761 Ga0207657_100057616 431
37 3300025920 Ga0207649_10034910 Ga0207649_100349102 431
38 3300026116 Ga0207674_10029511 Ga0207674_100295115 431
39 3300005444 Ga0070694_100040884 Ga0070694_1000408842 432
40 3300006846 Ga0075430_100068710 Ga0075430_1000687102 432
41 3300006847 Ga0075431_100004085 Ga0075431_1000040857 432
42 3300006880 Ga0075429_100002277 Ga0075429_1000022778 432
43 3300006880 Ga0075429_100040299 Ga0075429_1000402992 432
44 3300050508 nmdc:mga09592_15640_c1 nmdc:mga09592_15640_c1_235_1599 432
45 3300050508 nmdc:mga09592_1957_c1 nmdc:mga09592_1957_c1_13418_14776 432
46 3300003771 Ga0055526_1000487 Ga0055526_10004878 433
47 3300003773 Ga0055537_1000035 Ga0055537_100003557 433
48 3300003775 Ga0055524_1005183 Ga0055524_10051834 433
49 3300003784 Ga0055534_1000325 Ga0055534_100032519 433
50 3300003790 Ga0055528_1000058 Ga0055528_100005828 433
51 3300025263 Ga0209565_1000009 Ga0209565_1000009625 433
52 3300025273 Ga0209673_1000036 Ga0209673_100003658 433
53 3300025291 Ga0209675_1000013 Ga0209675_100001358 433
54 3300025295 Ga0209564_1000122 Ga0209564_100012258 433
55 3300025299 Ga0209256_1000106 Ga0209256_1000106118 433
56 iso_pu_bacteria 2821131069 2821135508 433
57 iso_pu_bacteria 2895427314 2895433817 433
58 3300003316 rootH1_10044769 rootH1_100447693 435
59 3300005530 Ga0070679_100010283 Ga0070679_1000102832 435
60 3300044712 Ga0453684_0038591 Ga0453684_0038591_3221_4570 435
61 3300046694 Ga0495649_0041662 Ga0495649_0041662_1017_2342 435
62 3300047445 Ga0495677_0000451 Ga0495677_0000451_7225_8547 435
63 iso_pu_bacteria 2738541297 2738825866 435
64 iso_pu_bacteria 2738541357 2739149663 435
65 iso_pu_bacteria 2738543003 2739191582 435
66 iso_pu_bacteria 2738543026 2739318059 435
67 iso_pu_bacteria 2738543029 2739336300 435
68 iso_pu_bacteria 2808606418 2809142852 435
69 iso_pu_bacteria 2842711865 2842713905 435
70 iso_pu_bacteria 2857564685 2857566268 435
71 iso_pu_bacteria 8047673197 8047679089 435
72 3300013102 Ga0157371_10000003 Ga0157371_10000003443 436
73 3300014497 Ga0182008_10009447 Ga0182008_100094472 436
74 3300031240 Ga0265320_10009848 Ga0265320_100098482 436
75 3300042876 Ga0451577_0000012 Ga0451577_0000012_339145_340518 436
76 3300046477 Ga0495664_0143757 Ga0495664_0143757_84_1436 436
77 3300046558 Ga0495633_0003289 Ga0495633_0003289_1141_2490 436
78 3300046665 Ga0495661_0078861 Ga0495661_0078861_301_1650 436
79 3300048924 Ga0496121_0030178 Ga0496121_0030178_724_2058 436
80 3300048927 Ga0496124_0097533 Ga0496124_0097533_844_2187 436
81 3300053161 Ga0500634_0000179 Ga0500634_0000179_8925_10274 436
82 iso_pu_bacteria 2643221556 2643800991 436
83 iso_pu_bacteria 2643221684 2644473359 436
84 3300003323 rootH1_10004943 rootH1_100049433 437
85 3300033179 Ga0307507_10007393 Ga0307507_100073939 437
86 3300033180 Ga0307510_10053173 Ga0307510_100531733 437
87 3300046452 Ga0495617_000139 Ga0495617_000139_39056_40393 437
88 3300046463 Ga0495653_0000018 Ga0495653_0000018_87575_88912 437
89 3300046492 Ga0495585_0000418 Ga0495585_0000418_3667_5004 437
90 3300046507 Ga0495606_0000269 Ga0495606_0000269_64475_65812 437
91 3300046524 Ga0495648_0003084 Ga0495648_0003084_13064_14401 437
92 3300046530 Ga0495654_0009991 Ga0495654_0009991_1944_3281 437
93 3300047323 Ga0495683_0025422 Ga0495683_0025422_767_2104 437
94 3300047469 Ga0495673_0000120 Ga0495673_0000120_103824_105161 437
95 3300003759 Ga0055525_1000025 Ga0055525_100002560 438
96 3300003763 Ga0055529_1000133 Ga0055529_100013330 438
97 3300005564 Ga0070664_100091397 Ga0070664_1000913972 438
98 3300025230 Ga0209563_100003 Ga0209563_100003835 438
99 3300025245 Ga0207425_1000202 Ga0207425_100020234 438
100 3300025253 Ga0209677_104852 Ga0209677_1048523 438
101 3300025254 Ga0209148_1000590 Ga0209148_100059023 438
102 3300025272 Ga0209455_1000063 Ga0209455_1000063159 438
103 3300025294 Ga0209025_1001180 Ga0209025_100118024 438
104 3300025297 Ga0209758_1000372 Ga0209758_100037271 438
105 3300025919 Ga0207657_10010908 Ga0207657_100109083 438
106 3300025945 Ga0207679_10060464 Ga0207679_100604642 438
107 3300037312 Ga0395899_0070221 Ga0395899_0070221_910_2247 438
108 3300037418 Ga0395900_0185206 Ga0395900_0185206_413_1750 438
109 3300037471 Ga0395905_0135372 Ga0395905_0135372_132_1469 438
110 3300038443 Ga0395901_0159532 Ga0395901_0159532_910_2247 438
111 3300044658 Ga0466972_0001798 Ga0466972_0001798_736_2073 438
112 3300044683 Ga0466965_0006602 Ga0466965_0006602_1093_2430 438
113 3300044683 Ga0466965_0019858 Ga0466965_0019858_561_1898 438
114 3300044684 Ga0466966_0019005 Ga0466966_0019005_1506_2843 438
115 3300044684 Ga0466966_0052762 Ga0466966_0052762_320_1657 438
116 3300044706 Ga0466964_0001830 Ga0466964_0001830_3978_5315 438
117 3300044735 Ga0466968_0021696 Ga0466968_0021696_295_1632 438
118 3300044842 Ga0466957_0003950 Ga0466957_0003950_6692_8029 438
119 3300045049 Ga0466959_0020684 Ga0466959_0020684_2384_3721 438
120 3300046457 Ga0495590_0000314 Ga0495590_0000314_12121_13461 438
121 3300046460 Ga0495638_0000067 Ga0495638_0000067_1625_2965 438
