F474034

General Info

Members Datasets Scaffolds Average Seq Length
669 277 1338 342

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0158420|Ga0495645_0158420_69_1274
Length 401
Sequence MGIHVWIQVKAVGRSRAASNYKRGIERLKLRKFLKERGRQVRETRMFARAMQSASHPILAQIVPTRRCNLDCAYCNEYDQVSSPVPLDIMLRRIDRLADLGTTIITLSGGEPMLHPDLDAIIQRIRERGAIATLITNGLLLTRDRIEGLNQAGLDYLQISIDNLMPDEISKKSLKVLDLKLQWLARYAEFQVTINSVLGAGIRNPEDAFLIGDRARNLGFTSTVGILHDHTGQLKPLAPEQQRVYQRFRRLKTALFSFTHFDSFQENISRGHPNDWHCRAGGRFLYICEEGLVHYCSQQRGHPGIPLEDYAVEDLVREAARPKTCAPFCTISCVHQTAMLDDFRENPRETLAGILERRRALDPGFNPPAIVGLLSWLFLNESRRGPLGKLMLKVLRLKPKA

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
221 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
241 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
252 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
259 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
264 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 3.14
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 15.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0158420 3300046543 Unclassified 1567
2 SwRhRL2b_contig_3248323 2162886007 Bacteria 1598
3 SwRhRL2b_contig_930207 2162886007 Unclassified 3598
4 JGI24034J14986_100701 3300001432 Unclassified 1976
5 JGI24748J21848_1000087 3300002074 Bacteria 27375
6 JGI24034J26672_10000070 3300002239 Bacteria 27386
7 JGI24751J29686_10000003 3300002459 Bacteria 157815
8 Ga0065714_10064425 3300005288 Bacteria 189652
9 Ga0065704_10001798 3300005289 Bacteria 6520
10 Ga0065704_10103794 3300005289 Bacteria 2162
11 Ga0065712_10007213 3300005290 Bacteria 2649
12 Ga0065712_10073393 3300005290 Unclassified 4409
13 Ga0065712_10081567 3300005290 Bacteria 2996
14 Ga0065715_10004743 3300005293 Bacteria 4336
15 Ga0065715_10009049 3300005293 Bacteria 4610
16 Ga0065715_10011790 3300005293 Bacteria 2613
17 Ga0065715_10089787 3300005293 Bacteria 8522
18 Ga0065715_10091778 3300005293 Bacteria 5558
19 Ga0065715_10092707 3300005293 Bacteria 4975
20 Ga0065715_10100599 3300005293 Bacteria 3287
21 Ga0065715_10120886 3300005293 Bacteria 2245
22 Ga0065707_10003391 3300005295 Bacteria 3796
23 Ga0065707_10010339 3300005295 Unclassified 2674
24 Ga0065707_10022558 3300005295 Bacteria 1448
25 Ga0065707_10106408 3300005295 Bacteria 2597
26 Ga0070690_100004965 3300005330 Bacteria 7443
27 Ga0070690_100006953 3300005330 Bacteria 6440
28 Ga0070670_100000167 3300005331 Bacteria 59452
29 Ga0070670_100388882 3300005331 Unclassified 1230
30 Ga0070677_10045044 3300005333 Bacteria 1758
31 Ga0068869_100009811 3300005334 Bacteria 6219
32 Ga0068869_100011059 3300005334 Bacteria 5910
33 Ga0068869_100029718 3300005334 Bacteria 3832
34 Ga0070666_10026016 3300005335 Bacteria 3819
35 Ga0070666_10109667 3300005335 Bacteria 1908
36 Ga0070680_100001034 3300005336 Bacteria 19934
37 Ga0070680_100015092 3300005336 Bacteria 6049
38 Ga0070680_100039864 3300005336 Unclassified 3801
39 Ga0070682_100000091 3300005337 Bacteria 82460
40 Ga0070682_100005562 3300005337 Bacteria 7019
41 Ga0070682_100032834 3300005337 Bacteria 3150
42 Ga0068868_100004335 3300005338 Bacteria 9945
43 Ga0068868_100032433 3300005338 Bacteria 4018
44 Ga0068868_100242512 3300005338 Bacteria 1515
45 Ga0070687_100010093 3300005343 Bacteria 4067
46 Ga0070687_100035319 3300005343 Bacteria 2481
47 Ga0070687_100183174 3300005343 Bacteria 1256
48 Ga0070692_10022540 3300005345 Bacteria 3076
49 Ga0070669_100002809 3300005353 Bacteria 12569
50 Ga0070669_100055936 3300005353 Bacteria 2891
51 Ga0070669_100094863 3300005353 Bacteria 2242
52 Ga0070669_100097785 3300005353 Bacteria 2210
53 Ga0070675_100088824 3300005354 Bacteria 2587
54 Ga0070675_100193338 3300005354 Bacteria 1764
55 Ga0070671_100002409 3300005355 Bacteria 14455
56 Ga0070671_100017845 3300005355 Bacteria 5752
57 Ga0070671_100088722 3300005355 Unclassified 2588
58 Ga0070673_100012647 3300005364 Bacteria 5804
59 Ga0070673_100013703 3300005364 Bacteria 5620
60 Ga0070673_100101009 3300005364 Bacteria 2376
61 Ga0070673_100163397 3300005364 Bacteria 1895
62 Ga0070688_100013752 3300005365 Bacteria 4573
63 Ga0070659_100102184 3300005366 Bacteria 2307
64 Ga0070659_100460627 3300005366 Bacteria 1080
65 Ga0070703_10000077 3300005406 Bacteria 48491
66 Ga0070713_100110637 3300005436 Unclassified 2395
67 Ga0070711_100304170 3300005439 Unclassified 1269
68 Ga0070705_100002034 3300005440 Bacteria 10341
69 Ga0070705_100055836 3300005440 Bacteria 2323
70 Ga0070705_100114510 3300005440 Bacteria 1730
71 Ga0070700_100000426 3300005441 Bacteria 21450
72 Ga0070700_100004146 3300005441 Bacteria 7558