122 3300046460 Ga0495638_0058219 Ga0495638_0058219_527_1867 438
123 3300046471 Ga0495650_0000239 Ga0495650_0000239_10082_11431 438
124 3300046471 Ga0495650_0000305 Ga0495650_0000305_51156_52496 438
125 3300046471 Ga0495650_0000472 Ga0495650_0000472_45983_47323 438
126 3300046471 Ga0495650_0002496 Ga0495650_0002496_11877_13217 438
127 3300046471 Ga0495650_0013594 Ga0495650_0013594_497_1837 438
128 3300046474 Ga0495605_0000005 Ga0495605_0000005_194381_195721 438
129 3300046474 Ga0495605_0000117 Ga0495605_0000117_28499_29836 438
130 3300046474 Ga0495605_0027462 Ga0495605_0027462_1056_2393 438
131 3300046474 Ga0495605_0028670 Ga0495605_0028670_260_1609 438
132 3300046500 Ga0495596_0003323 Ga0495596_0003323_155_1504 438
133 3300046500 Ga0495596_0004822 Ga0495596_0004822_4391_5728 438
134 3300046501 Ga0495607_0021878 Ga0495607_0021878_888_2225 438
135 3300046506 Ga0495583_0000160 Ga0495583_0000160_37988_39325 438
136 3300046506 Ga0495583_0000162 Ga0495583_0000162_109661_111001 438
137 3300046507 Ga0495606_0000783 Ga0495606_0000783_34736_36076 438
138 3300046507 Ga0495606_0001207 Ga0495606_0001207_34791_36131 438
139 3300046512 Ga0495610_0000021 Ga0495610_0000021_162338_163678 438
140 3300046512 Ga0495610_0015782 Ga0495610_0015782_2469_3809 438
141 3300046513 Ga0495616_0026271 Ga0495616_0026271_921_2258 438
142 3300046518 Ga0495631_0008030 Ga0495631_0008030_1214_2551 438
143 3300046519 Ga0495632_0011173 Ga0495632_0011173_1321_2658 438
144 3300046520 Ga0495637_0000057 Ga0495637_0000057_56569_57909 438
145 3300046522 Ga0495643_0000118 Ga0495643_0000118_71257_72597 438
146 3300046522 Ga0495643_0000212 Ga0495643_0000212_14841_16181 438
147 3300046522 Ga0495643_0000263 Ga0495643_0000263_61178_62515 438
148 3300046522 Ga0495643_0001396 Ga0495643_0001396_6105_7442 438
149 3300046523 Ga0495644_0014730 Ga0495644_0014730_791_2128 438
150 3300046524 Ga0495648_0000008 Ga0495648_0000008_229552_230892 438
151 3300046524 Ga0495648_0012918 Ga0495648_0012918_2481_3830 438
152 3300046528 Ga0495642_0006502 Ga0495642_0006502_1547_2887 438
153 3300046530 Ga0495654_0000005 Ga0495654_0000005_135621_136961 438
154 3300046538 Ga0495609_0000269 Ga0495609_0000269_10065_11414 438
155 3300046542 Ga0495597_0000027 Ga0495597_0000027_54218_55558 438
156 3300046542 Ga0495597_0000917 Ga0495597_0000917_7098_8438 438
157 3300046557 Ga0495622_0000060 Ga0495622_0000060_93594_94934 438
158 3300046558 Ga0495633_0000128 Ga0495633_0000128_57041_58381 438
159 3300046558 Ga0495633_0001536 Ga0495633_0001536_14713_16053 438
160 3300046558 Ga0495633_0079309 Ga0495633_0079309_167_1507 438
161 3300046558 Ga0495633_0083155 Ga0495633_0083155_40_1380 438
162 3300046616 Ga0495668_0000144 Ga0495668_0000144_8941_10281 438
163 3300046616 Ga0495668_0001247 Ga0495668_0001247_11466_12806 438
164 3300046616 Ga0495668_0002800 Ga0495668_0002800_6508_7848 438
165 3300046616 Ga0495668_0082152 Ga0495668_0082152_415_1752 438
166 3300046660 Ga0495625_0000192 Ga0495625_0000192_94185_95525 438
167 3300046660 Ga0495625_0003424 Ga0495625_0003424_7628_8968 438
168 3300046665 Ga0495661_0000872 Ga0495661_0000872_1402_2739 438
169 3300046691 Ga0495670_0045592 Ga0495670_0045592_472_1812 438
170 3300046692 Ga0495671_0000024 Ga0495671_0000024_32998_34338 438
171 3300046694 Ga0495649_0000715 Ga0495649_0000715_10475_11812 438
172 3300046694 Ga0495649_0002538 Ga0495649_0002538_2806_4146 438
173 3300046794 Ga0495589_0000974 Ga0495589_0000974_2304_3641 438
174 3300046794 Ga0495589_0026299 Ga0495589_0026299_1359_2708 438
175 3300046794 Ga0495589_0061067 Ga0495589_0061067_391_1728 438
176 3300046810 Ga0495660_0000054 Ga0495660_0000054_13734_15071 438
177 3300046810 Ga0495660_0034429 Ga0495660_0034429_604_1944 438
178 3300046810 Ga0495660_0072915 Ga0495660_0072915_406_1746 438
179 3300047320 Ga0495672_0000253 Ga0495672_0000253_54497_55837 438
180 3300047320 Ga0495672_0001329 Ga0495672_0001329_15657_16994 438
181 3300047320 Ga0495672_0002190 Ga0495672_0002190_10046_11395 438
182 3300047323 Ga0495683_0004438 Ga0495683_0004438_3893_5242 438
183 3300047323 Ga0495683_0010058 Ga0495683_0010058_1122_2459 438
184 3300047443 Ga0495687_000287 Ga0495687_000287_9924_11261 438
185 3300047443 Ga0495687_000358 Ga0495687_000358_36191_37531 438
186 3300047443 Ga0495687_000412 Ga0495687_000412_24775_26115 438
187 3300047445 Ga0495677_0000779 Ga0495677_0000779_2249_3586 438
188 3300047446 Ga0495679_007559 Ga0495679_007559_1284_2621 438
189 3300047469 Ga0495673_0000033 Ga0495673_0000033_152754_154094 438
190 3300047470 Ga0495681_0011640 Ga0495681_0011640_545_1882 438
191 3300047472 Ga0495686_0000054 Ga0495686_0000054_211332_212669 438
192 3300047472 Ga0495686_0009746 Ga0495686_0009746_1994_3334 438
193 3300048091 Ga0495626_0000800 Ga0495626_0000800_7541_8878 438
194 3300048091 Ga0495626_0008085 Ga0495626_0008085_3850_5187 438
195 3300048091 Ga0495626_0016619 Ga0495626_0016619_478_1815 438
196 3300048091 Ga0495626_0018630 Ga0495626_0018630_611_1948 438
197 3300048091 Ga0495626_0038432 Ga0495626_0038432_111_1448 438