73 Ga0070700_100027634 3300005441 Unclassified 3366
74 Ga0070694_100083005 3300005444 Bacteria 2232
75 Ga0070694_100086493 3300005444 Bacteria 2191
76 Ga0070694_100222632 3300005444 Unclassified 1416
77 Ga0070708_100278888 3300005445 Bacteria 1573
78 Ga0070662_100097957 3300005457 Bacteria 2214
79 Ga0070681_10000103 3300005458 Bacteria 63054
80 Ga0070681_10011795 3300005458 Bacteria 8663
81 Ga0070681_10013042 3300005458 Bacteria 8253
82 Ga0070685_10044218 3300005466 Bacteria 2549
83 Ga0070706_100000053 3300005467 Bacteria 139565
84 Ga0070706_100007385 3300005467 Bacteria 10307
85 Ga0070706_100045943 3300005467 Bacteria 4032
86 Ga0070706_100068352 3300005467 Unclassified 3285
87 Ga0070706_100200839 3300005467 Bacteria 1862
88 Ga0070707_100000197 3300005468 Bacteria 60425
89 Ga0070707_100042211 3300005468 Bacteria 4366
90 Ga0070707_100071459 3300005468 Bacteria 3343
91 Ga0070707_100073340 3300005468 Bacteria 3300
92 Ga0070707_100146918 3300005468 Bacteria 2295
93 Ga0070698_100002114 3300005471 Bacteria 22082
94 Ga0070698_100002889 3300005471 Bacteria 18910
95 Ga0070698_100007387 3300005471 Bacteria 11889
96 Ga0070698_100021483 3300005471 Bacteria 6761
97 Ga0070698_100021996 3300005471 Bacteria 6676
98 Ga0070698_100026001 3300005471 Bacteria 6098
99 Ga0070698_100079021 3300005471 Bacteria 3287
100 Ga0070699_100010950 3300005518 Bacteria 7843
101 Ga0070699_100038519 3300005518 Bacteria 4139
102 Ga0070699_100097757 3300005518 Unclassified 2572
103 Ga0070679_100000492 3300005530 Bacteria 33622
104 Ga0070679_100013568 3300005530 Bacteria 7808
105 Ga0070679_100148320 3300005530 Bacteria 2323
106 Ga0070684_100221031 3300005535 Unclassified 1728
107 Ga0070684_100343737 3300005535 Unclassified 1372
108 Ga0070697_100000095 3300005536 Bacteria 74109
109 Ga0070697_100000143 3300005536 Bacteria 57751
110 Ga0070697_100001842 3300005536 Bacteria 16203
111 Ga0070697_100026726 3300005536 Bacteria 4615
112 Ga0070697_100125068 3300005536 Bacteria 2154
113 Ga0068853_100384080 3300005539 Unclassified 1312
114 Ga0070672_100031067 3300005543 Bacteria 4018
115 Ga0070672_100224210 3300005543 Unclassified 1577
116 Ga0070686_100002485 3300005544 Bacteria 10151
117 Ga0070686_100004419 3300005544 Bacteria 7759
118 Ga0070686_100004724 3300005544 Bacteria 7509
119 Ga0070686_100014487 3300005544 Bacteria 4548
120 Ga0070686_100019207 3300005544 Bacteria 4023
121 Ga0070695_100047185 3300005545 Bacteria 2750
122 Ga0070695_100075792 3300005545 Unclassified 2214
123 Ga0070695_100205633 3300005545 Bacteria 1410
124 Ga0070696_100013338 3300005546 Bacteria 5514
125 Ga0070696_100019819 3300005546 Bacteria 4558
126 Ga0070696_100027274 3300005546 Bacteria 3890
127 Ga0070696_100125390 3300005546 Bacteria 1862
128 Ga0070696_100178722 3300005546 Bacteria 1573
129 Ga0070693_100000878 3300005547 Bacteria 13388
130 Ga0070693_100018480 3300005547 Bacteria 3643
131 Ga0070693_100026687 3300005547 Bacteria 3120
132 Ga0070693_100035585 3300005547 Bacteria 2763
133 Ga0070693_100043989 3300005547 Bacteria 2524
134 Ga0070693_100049706 3300005547 Unclassified 2394
135 Ga0070693_100080490 3300005547 Unclassified 1941
136 Ga0070704_100012733 3300005549 Bacteria 5204
137 Ga0070704_100036771 3300005549 Bacteria 3339
138 Ga0070704_100228009 3300005549 Bacteria 1518
139 Ga0068855_100335241 3300005563 Bacteria 1669
140 Ga0070664_100000399 3300005564 Bacteria 32416
141 Ga0068857_100003943 3300005577 Bacteria 12490
142 Ga0068854_100019481 3300005578 Bacteria 4573
143 Ga0068854_100044134 3300005578 Bacteria 3163
144 Ga0068854_100044960 3300005578 Bacteria 3137
145 Ga0068854_100169970 3300005578 Bacteria 1696
146 Ga0068856_100001146 3300005614 Bacteria 27859
147 Ga0068856_100082012 3300005614 Bacteria 3200
148 Ga0068856_100116379 3300005614 Unclassified 2674
149 Ga0070702_100015680 3300005615 Bacteria 3875
150 Ga0070702_100081130 3300005615 Bacteria 1943
151 Ga0068852_100429021 3300005616 Bacteria 1305
152 Ga0068859_100000994 3300005617 Bacteria 29030
153 Ga0068859_100013713 3300005617 Bacteria 8126
154 Ga0068859_100020559 3300005617 Bacteria 6623
155 Ga0068859_100065972 3300005617 Bacteria 3654
156 Ga0068859_100097141 3300005617 Bacteria 2999
157 Ga0068859_100126939 3300005617 Bacteria 2620
158 Ga0068859_100130997 3300005617 Bacteria 2579
159 Ga0068864_100002379 3300005618 Bacteria 15560
160 Ga0068864_100036778 3300005618 Bacteria 4175
161 Ga0068864_100215322 3300005618 Bacteria 1770
162 Ga0068864_100274530 3300005618 Unclassified 1572
163 Ga0068864_100546879 3300005618 Bacteria 1119
164 Ga0068866_10006640 3300005718 Bacteria 4824
165 Ga0068861_100002995 3300005719 Bacteria 11149