198 3300048925 Ga0496122_0046284 Ga0496122_0046284_733_2073 438
199 3300048925 Ga0496122_0076329 Ga0496122_0076329_819_2156 438
200 3300048926 Ga0496123_0001793 Ga0496123_0001793_22799_24136 438
201 3300048926 Ga0496123_0002950 Ga0496123_0002950_15845_17185 438
202 3300048927 Ga0496124_0090698 Ga0496124_0090698_972_2309 438
203 3300048927 Ga0496124_0184131 Ga0496124_0184131_211_1548 438
204 3300048927 Ga0496124_0220577 Ga0496124_0220577_40_1380 438
205 3300049459 Ga0495678_000154 Ga0495678_000154_8819_10159 438
206 3300053118 Ga0500594_0002809 Ga0500594_0002809_2417_3757 438
207 3300053125 Ga0500618_000284 Ga0500618_000284_27816_29156 438
208 3300053145 Ga0500586_000057 Ga0500586_000057_10075_11415 438
209 3300005329 Ga0070683_100010242 Ga0070683_1000102423 439
210 3300005535 Ga0070684_100039817 Ga0070684_1000398172 439
211 3300025944 Ga0207661_10015667 Ga0207661_100156671 439
212 3300031838 Ga0307518_10028309 Ga0307518_100283094 439
213 3300046665 Ga0495661_0058750 Ga0495661_0058750_433_1773 439
214 3300046674 Ga0495588_0000089 Ga0495588_0000089_105329_106669 439
215 3300048924 Ga0496121_0104169 Ga0496121_0104169_680_2020 439
216 3300049570 Ga0501033_0008365 Ga0501033_0008365_6016_7356 440
217 3300049823 Ga0501044_0001832 Ga0501044_0001832_3607_4947 440
218 iso_pu_bacteria 2675903059 2676481948 440
219 3300003322 rootL2_10106560 rootL2_101065602 442
220 3300048927 Ga0496124_0131746 Ga0496124_0131746_373_1776 442
221 3300037418 Ga0395900_0000324 Ga0395900_0000324_31609_33006 443
222 3300038443 Ga0395901_0000089 Ga0395901_0000089_91787_93184 443
223 3300042005 Ga0439448_0000868 Ga0439448_0000868_2759_4171 443
224 3300042012 Ga0439455_0001890 Ga0439455_0001890_136_1548 443
225 3300044706 Ga0466964_0001817 Ga0466964_0001817_4646_6058 443
226 3300045976 Ga0466967_0009040 Ga0466967_0009040_1138_2550 443
227 3300045976 Ga0466967_0064223 Ga0466967_0064223_1740_3176 443
228 3300046474 Ga0495605_0011372 Ga0495605_0011372_3003_4442 443
229 3300046491 Ga0495584_0005832 Ga0495584_0005832_3260_4699 443
230 3300046501 Ga0495607_0018097 Ga0495607_0018097_11_1687 443
231 3300046513 Ga0495616_0013425 Ga0495616_0013425_355_1794 443
232 3300046538 Ga0495609_0000001 Ga0495609_0000001_246164_247603 443
233 3300046665 Ga0495661_0000663 Ga0495661_0000663_29799_31238 443
234 3300046794 Ga0495589_0000027 Ga0495589_0000027_3435_4874 443
235 3300047443 Ga0495687_000019 Ga0495687_000019_246164_247603 443
236 3300047445 Ga0495677_0000020 Ga0495677_0000020_75364_76803 443
237 3300048091 Ga0495626_0001889 Ga0495626_0001889_12564_14003 443
238 3300048909 Ga0496106_0001057 Ga0496106_0001057_8671_10059 443
239 3300048913 Ga0496110_0170806 Ga0496110_0170806_502_1872 443
240 3300048916 Ga0496113_0001957 Ga0496113_0001957_1053_2489 443
241 3300049822 Ga0501035_0002652 Ga0501035_0002652_1898_3295 443
242 3300046491 Ga0495584_0000186 Ga0495584_0000186_16038_17426 444
243 3300046507 Ga0495606_0003466 Ga0495606_0003466_8727_10115 444
244 3300047443 Ga0495687_000023 Ga0495687_000023_298993_300381 444
245 3300005329 Ga0070683_100007980 Ga0070683_1000079807 445
246 3300005334 Ga0068869_100002123 Ga0068869_1000021232 445
247 3300005338 Ga0068868_100010999 Ga0068868_1000109993 445
248 3300005345 Ga0070692_10012284 Ga0070692_100122842 445
249 3300005354 Ga0070675_100000500 Ga0070675_1000005003 445
250 3300005366 Ga0070659_100042397 Ga0070659_1000423972 445
251 3300005455 Ga0070663_100011692 Ga0070663_1000116924 445
252 3300005535 Ga0070684_100027367 Ga0070684_1000273674 445
253 3300005564 Ga0070664_100000986 Ga0070664_10000098620 445
254 3300005577 Ga0068857_100001211 Ga0068857_1000012116 445
255 3300005614 Ga0068856_100069747 Ga0068856_1000697472 445
256 3300005615 Ga0070702_100007666 Ga0070702_1000076662 445
257 3300005844 Ga0068862_100183893 Ga0068862_1001838931 445
258 3300006881 Ga0068865_100035342 Ga0068865_1000353422 445
259 3300009094 Ga0111539_10001734 Ga0111539_1000173413 445
260 3300009098 Ga0105245_10001884 Ga0105245_100018845 445
261 3300025926 Ga0207659_10013895 Ga0207659_100138954 445
262 3300025927 Ga0207687_10007814 Ga0207687_100078143 445
263 3300025932 Ga0207690_10044452 Ga0207690_100444522 445
264 3300025938 Ga0207704_10034889 Ga0207704_100348892 445
265 3300025942 Ga0207689_10022071 Ga0207689_100220712 445
266 3300025944 Ga0207661_10040245 Ga0207661_100402452 445
267 3300025945 Ga0207679_10034266 Ga0207679_100342662 445
268 3300026067 Ga0207678_10022373 Ga0207678_100223732 445
269 3300026075 Ga0207708_10003232 Ga0207708_100032326 445
270 3300026116 Ga0207674_10003876 Ga0207674_1000387615 445
271 3300026142 Ga0207698_10073646 Ga0207698_100736462 445
272 3300027907 Ga0207428_10013648 Ga0207428_100136483 445
273 3300028380 Ga0268265_10083036 Ga0268265_100830362 445
274 3300031995 Ga0307409_100079780 Ga0307409_1000797802 445
275 3300050511 nmdc:mga08y16_1631_c1 nmdc:mga08y16_1631_c1_10483_11844 445
276 3300031649 Ga0307514_10063459 Ga0307514_100634593 447
277 3300044683 Ga0466965_0008661 Ga0466965_0008661_713_2077 448