166 Ga0068861_100285509 3300005719 Bacteria 1423
167 Ga0068870_10019119 3300005840 Bacteria 3318
168 Ga0068870_10020803 3300005840 Bacteria 3201
169 Ga0068870_10212611 3300005840 Bacteria 1179
170 Ga0068863_100007830 3300005841 Bacteria 10447
171 Ga0068863_100014644 3300005841 Bacteria 7551
172 Ga0068863_100066196 3300005841 Bacteria 3418
173 Ga0068863_100118558 3300005841 Unclassified 2523
174 Ga0068863_100303113 3300005841 Unclassified 1550
175 Ga0068858_100000077 3300005842 Bacteria 103156
176 Ga0068858_100029631 3300005842 Bacteria 5084
177 Ga0068858_100058924 3300005842 Bacteria 3550
178 Ga0068858_100065325 3300005842 Bacteria 3366
179 Ga0068858_100327627 3300005842 Unclassified 1464
180 Ga0068860_100006429 3300005843 Bacteria 11800
181 Ga0068860_100007591 3300005843 Bacteria 10853
182 Ga0068860_100015475 3300005843 Bacteria 7448
183 Ga0068860_100019122 3300005843 Bacteria 6651
184 Ga0068860_100019966 3300005843 Bacteria 6496
185 Ga0068860_100127128 3300005843 Bacteria 2443
186 Ga0068860_100131223 3300005843 Unclassified 2404
187 Ga0068860_100163476 3300005843 Bacteria 2147
188 Ga0068862_100012348 3300005844 Bacteria 7061
189 Ga0081455_10005508 3300005937 Bacteria 13876
190 Ga0081455_10124760 3300005937 Bacteria 2023
191 Ga0081539_10001126 3300005985 Bacteria 48444
192 Ga0081539_10002144 3300005985 Bacteria 29163
193 Ga0070717_10010741 3300006028 Bacteria 6931
194 Ga0070715_10000010 3300006163 Bacteria 184687
195 Ga0070716_100000004 3300006173 Bacteria 296614
196 Ga0070716_100076873 3300006173 Unclassified 1980
197 Ga0097621_100002148 3300006237 Unclassified 13491
198 Ga0097621_100013481 3300006237 Bacteria 6094
199 Ga0097621_100049890 3300006237 Bacteria 3402
200 Ga0068871_100001307 3300006358 Bacteria 16665
201 Ga0068871_100015084 3300006358 Bacteria 5776
202 Ga0068871_100032871 3300006358 Bacteria 4102
203 Ga0068871_100045549 3300006358 Bacteria 3531
204 Ga0068871_100109002 3300006358 Bacteria 2328
205 Ga0075428_100048414 3300006844 Bacteria 4665
206 Ga0075428_100172873 3300006844 Bacteria 2341
207 Ga0075431_100208416 3300006847 Bacteria 1998
208 Ga0075431_100268104 3300006847 Unclassified 1731
209 Ga0075433_10005899 3300006852 Bacteria 9649
210 Ga0075433_10029652 3300006852 Bacteria 4664
211 Ga0075433_10033398 3300006852 Bacteria 4411
212 Ga0075433_10054727 3300006852 Bacteria 3481
213 Ga0075433_10217498 3300006852 Unclassified 1698
214 Ga0075434_100000642 3300006871 Bacteria 27039
215 Ga0075434_100035193 3300006871 Bacteria 4949
216 Ga0075434_100133673 3300006871 Bacteria 2500
217 Ga0075434_100321903 3300006871 Bacteria 1567
218 Ga0075434_100678012 3300006871 Bacteria 1049
219 Ga0075429_100152893 3300006880 Bacteria 2020
220 Ga0068865_100033930 3300006881 Unclassified 3420
221 Ga0075436_100051780 3300006914 Bacteria 2833
222 Ga0097620_100000994 3300006931 Bacteria 29030
223 Ga0097620_100013713 3300006931 Bacteria 8126
224 Ga0097620_100020559 3300006931 Bacteria 6623
225 Ga0097620_100065973 3300006931 Bacteria 3654
226 Ga0097620_100097141 3300006931 Bacteria 2999
227 Ga0097620_100126945 3300006931 Bacteria 2620
228 Ga0097620_100131001 3300006931 Bacteria 2579
229 Ga0097620_100217332 3300006931 Bacteria 1999
230 Ga0075435_100003777 3300007076 Bacteria 10328
231 Ga0075435_100233604 3300007076 Bacteria 1562
232 Ga0099794_10114538 3300007265 Bacteria 1353
233 Ga0105240_10003947 3300009093 Bacteria 22909
234 Ga0105240_10021642 3300009093 Bacteria 8549
235 Ga0105240_10058744 3300009093 Bacteria 4801
236 Ga0111539_10001706 3300009094 Bacteria 29249
237 Ga0111539_10021254 3300009094 Bacteria 7990
238 Ga0111539_10023803 3300009094 Bacteria 7525
239 Ga0111539_10240752 3300009094 Bacteria 2106
240 Ga0105245_10005694 3300009098 Bacteria 10943
241 Ga0105245_10192631 3300009098 Unclassified 1953
242 Ga0105247_10000015 3300009101 Bacteria 277224
243 Ga0105247_10002274 3300009101 Bacteria 13192
244 Ga0114129_10006170 3300009147 Bacteria 17003
245 Ga0114129_10016614 3300009147 Bacteria 10483
246 Ga0114129_10018678 3300009147 Bacteria 9872
247 Ga0114129_10023494 3300009147 Bacteria 8740
248 Ga0114129_10040881 3300009147 Bacteria 6535
249 Ga0114129_10069585 3300009147 Bacteria 4906
250 Ga0114129_10087518 3300009147 Bacteria 4319
251 Ga0114129_10134259 3300009147 Bacteria 3397
252 Ga0114129_10168692 3300009147 Bacteria 2985
253 Ga0114129_10310863 3300009147 Unclassified 2098
254 Ga0105243_10000283 3300009148 Bacteria 56438
255 Ga0105243_10000350 3300009148 Bacteria 49215
256 Ga0105243_10009281 3300009148 Bacteria 7505
257 Ga0105243_10013270 3300009148 Bacteria 6229
258 Ga0105243_10089776 3300009148 Unclassified 2527
259 Ga0105243_10280671 3300009148 Bacteria 1500
260 Ga0105241_10040711 3300009174 Bacteria 3509
261 Ga0105241_10052494 3300009174 Bacteria 3113
262 Ga0105242_10000235 3300009176 Bacteria 43611
263 Ga0105242_10000694 3300009176 Bacteria 26389
264 Ga0105242_10006761 3300009176 Bacteria 8842
265 Ga0105242_10019042 3300009176 Bacteria 5378
266 Ga0105242_10034332 3300009176 Bacteria 4066
267 Ga0105242_10264162 3300009176 Bacteria 1556
268 Ga0105248_10005966 3300009177 Bacteria 13384
269 Ga0105248_10043134 3300009177 Bacteria 5058
270 Ga0105248_10076539 3300009177 Bacteria 3761
271 Ga0105248_10229451 3300009177 Bacteria 2090
272 Ga0105248_10344766 3300009177 Bacteria 1677
273 Ga0105248_10429542 3300009177 Unclassified 1488
274 Ga0105248_10564376 3300009177 Bacteria 1284
275 Ga0105248_10579047 3300009177 Unclassified 1266
276 Ga0105237_10006325 3300009545 Bacteria 13163
277 Ga0105237_10010011 3300009545 Bacteria 10116
278 Ga0105237_10026320 3300009545 Bacteria 5945
279 Ga0105237_10094132 3300009545 Bacteria 2985
280 Ga0105238_10005440 3300009551 Bacteria 12583
281 Ga0105238_10007235 3300009551 Bacteria 11110
282 Ga0105238_10039424 3300009551 Bacteria 4790
283 Ga0105238_10370216 3300009551 Bacteria 1423
284 Ga0105249_10000018 3300009553 Bacteria 275907
285 Ga0105249_10129141 3300009553 Bacteria 2411
286 Ga0105249_10148309 3300009553 Unclassified 2256
287 Ga0105249_10328081 3300009553 Unclassified 1543
288 Ga0105239_10058238 3300010375 Bacteria 4239
289 Ga0105239_10235428 3300010375 Bacteria 2055
290 Ga0105246_10026458 3300011119 Bacteria 3790
291 Ga0157373_10006546 3300013100 Bacteria 8691
292 Ga0157373_10099097 3300013100 Bacteria 2051
293 Ga0157373_10122099 3300013100 Bacteria 1831
294 Ga0157371_10090139 3300013102 Unclassified 2172
295 Ga0157370_10218513 3300013104 Unclassified 1765
296 Ga0157369_10084635 3300013105 Unclassified 3390
297 Ga0157374_10084409 3300013296 Bacteria 3018
298 Ga0157374_10121431 3300013296 Bacteria 2522
299 Ga0157374_10309407 3300013296 Bacteria 1564
300 Ga0157378_10000095 3300013297 Bacteria 84288
301 Ga0157378_10001621 3300013297 Bacteria 20349
302 Ga0157378_10012834 3300013297 Bacteria 7333
303 Ga0157378_10019191 3300013297 Bacteria 6009
304 Ga0157378_10020181 3300013297 Bacteria 5861
305 Ga0157378_10031802 3300013297 Bacteria 4661
306 Ga0157378_10036464 3300013297 Bacteria 4351
307 Ga0157378_10088772 3300013297 Bacteria 2806
308 Ga0157378_10111867 3300013297 Bacteria 2504
309 Ga0163162_10000001 3300013306 Bacteria 751833
310 Ga0163162_10001376 3300013306 Bacteria 22623
311 Ga0163162_10005973 3300013306 Bacteria 11787
312 Ga0163162_10023086 3300013306 Bacteria 6136
313 Ga0163162_10062368 3300013306 Bacteria 3768
314 Ga0163162_10123575 3300013306 Bacteria 2694
315 Ga0157372_10006380 3300013307 Bacteria 12546
316 Ga0157372_10042170 3300013307 Bacteria 5046
317 Ga0157375_10015321 3300013308 Bacteria 6860
318 Ga0157375_10097288 3300013308 Bacteria 3017
319 Ga0157375_10128480 3300013308 Bacteria 2652
320 Ga0157375_10313569 3300013308 Bacteria 1733
321 Ga0157375_10395901 3300013308 Bacteria 1548
322 Ga0157375_10524988 3300013308 Bacteria 1347
323 Ga0163163_10000298 3300014325 Bacteria 49128
324 Ga0163163_10000769 3300014325 Bacteria 27193
325 Ga0163163_10002579 3300014325 Bacteria 15355
326 Ga0163163_10017394 3300014325 Bacteria 6704
327 Ga0163163_10021823 3300014325 Bacteria 6049
328 Ga0163163_10032131 3300014325 Bacteria 5070
329 Ga0163163_10034727 3300014325 Unclassified 4886
330 Ga0163163_10149175 3300014325 Bacteria 2383
331 Ga0163163_10278971 3300014325 Bacteria 1723
332 Ga0163163_10294954 3300014325 Bacteria 1674
333 Ga0163163_10386490 3300014325 Bacteria 1457
334 Ga0157380_10000312 3300014326 Bacteria 29376
335 Ga0157380_10000396 3300014326 Bacteria 26239
336 Ga0157380_10001184 3300014326 Bacteria 16877
337 Ga0157380_10039879 3300014326 Bacteria 3654
338 Ga0157380_10043381 3300014326 Bacteria 3521
339 Ga0157380_10192728 3300014326 Bacteria 1801
340 Ga0157380_10331288 3300014326 Bacteria 1416
341 Ga0157379_10038187 3300014968 Bacteria 4284
342 Ga0157376_10000158 3300014969 Bacteria 47028
343 Ga0157376_10258659 3300014969 Bacteria 1630
344 Ga0163161_10012135 3300017792 Bacteria 5977
345 Ga0163161_10023688 3300017792 Bacteria 4333
346 Ga0213872_10018868 3300021361 Bacteria 3178
347 Ga0213875_10027641 3300021388 Bacteria 2699
348 Ga0207653_10000326 3300025885 Bacteria 25312
349 Ga0207653_10020630 3300025885 Bacteria 2086
350 Ga0207682_10028837 3300025893 Unclassified 2217
351 Ga0207710_10000004 3300025900 Bacteria 846540