278 3300005329 Ga0070683_100007512 Ga0070683_1000075128 449
279 3300005344 Ga0070661_100049817 Ga0070661_1000498173 449
280 3300005345 Ga0070692_10014463 Ga0070692_100144632 449
281 3300005347 Ga0070668_100088582 Ga0070668_1000885822 449
282 3300005354 Ga0070675_100003832 Ga0070675_1000038326 449
283 3300005366 Ga0070659_100001502 Ga0070659_1000015026 449
284 3300005455 Ga0070663_100038366 Ga0070663_1000383662 449
285 3300005535 Ga0070684_100009947 Ga0070684_1000099473 449
286 3300005564 Ga0070664_100001017 Ga0070664_1000010178 449
287 3300005615 Ga0070702_100028520 Ga0070702_1000285202 449
288 3300005616 Ga0068852_100037469 Ga0068852_1000374693 449
289 3300005842 Ga0068858_100140953 Ga0068858_1001409533 449
290 3300005844 Ga0068862_100003795 Ga0068862_1000037959 449
291 3300009094 Ga0111539_10002939 Ga0111539_100029399 449
292 3300009098 Ga0105245_10006225 Ga0105245_100062256 449
293 3300010375 Ga0105239_10059327 Ga0105239_100593273 449
294 3300013308 Ga0157375_10056496 Ga0157375_100564962 449
295 3300014745 Ga0157377_10007093 Ga0157377_100070933 449
296 3300021388 Ga0213875_10000499 Ga0213875_1000049920 449
297 3300025926 Ga0207659_10001668 Ga0207659_100016687 449
298 3300025933 Ga0207706_10004525 Ga0207706_100045259 449
299 3300025944 Ga0207661_10042483 Ga0207661_100424832 449
300 3300025972 Ga0207668_10078930 Ga0207668_100789302 449
301 3300026023 Ga0207677_10009501 Ga0207677_100095012 449
302 3300026035 Ga0207703_10111408 Ga0207703_101114083 449
303 3300026067 Ga0207678_10010910 Ga0207678_100109106 449
304 3300026121 Ga0207683_10077049 Ga0207683_100770492 449
305 3300028380 Ga0268265_10003188 Ga0268265_100031884 449
306 3300037853 Ga0436364_1386442 Ga0436364_1386442_25670_27079 449
307 3300050511 nmdc:mga08y16_73832_c1 nmdc:mga08y16_73832_c1_789_2162 449
308 3300005985 Ga0081539_10000128 Ga0081539_1000012814 451
309 3300048905 Ga0496102_0161297 Ga0496102_0161297_178_1545 451
310 3300048917 Ga0496114_0031403 Ga0496114_0031403_1172_2539 451
311 iso_pu_bacteria 2997600082 2997607995 451
312 iso_pu_bacteria 2751185734 2753071236 452
313 iso_pu_bacteria 2870721527 2870721961 452
314 iso_pu_bacteria 8047710418 8047712707 452
315 3300031665 Ga0316575_10000010 Ga0316575_1000001013 453
316 3300046454 Ga0495592_0002377 Ga0495592_0002377_3658_5082 453
317 3300046462 Ga0495651_0001434 Ga0495651_0001434_8206_9630 453
318 3300046463 Ga0495653_0024485 Ga0495653_0024485_2964_4388 453
319 3300046476 Ga0495662_0000316 Ga0495662_0000316_9322_10746 453
320 3300046477 Ga0495664_0001280 Ga0495664_0001280_3385_4809 453
321 3300046511 Ga0495608_0001532 Ga0495608_0001532_14597_16021 453
322 3300046516 Ga0495628_0004838 Ga0495628_0004838_6307_7731 453
323 3300046526 Ga0495666_0001077 Ga0495666_0001077_10044_11468 453
324 3300046531 Ga0495665_0000346 Ga0495665_0000346_15070_16494 453
325 3300046533 Ga0495640_0008329 Ga0495640_0008329_1431_2855 453
326 3300046535 Ga0495586_0011130 Ga0495586_0011130_1431_2855 453
327 3300046543 Ga0495645_0002377 Ga0495645_0002377_1206_2630 453
328 3300046559 Ga0495667_0001088 Ga0495667_0001088_10898_12322 453
329 3300046642 Ga0495634_0038089 Ga0495634_0038089_1538_2962 453
330 3300046663 Ga0495635_0010158 Ga0495635_0010158_2835_4259 453
331 3300046675 Ga0495657_0005278 Ga0495657_0005278_318_1742 453
332 3300046678 Ga0495599_0002673 Ga0495599_0002673_776_2200 453
333 3300046679 Ga0495623_0039407 Ga0495623_0039407_476_1900 453
334 3300046680 Ga0495646_0002071 Ga0495646_0002071_3581_5005 453
335 3300046809 Ga0495600_0012846 Ga0495600_0012846_2578_4002 453
336 3300047315 Ga0495581_0005609 Ga0495581_0005609_1275_2699 453
337 3300047317 Ga0495604_0001376 Ga0495604_0001376_10145_11569 453
338 3300047319 Ga0495674_0031949 Ga0495674_0031949_776_2200 453
339 3300047444 Ga0495675_0025269 Ga0495675_0025269_1244_2668 453
340 3300047471 Ga0495684_0013971 Ga0495684_0013971_2196_3620 453
341 3300053077 Ga0495601_0035036 Ga0495601_0035036_1416_2840 453
342 3300053085 Ga0495619_0031433 Ga0495619_0031433_18_1442 453
343 3300005434 Ga0070709_10030767 Ga0070709_100307674 454
344 3300005435 Ga0070714_100007850 Ga0070714_1000078507 454
345 3300005437 Ga0070710_10001747 Ga0070710_100017476 454
346 3300025898 Ga0207692_10001543 Ga0207692_100015435 454
347 3300025906 Ga0207699_10085472 Ga0207699_100854722 454
348 3300044694 Ga0466963_0006646 Ga0466963_0006646_1973_3412 454
349 3300005437 Ga0070710_10008929 Ga0070710_100089294 455
350 3300006844 Ga0075428_100008826 Ga0075428_1000088266 455
351 3300006846 Ga0075430_100025090 Ga0075430_1000250902 455
352 3300006847 Ga0075431_100032957 Ga0075431_1000329572 455
353 3300006880 Ga0075429_100027382 Ga0075429_1000273825 455
354 3300009147 Ga0114129_10044528 Ga0114129_100445282 455
355 3300025898 Ga0207692_10084359 Ga0207692_100843592 455
356 3300025928 Ga0207700_10046870 Ga0207700_100468702 455
357 3300050507 nmdc:mga05p37_21243_c1 nmdc:mga05p37_21243_c1_1151_2578 455
358 3300050508 nmdc:mga09592_39874_c1 nmdc:mga09592_39874_c1_2080_3507 455
359 3300050510 nmdc:mga06r32_4692_c1 nmdc:mga06r32_4692_c1_10593_12020 455