352 Ga0207710_10000575 3300025900 Bacteria 21826
353 Ga0207680_10041453 3300025903 Bacteria 2686
354 Ga0207680_10063380 3300025903 Unclassified 2262
355 Ga0207647_10011682 3300025904 Bacteria 6146
356 Ga0207685_10000006 3300025905 Bacteria 284255
357 Ga0207643_10001070 3300025908 Bacteria 16179
358 Ga0207643_10010513 3300025908 Bacteria 4985
359 Ga0207643_10032351 3300025908 Bacteria 2921
360 Ga0207643_10081916 3300025908 Bacteria 1871
361 Ga0207643_10211475 3300025908 Bacteria 1184
362 Ga0207684_10000053 3300025910 Bacteria 225260
363 Ga0207684_10004659 3300025910 Bacteria 12875
364 Ga0207684_10011087 3300025910 Bacteria 7891
365 Ga0207684_10014452 3300025910 Bacteria 6806
366 Ga0207707_10000033 3300025912 Bacteria 158362
367 Ga0207707_10043224 3300025912 Bacteria 3931
368 Ga0207707_10071675 3300025912 Unclassified 3020
369 Ga0207707_10095161 3300025912 Unclassified 2603
370 Ga0207695_10006656 3300025913 Bacteria 14912
371 Ga0207671_10004666 3300025914 Bacteria 12970
372 Ga0207671_10030000 3300025914 Bacteria 4057
373 Ga0207671_10061854 3300025914 Bacteria 2779
374 Ga0207663_10106893 3300025916 Unclassified 1892
375 Ga0207663_10246065 3300025916 Bacteria 1314
376 Ga0207660_10000364 3300025917 Bacteria 29558
377 Ga0207660_10011501 3300025917 Bacteria 5764
378 Ga0207660_10048302 3300025917 Bacteria 3011
379 Ga0207662_10001073 3300025918 Bacteria 12851
380 Ga0207662_10006092 3300025918 Bacteria 6488
381 Ga0207662_10012150 3300025918 Bacteria 4792
382 Ga0207662_10060778 3300025918 Unclassified 2267
383 Ga0207657_10209247 3300025919 Bacteria 1566
384 Ga0207649_10276657 3300025920 Unclassified 1219
385 Ga0207652_10000032 3300025921 Bacteria 143319
386 Ga0207652_10032165 3300025921 Bacteria 4407
387 Ga0207652_10174121 3300025921 Bacteria 1932
388 Ga0207646_10001700 3300025922 Bacteria 26758
389 Ga0207646_10003397 3300025922 Bacteria 17989
390 Ga0207646_10028626 3300025922 Bacteria 5069
391 Ga0207646_10055709 3300025922 Bacteria 3535
392 Ga0207646_10066102 3300025922 Bacteria 3228
393 Ga0207646_10099853 3300025922 Bacteria 2601
394 Ga0207681_10000902 3300025923 Bacteria 19410
395 Ga0207681_10029293 3300025923 Bacteria 3574
396 Ga0207681_10036365 3300025923 Bacteria 3248
397 Ga0207694_10003281 3300025924 Bacteria 12887
398 Ga0207694_10009398 3300025924 Bacteria 7373
399 Ga0207694_10016080 3300025924 Bacteria 5645
400 Ga0207694_10059105 3300025924 Bacteria 2982
401 Ga0207650_10000007 3300025925 Bacteria 530810
402 Ga0207650_10000504 3300025925 Bacteria 32594
403 Ga0207650_10135137 3300025925 Bacteria 1934
404 Ga0207650_10332485 3300025925 Unclassified 1246
405 Ga0207687_10004879 3300025927 Bacteria 8913
406 Ga0207687_10011956 3300025927 Bacteria 5677
407 Ga0207644_10001811 3300025931 Bacteria 13881
408 Ga0207644_10001852 3300025931 Bacteria 13770
409 Ga0207644_10167535 3300025931 Unclassified 1713
410 Ga0207690_10198739 3300025932 Bacteria 1521
411 Ga0207686_10000021 3300025934 Bacteria 181793
412 Ga0207686_10000318 3300025934 Bacteria 34744
413 Ga0207686_10001321 3300025934 Bacteria 14158
414 Ga0207686_10023046 3300025934 Unclassified 3591
415 Ga0207686_10034960 3300025934 Unclassified 3012
416 Ga0207686_10036511 3300025934 Bacteria 2959
417 Ga0207686_10050115 3300025934 Bacteria 2595
418 Ga0207709_10000069 3300025935 Bacteria 183367
419 Ga0207709_10004936 3300025935 Bacteria 7634
420 Ga0207709_10014659 3300025935 Bacteria 4332
421 Ga0207670_10307910 3300025936 Bacteria 1242
422 Ga0207704_10009942 3300025938 Bacteria 4615
423 Ga0207665_10000139 3300025939 Bacteria 48695
424 Ga0207665_10063134 3300025939 Bacteria 2515
425 Ga0207691_10000991 3300025940 Bacteria 28224
426 Ga0207691_10237448 3300025940 Bacteria 1577
427 Ga0207711_10004098 3300025941 Bacteria 12495
428 Ga0207711_10005871 3300025941 Bacteria 10364
429 Ga0207711_10018504 3300025941 Bacteria 5792
430 Ga0207711_10029508 3300025941 Bacteria 4627
431 Ga0207689_10022598 3300025942 Bacteria 5284
432 Ga0207689_10062015 3300025942 Bacteria 3075
433 Ga0207689_10148402 3300025942 Bacteria 1932
434 Ga0207689_10279422 3300025942 Bacteria 1383
435 Ga0207661_10027684 3300025944 Bacteria 4332
436 Ga0207679_10285361 3300025945 Unclassified 1417
437 Ga0207679_10481233 3300025945 Bacteria 1105
438 Ga0207667_10002312 3300025949 Bacteria 23885
439 Ga0207651_10019355 3300025960 Bacteria 4077
440 Ga0207651_10033719 3300025960 Bacteria 3306
441 Ga0207651_10141966 3300025960 Bacteria 1856
442 Ga0207651_10220085 3300025960 Bacteria 1534
443 Ga0207712_10000081 3300025961 Bacteria 114043
444 Ga0207712_10004444 3300025961 Bacteria 8855
445 Ga0207712_10029295 3300025961 Bacteria 3691