360 iso_pu_bacteria 2946003308 2946005813 455
361 3300005329 Ga0070683_100000951 Ga0070683_1000009513 456
362 3300005564 Ga0070664_100011712 Ga0070664_1000117123 456
363 3300025944 Ga0207661_10003256 Ga0207661_100032568 456
364 3300025945 Ga0207679_10003806 Ga0207679_100038064 456
365 iso_pu_bacteria 2808606700 2810362853 456
366 iso_pu_bacteria 2873151551 2873156316 456
367 iso_pu_bacteria 2905926851 2905929494 456
368 3300031824 Ga0307413_10054688 Ga0307413_100546882 457
369 3300046459 Ga0495629_0010634 Ga0495629_0010634_3306_4715 457
370 iso_pu_bacteria 3006493962 3006496350 457
371 3300025303 Ga0209051_1017704 Ga0209051_10177043 458
372 3300031824 Ga0307413_10005800 Ga0307413_100058003 458
373 3300053085 Ga0495619_0035818 Ga0495619_0035818_437_1849 458
374 iso_pu_bacteria 2912723979 2912724814 458
375 3300049570 Ga0501033_0051945 Ga0501033_0051945_164_1582 459
376 3300049573 Ga0501037_0152417 Ga0501037_0152417_116_1534 459
377 3300049578 Ga0501042_0110097 Ga0501042_0110097_207_1625 459
378 3300049579 Ga0501043_0042827 Ga0501043_0042827_288_1706 459
379 3300049580 Ga0501046_0132310 Ga0501046_0132310_270_1688 459
380 3300049581 Ga0501047_0241337 Ga0501047_0241337_148_1566 459
381 3300049582 Ga0501048_0042396 Ga0501048_0042396_1571_2989 459
382 3300049822 Ga0501035_0005722 Ga0501035_0005722_6958_8376 459
383 3300049823 Ga0501044_0039888 Ga0501044_0039888_506_1924 459
384 iso_pu_bacteria 2622736626 2623587463 459
385 iso_pu_bacteria 2811994879 2812358756 459
386 iso_pu_bacteria 2852635781 2852641953 459
387 iso_pu_bacteria 2862281513 2862287885 459
388 iso_pu_bacteria 2912715099 2912720649 459
389 iso_pu_bacteria 2946064051 2946067121 459
390 iso_pu_bacteria 2947224130 2947230117 459
391 3300046455 Ga0495603_0001268 Ga0495603_0001268_1761_3179 460
392 3300046459 Ga0495629_0010442 Ga0495629_0010442_1997_3415 460
393 3300046475 Ga0495639_0015258 Ga0495639_0015258_56_1474 460
394 3300046559 Ga0495667_0057688 Ga0495667_0057688_422_1879 460
395 iso_pu_bacteria 2547132111 2547407018 460
396 iso_pu_bacteria 2582581314 2585319736 460
397 iso_pu_bacteria 2616644814 2616697600 460
398 iso_pu_bacteria 2772190715 2772643850 460
399 iso_pu_bacteria 2784132148 2784588057 460
400 iso_pu_bacteria 2784746763 2785344002 460
401 iso_pu_bacteria 2808606448 2809231657 460
402 iso_pu_bacteria 2855670206 2855672832 460
403 iso_pu_bacteria 2855676851 2855677292 460
404 iso_pu_bacteria 2857288857 2857294835 460
405 iso_pu_bacteria 2858848962 2858855470 460
406 iso_pu_bacteria 2858882152 2858885443 460
407 iso_pu_bacteria 2858888857 2858892239 460
408 iso_pu_bacteria 2858895516 2858902072 460
409 iso_pu_bacteria 2862382967 2862392899 460
410 iso_pu_bacteria 2863404153 2863405292 460
411 iso_pu_bacteria 2869048445 2869055193 460
412 iso_pu_bacteria 2869061728 2869062895 460
413 iso_pu_bacteria 2869068681 2869072509 460
414 iso_pu_bacteria 2880489317 2880492765 460
415 iso_pu_bacteria 2880495981 2880499549 460
416 iso_pu_bacteria 2929226422 2929228140 460
417 iso_pu_bacteria 2990059506 2990065560 460
418 iso_pu_bacteria 8003870546 8003875351 460
419 iso_pu_bacteria 8008558824 8008559786 460
420 iso_pu_bacteria 8023623736 8023631057 460
421 iso_pu_bacteria 8048406513 8048413303 460
422 iso_pu_bacteria 8054704163 8054705988 460
423 iso_pu_bacteria 8054727385 8054732188 460
424 iso_pu_bacteria 8054734606 8054740939 460
425 3300005618 Ga0068864_100029219 Ga0068864_1000292195 461
426 3300005841 Ga0068863_100055968 Ga0068863_1000559683 461
427 3300005842 Ga0068858_100048426 Ga0068858_1000484262 461
428 3300006844 Ga0075428_100000249 Ga0075428_10000024929 461
429 3300006846 Ga0075430_100013782 Ga0075430_1000137823 461
430 3300006847 Ga0075431_100012731 Ga0075431_1000127314 461
431 3300006880 Ga0075429_100014279 Ga0075429_1000142793 461
432 3300009147 Ga0114129_10000352 Ga0114129_1000035228 461
433 3300014325 Ga0163163_10002454 Ga0163163_100024547 461
434 3300014968 Ga0157379_10152151 Ga0157379_101521512 461
435 3300025906 Ga0207699_10082168 Ga0207699_100821682 461
436 3300025932 Ga0207690_10134550 Ga0207690_101345502 461
437 3300025941 Ga0207711_10036486 Ga0207711_100364862 461
438 3300026095 Ga0207676_10088794 Ga0207676_100887942 461
439 3300026116 Ga0207674_10118652 Ga0207674_101186522 461
440 3300044656 Ga0466969_0071787 Ga0466969_0071787_22_1455 461
441 3300044658 Ga0466972_0001015 Ga0466972_0001015_1315_2748 461
442 3300044683 Ga0466965_0098090 Ga0466965_0098090_38_1471 461
443 3300044684 Ga0466966_0045675 Ga0466966_0045675_33_1466 461
444 3300044719 Ga0466971_0010922 Ga0466971_0010922_1094_2527 461
445 3300044735 Ga0466968_0017129 Ga0466968_0017129_1441_2874 461
446 3300044765 Ga0466970_0001976 Ga0466970_0001976_3552_5021 461
447 3300048907 Ga0496104_0031219 Ga0496104_0031219_394_1905 461
448 3300048911 Ga0496108_0008291 Ga0496108_0008291_3703_5214 461
449 3300048912 Ga0496109_0005868 Ga0496109_0005868_2419_3930 461
450 3300048913 Ga0496110_0016585 Ga0496110_0016585_3578_5089 461
451 3300048914 Ga0496111_0030388 Ga0496111_0030388_1913_3424 461