446 Ga0207712_10158569 3300025961 Unclassified 1756
447 Ga0207668_10004533 3300025972 Bacteria 8172
448 Ga0207640_10014000 3300025981 Bacteria 4608
449 Ga0207640_10110238 3300025981 Bacteria 1949
450 Ga0207658_10083773 3300025986 Unclassified 2452
451 Ga0207677_10007186 3300026023 Bacteria 6136
452 Ga0207677_10083524 3300026023 Bacteria 2299
453 Ga0207677_10261100 3300026023 Bacteria 1412
454 Ga0207703_10011010 3300026035 Bacteria 7048
455 Ga0207703_10016670 3300026035 Bacteria 5731
456 Ga0207703_10050171 3300026035 Bacteria 3376
457 Ga0207703_10075478 3300026035 Unclassified 2794
458 Ga0207703_10092744 3300026035 Bacteria 2543
459 Ga0207703_10093180 3300026035 Bacteria 2537
460 Ga0207703_10114577 3300026035 Unclassified 2305
461 Ga0207703_10116319 3300026035 Bacteria 2289
462 Ga0207703_10276323 3300026035 Unclassified 1524
463 Ga0207703_10402281 3300026035 Unclassified 1271
464 Ga0207639_10064225 3300026041 Unclassified 2845
465 Ga0207639_10219902 3300026041 Bacteria 1640
466 Ga0207708_10000096 3300026075 Bacteria 67574
467 Ga0207708_10005969 3300026075 Bacteria 9020
468 Ga0207708_10016590 3300026075 Bacteria 5541
469 Ga0207708_10017440 3300026075 Bacteria 5405
470 Ga0207708_10042621 3300026075 Bacteria 3458
471 Ga0207708_10060669 3300026075 Bacteria 2887
472 Ga0207708_10185985 3300026075 Unclassified 1651
473 Ga0207702_10010876 3300026078 Bacteria 7590
474 Ga0207702_10086434 3300026078 Bacteria 2735
475 Ga0207641_10009016 3300026088 Bacteria 8238
476 Ga0207641_10116896 3300026088 Bacteria 2374
477 Ga0207641_10166413 3300026088 Bacteria 2008
478 Ga0207641_10333330 3300026088 Unclassified 1442
479 Ga0207648_10001293 3300026089 Bacteria 27927
480 Ga0207648_10085218 3300026089 Bacteria 2756
481 Ga0207676_10003315 3300026095 Unclassified 11429
482 Ga0207676_10055935 3300026095 Bacteria 3100
483 Ga0207676_10073384 3300026095 Unclassified 2754
484 Ga0207676_10078963 3300026095 Bacteria 2667
485 Ga0207674_10000058 3300026116 Bacteria 113012
486 Ga0207674_10043224 3300026116 Unclassified 4647
487 Ga0207674_10097352 3300026116 Bacteria 2926
488 Ga0207674_10132940 3300026116 Unclassified 2451
489 Ga0207674_10330714 3300026116 Bacteria 1473
490 Ga0207675_100001711 3300026118 Bacteria 21971
491 Ga0207675_100005590 3300026118 Bacteria 12033
492 Ga0207675_100014439 3300026118 Bacteria 7363
493 Ga0207675_100024259 3300026118 Bacteria 5640
494 Ga0207675_100186980 3300026118 Bacteria 1986
495 Ga0207698_10278906 3300026142 Bacteria 1545
496 Ga0207428_10006650 3300027907 Bacteria 10615
497 Ga0207428_10013108 3300027907 Bacteria 7259
498 Ga0207428_10280788 3300027907 Unclassified 1236
499 Ga0268264_10009577 3300028381 Bacteria 8021
500 Ga0268264_10017289 3300028381 Bacteria 5908
501 Ga0268264_10018974 3300028381 Bacteria 5622
502 Ga0268264_10093460 3300028381 Bacteria 2598
503 Ga0268264_10104585 3300028381 Unclassified 2468
504 Ga0268264_10233891 3300028381 Bacteria 1698
505 Ga0307405_10064940 3300031731 Bacteria 2321
506 Ga0307413_10028563 3300031824 Bacteria 3109
507 Ga0307406_10062816 3300031901 Bacteria 2403
508 Ga0307412_10002204 3300031911 Bacteria 10817
509 Ga0307409_100046695 3300031995 Bacteria 3281
510 Ga0307409_100079862 3300031995 Bacteria 2638
511 Ga0307416_100186698 3300032002 Unclassified 1949
512 Ga0307416_100452099 3300032002 Bacteria 1337
513 Ga0307414_10002865 3300032004 Bacteria 9109
514 Ga0307411_10015779 3300032005 Bacteria 4255
515 Ga0307415_100040909 3300032126 Bacteria 3074
516 Ga0373943_0006189 3300035170 Bacteria 5373
517 Ga0373942_0003133 3300035207 Bacteria 3914
518 Ga0373925_0028297 3300037068 Unclassified 4106
519 Ga0373925_0335844 3300037068 Unclassified 1225
520 Ga0395900_0094831 3300037418 Bacteria 3066
521 Ga0436364_0566928 3300037853 Bacteria 5827
522 Ga0436364_1078325 3300037853 Bacteria 4118
523 Ga0395901_0039638 3300038443 Bacteria 4876
524 Ga0242422_00204 3300038699 Bacteria 3378
525 Ga0242420_025267 3300038996 Bacteria 1079
526 Ga0436365_0224719 3300039437 Bacteria 6227
527 Ga0436361_1039433 3300039447 Bacteria 4495
528 Ga0436362_1169302 3300039453 Bacteria 3704
529 Ga0439448_0010185 3300042005 Bacteria 2782
530 Ga0439455_0050329 3300042012 Unclassified 1087
531 Ga0439434_0048382 3300042435 Bacteria 1315
532 Ga0453683_0083739 3300044673 Bacteria 1998
533 Ga0451576_0072114 3300045051 Bacteria 3594
534 Ga0451576_0370311 3300045051 Bacteria 1501
535 Ga0451576_0540803 3300045051 Bacteria 1224
536 Ga0495580_0000800 3300046472 Bacteria 27228
537 Ga0495582_0000117 3300046473 Bacteria 42161
538 Ga0495662_0017931 3300046476 Bacteria 3426