452 3300048915 Ga0496112_0012152 Ga0496112_0012152_3210_4721 461
453 3300048916 Ga0496113_0002354 Ga0496113_0002354_5707_7218 461
454 3300050507 nmdc:mga05p37_24_c1 nmdc:mga05p37_24_c1_26512_27918 461
455 3300050508 nmdc:mga09592_149_c1 nmdc:mga09592_149_c1_23811_25217 461
456 3300050509 nmdc:mga0qj67_57_c2 nmdc:mga0qj67_57_c2_31076_32482 461
457 3300050510 nmdc:mga06r32_22_c1 nmdc:mga06r32_22_c1_22353_23759 461
458 3300061719 Ga0466962_0044305 Ga0466962_0044305_261_1694 461
459 iso_pu_bacteria 2501939600 2501945714 461
460 iso_pu_bacteria 2818991463 2819693485 461
461 iso_pu_bacteria 2831935698 2831938577 461
462 iso_pu_bacteria 2855683550 2855688159 461
463 iso_pu_bacteria 2856858025 2856861330 461
464 iso_pu_bacteria 2858868258 2858875598 461
465 iso_pu_bacteria 2867302475 2867305814 461
466 iso_pu_bacteria 2902582711 2902587741 461
467 iso_pu_bacteria 2929219909 2929221512 461
468 iso_pu_bacteria 2966598605 2966603102 461
469 iso_pu_bacteria 3006425503 3006426753 461
470 iso_pu_bacteria 649633069 649812084 461
471 iso_pu_bacteria 8003830390 8003830840 461
472 3300005618 Ga0068864_100077496 Ga0068864_1000774961 462
473 3300009148 Ga0105243_10124359 Ga0105243_101243591 462
474 3300015688 Ga0183367_1006 Ga0183367_1006244 462
475 3300028786 Ga0307517_10008362 Ga0307517_100083627 462
476 3300028794 Ga0307515_10008666 Ga0307515_1000866618 462
477 3300030521 Ga0307511_10001845 Ga0307511_1000184517 462
478 3300031456 Ga0307513_10020885 Ga0307513_100208857 462
479 3300031507 Ga0307509_10009951 Ga0307509_100099512 462
480 3300031507 Ga0307509_10011427 Ga0307509_100114273 462
481 3300033179 Ga0307507_10016591 Ga0307507_100165913 462
482 3300037466 Ga0395898_0051003 Ga0395898_0051003_2512_3948 462
483 3300041404 Ga0439436_0000330 Ga0439436_0000330_9297_10733 462
484 3300041406 Ga0439439_0012517 Ga0439439_0012517_231_1667 462
485 3300042007 Ga0439449_0000183 Ga0439449_0000183_13523_14959 462
486 3300042014 Ga0439457_000664 Ga0439457_000664_3033_4469 462
487 3300044656 Ga0466969_0005538 Ga0466969_0005538_4366_5802 462
488 3300044683 Ga0466965_0001465 Ga0466965_0001465_6507_7943 462
489 3300044684 Ga0466966_0003922 Ga0466966_0003922_8271_9707 462
490 3300044693 Ga0466961_0014839 Ga0466961_0014839_2592_4028 462
491 3300044694 Ga0466963_0091633 Ga0466963_0091633_256_1692 462
492 3300044706 Ga0466964_0062452 Ga0466964_0062452_49_1485 462
493 3300044719 Ga0466971_0032906 Ga0466971_0032906_740_2176 462
494 3300044842 Ga0466957_0003544 Ga0466957_0003544_3350_4786 462
495 3300045049 Ga0466959_0111052 Ga0466959_0111052_486_1922 462
496 3300045836 Ga0466958_0022637 Ga0466958_0022637_89_1525 462
497 3300046459 Ga0495629_0007808 Ga0495629_0007808_1128_2555 462
498 3300046459 Ga0495629_0017542 Ga0495629_0017542_1685_3112 462
499 3300046514 Ga0495618_0035076 Ga0495618_0035076_856_2283 462
500 3300046516 Ga0495628_0011400 Ga0495628_0011400_6051_7478 462
501 3300046529 Ga0495652_0057679 Ga0495652_0057679_1847_3274 462
502 3300046642 Ga0495634_0004825 Ga0495634_0004825_4787_6214 462
503 3300046660 Ga0495625_0011290 Ga0495625_0011290_1996_3423 462
504 3300046663 Ga0495635_0000558 Ga0495635_0000558_18_1445 462
505 3300046675 Ga0495657_0011223 Ga0495657_0011223_4956_6383 462
506 3300046680 Ga0495646_0075470 Ga0495646_0075470_468_1895 462
507 3300046689 Ga0495613_0022476 Ga0495613_0022476_2012_3439 462
508 3300046692 Ga0495671_0005439 Ga0495671_0005439_4080_5507 462
509 3300047317 Ga0495604_0002526 Ga0495604_0002526_4888_6315 462
510 3300047321 Ga0495676_0032458 Ga0495676_0032458_1998_3425 462
511 3300047443 Ga0495687_019705 Ga0495687_019705_1830_3257 462
512 3300047470 Ga0495681_0000354 Ga0495681_0000354_24136_25563 462
513 3300047673 Ga0495593_0002940 Ga0495593_0002940_91_1518 462
514 3300048089 Ga0495614_0008179 Ga0495614_0008179_987_2414 462
515 3300053092 Ga0500583_0044263 Ga0500583_0044263_248_1672 462
516 3300053107 Ga0500560_001901 Ga0500560_001901_1950_3377 462
517 3300061719 Ga0466962_0030309 Ga0466962_0030309_639_2075 462
518 iso_pu_bacteria 2582581312 2585299941 462
519 3300009098 Ga0105245_10045501 Ga0105245_100455012 463
520 3300025927 Ga0207687_10019413 Ga0207687_100194134 463
521 3300025935 Ga0207709_10063270 Ga0207709_100632702 463
522 3300030522 Ga0307512_10028172 Ga0307512_100281724 463
523 3300031649 Ga0307514_10057602 Ga0307514_100576021 463
524 3300031901 Ga0307406_10017304 Ga0307406_100173043 463
525 3300041404 Ga0439436_0002440 Ga0439436_0002440_3519_4952 463
526 3300041512 Ga0451853_1301325 Ga0451853_1301325_4753_6195 463
527 3300042014 Ga0439457_000427 Ga0439457_000427_5560_6993 463
528 3300042015 Ga0439462_0015749 Ga0439462_0015749_313_1755 463
529 3300042131 Ga0450894_000879 Ga0450894_000879_2178_3620 463
530 3300045976 Ga0466967_0163414 Ga0466967_0163414_482_1912 463
531 3300046455 Ga0495603_0001033 Ga0495603_0001033_3560_4990 463
532 3300046476 Ga0495662_0016113 Ga0495662_0016113_810_2240 463
533 3300046499 Ga0495594_0002866 Ga0495594_0002866_3708_5138 463