539 Ga0495618_0102750 3300046514 Bacteria 1830
540 Ga0495630_0239428 3300046517 Unclassified 1387
541 Ga0495643_0037054 3300046522 Bacteria 2677
542 Ga0495663_0000086 3300046525 Bacteria 42201
543 Ga0495598_0000022 3300046537 Bacteria 24493
544 Ga0495599_0018096 3300046678 Unclassified 4387
545 Ga0495658_0021146 3300046683 Unclassified 3427
546 Ga0495658_0088013 3300046683 Bacteria 1835
547 Ga0495613_0066387 3300046689 Bacteria 2635
548 Ga0495636_0026492 3300047318 Bacteria 2359
549 Ga0495674_0171976 3300047319 Unclassified 1807
550 Ga0495672_0014261 3300047320 Bacteria 5450
551 Ga0496100_0085321 3300048903 Bacteria 2143
552 Ga0496102_0045769 3300048905 Bacteria 3973
553 Ga0496103_0252067 3300048906 Unclassified 1136
554 Ga0496104_0136004 3300048907 Unclassified 2361
555 Ga0496104_0288005 3300048907 Bacteria 1555
556 Ga0496106_0001611 3300048909 Bacteria 16954
557 Ga0496106_0148481 3300048909 Bacteria 1848
558 Ga0496106_0256035 3300048909 Unclassified 1400
559 Ga0496107_0199231 3300048910 Bacteria 1488
560 Ga0496107_0369341 3300048910 Bacteria 1067
561 Ga0496108_0044067 3300048911 Bacteria 3726
562 Ga0496108_0160284 3300048911 Unclassified 1944
563 Ga0496108_0430753 3300048911 Bacteria 1152
564 Ga0496109_0000151 3300048912 Bacteria 68525
565 Ga0496109_0117114 3300048912 Bacteria 2480
566 Ga0496110_0221978 3300048913 Unclassified 1719
567 Ga0496112_0040600 3300048915 Bacteria 4550
568 Ga0496112_0054171 3300048915 Bacteria 3941
569 Ga0496112_0081576 3300048915 Bacteria 3199
570 Ga0496113_0189446 3300048916 Bacteria 1633
571 Ga0496115_0002364 3300048918 Bacteria 13530
572 Ga0501291_007177 3300049514 Unclassified 1504
573 Ga0501296_002086 3300049519 Bacteria 2056
574 Ga0501297_004774 3300049520 Unclassified 1399
575 Ga0501298_000750 3300049521 Bacteria 4555
576 Ga0501298_001029 3300049521 Bacteria 3994
577 Ga0501300_006002 3300049523 Unclassified 1790
578 Ga0501037_0124388 3300049573 Bacteria 1853
579 Ga0501038_0005634 3300049574 Bacteria 11618
580 Ga0501038_0153743 3300049574 Bacteria 1874
581 Ga0501039_0128033 3300049575 Bacteria 1992
582 Ga0501040_0021222 3300049576 Bacteria 4334
583 Ga0501040_0277882 3300049576 Unclassified 1196
584 Ga0501042_0000856 3300049578 Bacteria 16973
585 Ga0501043_0012892 3300049579 Bacteria 6533
586 Ga0501046_0018770 3300049580 Bacteria 5747
587 Ga0501046_0028416 3300049580 Bacteria 4554
588 Ga0501048_0013522 3300049582 Bacteria 6056
589 Ga0501048_0169708 3300049582 Bacteria 1545
590 Ga0501068_0008502 3300049584 Bacteria 5717
591 Ga0501070_0015855 3300049586 Bacteria 6336
592 Ga0501071_0015441 3300049587 Bacteria 5242
593 Ga0501072_0003762 3300049588 Bacteria 11457
594 Ga0501074_0061177 3300049590 Bacteria 2713
595 Ga0501074_0097545 3300049590 Bacteria 2104
596 Ga0501075_0001651 3300049591 Bacteria 14648
597 Ga0501076_0002128 3300049592 Bacteria 13587
598 Ga0501077_0220349 3300049593 Bacteria 1206
599 Ga0501207_003735 3300049654 Bacteria 2042
600 Ga0501209_003496 3300049656 Bacteria 2603
601 Ga0501216_003936 3300049660 Bacteria 2186
602 Ga0501217_000958 3300049661 Bacteria 5182
603 Ga0501217_031303 3300049661 Bacteria 1310
604 Ga0501224_001749 3300049664 Bacteria 2918
605 Ga0501227_005436 3300049665 Bacteria 2726
606 Ga0501227_029313 3300049665 Unclassified 1312
607 Ga0501233_015533 3300049668 Bacteria 1569
608 Ga0501235_007610 3300049669 Bacteria 2360
609 Ga0501235_028301 3300049669 Bacteria 1259
610 Ga0501249_013737 3300049679 Unclassified 1722
611 Ga0501257_002806 3300049686 Bacteria 3685
612 Ga0501225_0000502 3300049705 Bacteria 12197
613 Ga0501225_0035424 3300049705 Bacteria 1374
614 Ga0501234_017100 3300049707 Unclassified 1146
615 Ga0501245_012803 3300049708 Bacteria 1235
616 Ga0501079_0021340 3300049741 Bacteria 4953
617 Ga0501080_0002839 3300049742 Bacteria 15218
618 Ga0501080_0151552 3300049742 Bacteria 2143
619 Ga0501081_0003753 3300049743 Bacteria 9725
620 Ga0501264_003302 3300049761 Unclassified 1469
621 Ga0501268_009090 3300049765 Bacteria 1521
622 Ga0501272_002749 3300049769 Bacteria 1755
623 Ga0501272_004189 3300049769 Unclassified 1493
624 Ga0501273_000676 3300049770 Bacteria 2868
625 Ga0501035_0010538 3300049822 Bacteria 8566
626 Ga0501035_0239662 3300049822 Bacteria 1543
627 Ga0501044_0031485 3300049823 Bacteria 5583
628 Ga0501045_0000752 3300049824 Bacteria 20740
629 Ga0501212_000220 3300049851 Bacteria 5033
630 Ga0501226_001347 3300049853 Bacteria 3172
631 nmdc:mga05p37_125124_c1 3300050507 Bacteria 3157
632 nmdc:mga05p37_143453_c1 3300050507 Unclassified 2925
633 nmdc:mga05p37_31687_c1 3300050507 Bacteria 6460
634 nmdc:mga05p37_38485_c1 3300050507 Bacteria 5867