534 3300046501 Ga0495607_0052757 Ga0495607_0052757_831_2267 463
535 3300046507 Ga0495606_0007008 Ga0495606_0007008_7320_8756 463
536 3300046512 Ga0495610_0075302 Ga0495610_0075302_35_1471 463
537 3300046513 Ga0495616_0026651 Ga0495616_0026651_43_1479 463
538 3300046515 Ga0495620_0004115 Ga0495620_0004115_258_1694 463
539 3300046515 Ga0495620_0010011 Ga0495620_0010011_83_1519 463
540 3300046522 Ga0495643_0004726 Ga0495643_0004726_517_1953 463
541 3300046524 Ga0495648_0023170 Ga0495648_0023170_1585_3021 463
542 3300046533 Ga0495640_0017241 Ga0495640_0017241_1560_2996 463
543 3300046542 Ga0495597_0021607 Ga0495597_0021607_990_2426 463
544 3300046615 Ga0495656_0021085 Ga0495656_0021085_55_1485 463
545 3300046642 Ga0495634_0139173 Ga0495634_0139173_74_1510 463
546 3300046675 Ga0495657_0001523 Ga0495657_0001523_901_2331 463
547 3300046694 Ga0495649_0023132 Ga0495649_0023132_406_1842 463
548 3300046794 Ga0495589_0079158 Ga0495589_0079158_83_1519 463
549 3300047315 Ga0495581_0039742 Ga0495581_0039742_804_2240 463
550 3300047318 Ga0495636_0004016 Ga0495636_0004016_1904_3334 463
551 3300047321 Ga0495676_0007630 Ga0495676_0007630_989_2425 463
552 3300047443 Ga0495687_059624 Ga0495687_059624_69_1505 463
553 3300048089 Ga0495614_0067665 Ga0495614_0067665_61_1497 463
554 3300049575 Ga0501039_0063964 Ga0501039_0063964_375_1847 463
555 3300050507 nmdc:mga05p37_188172_c1 nmdc:mga05p37_188172_c1_175_1770 463
556 3300053146 Ga0500588_0001588 Ga0500588_0001588_2016_3542 463
557 iso_pu_bacteria 2643221548 2643765288 463
558 iso_pu_bacteria 2643221682 2644462641 463
559 3300042157 Ga0439458_0003723 Ga0439458_0003723_1815_3263 464
560 3300005539 Ga0068853_100004376 Ga0068853_1000043763 465
561 3300026041 Ga0207639_10002566 Ga0207639_100025662 465
562 3300044658 Ga0466972_0003739 Ga0466972_0003739_4481_5926 465
563 3300044765 Ga0466970_0028670 Ga0466970_0028670_959_2404 465
564 3300044901 Ga0466960_0004876 Ga0466960_0004876_1971_3416 465
565 3300047472 Ga0495686_0003153 Ga0495686_0003153_2298_3698 465
566 iso_pu_bacteria 2868088558 2868089063 465
567 3300005548 Ga0070665_100014500 Ga0070665_1000145002 466
568 3300046455 Ga0495603_0004977 Ga0495603_0004977_2143_3603 466
569 3300046459 Ga0495629_0008014 Ga0495629_0008014_4149_5609 466
570 3300046689 Ga0495613_0001444 Ga0495613_0001444_4014_5474 466
571 3300047321 Ga0495676_0024841 Ga0495676_0024841_1563_3023 466
572 3300047673 Ga0495593_0076456 Ga0495593_0076456_60_1520 466
573 3300048089 Ga0495614_0002100 Ga0495614_0002100_5915_7375 466
574 3300005331 Ga0070670_100015451 Ga0070670_1000154513 467
575 3300005334 Ga0068869_100134671 Ga0068869_1001346711 467
576 3300005336 Ga0070680_100156387 Ga0070680_1001563871 467
577 3300005337 Ga0070682_100002956 Ga0070682_1000029564 467
578 3300005338 Ga0068868_100028918 Ga0068868_1000289183 467
579 3300005341 Ga0070691_10011255 Ga0070691_100112552 467
580 3300005345 Ga0070692_10000081 Ga0070692_100000817 467
581 3300005354 Ga0070675_100006199 Ga0070675_1000061993 467
582 3300005355 Ga0070671_100000610 Ga0070671_10000061010 467
583 3300005365 Ga0070688_100085797 Ga0070688_1000857971 467
584 3300005441 Ga0070700_100007623 Ga0070700_1000076231 467
585 3300005455 Ga0070663_100006893 Ga0070663_1000068932 467
586 3300005456 Ga0070678_100171683 Ga0070678_1001716831 467
587 3300005458 Ga0070681_10031754 Ga0070681_100317543 467
588 3300005466 Ga0070685_10006225 Ga0070685_100062253 467
589 3300005539 Ga0068853_100100097 Ga0068853_1001000972 467
590 3300005547 Ga0070693_100010660 Ga0070693_1000106601 467
591 3300005548 Ga0070665_100254515 Ga0070665_1002545151 467
592 3300005563 Ga0068855_100177959 Ga0068855_1001779592 467
593 3300005614 Ga0068856_100018360 Ga0068856_1000183603 467
594 3300005615 Ga0070702_100001137 Ga0070702_1000011377 467
595 3300005616 Ga0068852_100013223 Ga0068852_1000132233 467
596 3300005617 Ga0068859_100016831 Ga0068859_1000168315 467
597 3300005840 Ga0068870_10000675 Ga0068870_100006758 467
598 3300005841 Ga0068863_100006338 Ga0068863_1000063385 467
599 3300005842 Ga0068858_100198276 Ga0068858_1001982762 467
600 3300006358 Ga0068871_100010156 Ga0068871_1000101563 467
601 3300006844 Ga0075428_100087839 Ga0075428_1000878392 467
602 3300006852 Ga0075433_10008500 Ga0075433_100085005 467
603 3300006871 Ga0075434_100006079 Ga0075434_1000060796 467
604 3300006914 Ga0075436_100000859 Ga0075436_1000008597 467
605 3300006931 Ga0097620_100016831 Ga0097620_1000168315 467
606 3300007076 Ga0075435_100041843 Ga0075435_1000418433 467
607 3300009093 Ga0105240_10063784 Ga0105240_100637843 467
608 3300009101 Ga0105247_10011226 Ga0105247_100112264 467
609 3300009147 Ga0114129_10081816 Ga0114129_100818163 467
610 3300009174 Ga0105241_10002930 Ga0105241_100029305 467
611 3300009545 Ga0105237_10052495 Ga0105237_100524951 467
612 3300011119 Ga0105246_10002248 Ga0105246_100022484 467
613 3300013296 Ga0157374_10083478 Ga0157374_100834783 467
614 3300013297 Ga0157378_10170949 Ga0157378_101709492 467
615 3300013307 Ga0157372_10052701 Ga0157372_100527012 467
616 3300014497 Ga0182008_10032816 Ga0182008_100328161 467
617 3300014969 Ga0157376_10098036 Ga0157376_100980362 467
618 3300020081 Ga0206354_10748882 Ga0206354_107488821 467
619 3300025900 Ga0207710_10040443 Ga0207710_100404431 467
620 3300025901 Ga0207688_10001656 Ga0207688_100016568 467
621 3300025906 Ga0207699_10119288 Ga0207699_101192882 467
622 3300025908 Ga0207643_10000243 Ga0207643_100002438 467
623 3300025911 Ga0207654_10010981 Ga0207654_100109813 467
624 3300025917 Ga0207660_10016326 Ga0207660_100163261 467
625 3300025919 Ga0207657_10053857 Ga0207657_100538571 467
626 3300025920 Ga0207649_10033048 Ga0207649_100330482 467
627 3300025921 Ga0207652_10027175 Ga0207652_100271751 467
628 3300025928 Ga0207700_10041362 Ga0207700_100413623 467
629 3300025932 Ga0207690_10130173 Ga0207690_101301731 467
630 3300025936 Ga0207670_10016736 Ga0207670_100167361 467
631 3300025942 Ga0207689_10000249 Ga0207689_1000024918 467
632 3300025944 Ga0207661_10022967 Ga0207661_100229673 467
633 3300025945 Ga0207679_10006523 Ga0207679_100065231 467
634 3300025986 Ga0207658_10180934 Ga0207658_101809341 467
635 3300026023 Ga0207677_10004582 Ga0207677_100045826 467
636 3300026067 Ga0207678_10000437 Ga0207678_1000043727 467
637 3300026075 Ga0207708_10002920 Ga0207708_100029207 467
638 3300026078 Ga0207702_10004711 Ga0207702_100047113 467
639 3300026088 Ga0207641_10031439 Ga0207641_100314393 467
640 3300026095 Ga0207676_10004625 Ga0207676_100046257 467
641 3300026121 Ga0207683_10000612 Ga0207683_100006129 467
642 3300028379 Ga0268266_10078385 Ga0268266_100783852 467
643 3300028381 Ga0268264_10256982 Ga0268264_102569821 467
644 3300042157 Ga0439458_0015381 Ga0439458_0015381_54_1460 467
645 3300048905 Ga0496102_0042564 Ga0496102_0042564_146_1552 467
646 3300048907 Ga0496104_0025309 Ga0496104_0025309_3658_5064 467
647 3300048908 Ga0496105_0002913 Ga0496105_0002913_10793_12199 467
648 3300048909 Ga0496106_0010225 Ga0496106_0010225_48_1454 467
649 3300048910 Ga0496107_0069056 Ga0496107_0069056_259_1665 467
650 3300048911 Ga0496108_0005277 Ga0496108_0005277_6177_7583 467
651 3300048912 Ga0496109_0079316 Ga0496109_0079316_1515_2921 467
652 3300048913 Ga0496110_0001600 Ga0496110_0001600_13684_15090 467
653 3300048914 Ga0496111_0002018 Ga0496111_0002018_3909_5315 467
654 3300050510 nmdc:mga06r32_258837_c1 nmdc:mga06r32_258837_c1_25_1431 467
655 3300050512 nmdc:mga0n895_5324_c1 nmdc:mga0n895_5324_c1_220_1626 467
656 3300050513 nmdc:mga0rr50_173053_c1 nmdc:mga0rr50_173053_c1_69_1475 467
657 3300050515 nmdc:mga0a205_3903_c1 nmdc:mga0a205_3903_c1_1465_2871 467
658 3300046455 Ga0495603_0003077 Ga0495603_0003077_6177_7652 469
659 3300046459 Ga0495629_0007045 Ga0495629_0007045_4604_6079 469
660 3300046499 Ga0495594_0002972 Ga0495594_0002972_2747_4222 469
661 3300046648 Ga0495611_0021232 Ga0495611_0021232_1050_2525 469
662 3300047321 Ga0495676_0003549 Ga0495676_0003549_4618_6093 469
663 3300053153 Ga0500616_0007334 Ga0500616_0007334_1869_3401 469
664 3300037418 Ga0395900_0029681 Ga0395900_0029681_1678_3108 470
665 3300037466 Ga0395898_0022655 Ga0395898_0022655_235_1665 470
666 3300037471 Ga0395905_0080751 Ga0395905_0080751_915_2345 470
667 3300038443 Ga0395901_0005824 Ga0395901_0005824_1661_3091 470
668 3300003203 JGI25406J46586_10030411 JGI25406J46586_100304111 472
669 3300005985 Ga0081539_10002184 Ga0081539_1000218422 472

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00232

Glyco_hydro_1

Glycosyl hydrolase family 1

31

519

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gnx-assembly1.cif.gz_B b-glucosidase from streptomyces sp 0.9854 13 468
1gon-assembly2.cif.gz_B b-glucosidase from streptomyces sp 0.9854 13 468
7bbs-assembly1.cif.gz_B structure of bg10: an alcohol-tolerant and glucose-stimulated b-glucosidase 0.9843 14 466
1gon-assembly1.cif.gz_A b-glucosidase from streptomyces sp 0.9838 13 468
7bbs-assembly1.cif.gz_A structure of bg10: an alcohol-tolerant and glucose-stimulated b-glucosidase 0.9824 14 466
ID Description Score Start End Superfamily
af_A0A1D6PHF5_27_269_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9867 15 218 3.20.20.80
3ta9B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9779 13 466 3.20.20.80
2o9rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9772 11 465 3.20.20.80
5aybA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9765 13 462 3.20.20.80
3ta9B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9757 13 466 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A060BWI0-F1-model_v4 Glyco_hydro_1 0.9991 370 465 GO:0005829
GO:0008422
GO:0016052
AF-A0A453SUS3-F1-model_v4 Uncharacterized protein 0.9937 15 143 GO:0005975
GO:0008422
GO:0102726
AF-A0A388NUD9-F1-model_v4 Beta-glucosidase 0.9925 13 194 GO:0005829
GO:0008422
GO:0030245
AF-A0A3D0STR2-F1-model_v4 Beta-glucosidase 0.9921 15 179 GO:0005829
GO:0008422
GO:0030245
AF-Q9X9R4-F1-model_v4 BGLC protein (EC 3.2.1.21) 0.9917 11 240 GO:0005829
GO:0008422
GO:0030245

Feature Viewer

pLDDT pTM Quality
94.6 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map