635 nmdc:mga05p37_55941_c1 3300050507 Bacteria 4857
636 nmdc:mga05p37_6284_c1 3300050507 Bacteria 13981
637 nmdc:mga09592_395317_c1 3300050508 Unclassified 1195
638 nmdc:mga0qj67_19659_c1 3300050509 Bacteria 5163
639 nmdc:mga06r32_102322_c1 3300050510 Unclassified 2812
640 nmdc:mga06r32_129213_c1 3300050510 Unclassified 2497
641 nmdc:mga06r32_309760_c1 3300050510 Bacteria 1565
642 nmdc:mga06r32_34585_c1 3300050510 Bacteria 4766
643 nmdc:mga06r32_94279_c1 3300050510 Bacteria 2929
644 nmdc:mga08y16_171581_c1 3300050511 Bacteria 2253
645 nmdc:mga08y16_18816_c1 3300050511 Bacteria 7277
646 nmdc:mga08y16_47607_c1 3300050511 Bacteria 4488
647 nmdc:mga0n895_224117_c1 3300050512 Bacteria 1908
648 nmdc:mga0n895_265260_c1 3300050512 Bacteria 1742
649 nmdc:mga0n895_312716_c1 3300050512 Bacteria 1592
650 nmdc:mga0n895_43491_c1 3300050512 Bacteria 4377
651 nmdc:mga0rr50_102_c1 3300050513 Bacteria 48211
652 nmdc:mga0rr50_114886_c1 3300050513 Bacteria 2135
653 nmdc:mga08x19_29_c1 3300050514 Bacteria 214647
654 nmdc:mga08x19_9600_c1 3300050514 Bacteria 5792
655 nmdc:mga0a205_10093_c1 3300050515 Bacteria 8666
656 nmdc:mga0a205_11585_c1 3300050515 Bacteria 8124
657 nmdc:mga0a205_137578_c1 3300050515 Unclassified 2343
658 nmdc:mga0a205_227111_c1 3300050515 Unclassified 1751
659 nmdc:mga0a205_70461_c1 3300050515 Bacteria 3376
660 nmdc:mga0a205_72069_c1 3300050515 Unclassified 3337
661 nmdc:mga0a205_9020_c1 3300050515 Bacteria 9090
662 Ga0500616_0001243 3300053153 Bacteria 25559
663 Ga0501084_0004575 3300054114 Bacteria 11309
664 Ga0501084_0099622 3300054114 Bacteria 2440
665 Ga0501084_0260547 3300054114 Unclassified 1464
666 Ga0501082_0001413 3300060353 Bacteria 21097
667 Ga0501082_0126238 3300060353 Unclassified 2219
668 Ga0530510_0006514 3300061734 Bacteria 8130
669 Ga0530510_0082574 3300061734 Bacteria 2340
670 Ga0495645_0158420
671 SwRhRL2b_contig_3248323
672 SwRhRL2b_contig_930207
673 JGI24034J14986_100701
674 JGI24748J21848_1000087
675 JGI24034J26672_10000070
676 JGI24751J29686_10000003
677 Ga0065714_10064425
678 Ga0065704_10001798
679 Ga0065704_10103794
680 Ga0065712_10007213
681 Ga0065712_10073393
682 Ga0065712_10081567
683 Ga0065715_10004743
684 Ga0065715_10009049
685 Ga0065715_10011790
686 Ga0065715_10089787
687 Ga0065715_10091778
688 Ga0065715_10092707
689 Ga0065715_10100599
690 Ga0065715_10120886
691 Ga0065707_10003391
692 Ga0065707_10010339
693 Ga0065707_10022558
694 Ga0065707_10106408
695 Ga0070690_100004965
696 Ga0070690_100006953
697 Ga0070670_100000167
698 Ga0070670_100388882
699 Ga0070677_10045044
700 Ga0068869_100009811
701 Ga0068869_100011059
702 Ga0068869_100029718
703 Ga0070666_10026016
704 Ga0070666_10109667
705 Ga0070680_100001034
706 Ga0070680_100015092
707 Ga0070680_100039864
708 Ga0070682_100000091
709 Ga0070682_100005562
710 Ga0070682_100032834
711 Ga0068868_100004335
712 Ga0068868_100032433
713 Ga0068868_100242512
714 Ga0070687_100010093
715 Ga0070687_100035319
716 Ga0070687_100183174
717 Ga0070692_10022540
718 Ga0070669_100002809
719 Ga0070669_100055936
720 Ga0070669_100094863
721 Ga0070669_100097785
722 Ga0070675_100088824
723 Ga0070675_100193338
724 Ga0070671_100002409
725 Ga0070671_100017845
726 Ga0070671_100088722
727 Ga0070673_100012647
728 Ga0070673_100013703
729 Ga0070673_100101009
730 Ga0070673_100163397
731 Ga0070688_100013752
732 Ga0070659_100102184
733 Ga0070659_100460627
734 Ga0070703_10000077
735 Ga0070713_100110637
736 Ga0070711_100304170
737 Ga0070705_100002034
738 Ga0070705_100055836
739 Ga0070705_100114510
740 Ga0070700_100000426
741 Ga0070700_100004146
742 Ga0070700_100027634
743 Ga0070694_100083005
744 Ga0070694_100086493
745 Ga0070694_100222632
746 Ga0070708_100278888
747 Ga0070662_100097957
748 Ga0070681_10000103
749 Ga0070681_10011795
750 Ga0070681_10013042
751 Ga0070685_10044218
752 Ga0070706_100000053
753 Ga0070706_100007385
754 Ga0070706_100045943
755 Ga0070706_100068352
756 Ga0070706_100200839
757 Ga0070707_100000197
758 Ga0070707_100042211
759 Ga0070707_100071459
760 Ga0070707_100073340
761 Ga0070707_100146918
762 Ga0070698_100002114
763 Ga0070698_100002889
764 Ga0070698_100007387
765 Ga0070698_100021483
766 Ga0070698_100021996
767 Ga0070698_100026001
768 Ga0070698_100079021
769 Ga0070699_100010950
770 Ga0070699_100038519
771 Ga0070699_100097757
772 Ga0070679_100000492
773 Ga0070679_100013568
774 Ga0070679_100148320
775 Ga0070684_100221031
776 Ga0070684_100343737
777 Ga0070697_100000095
778 Ga0070697_100000143
779 Ga0070697_100001842
780 Ga0070697_100026726
781 Ga0070697_100125068
782 Ga0068853_100384080
783 Ga0070672_100031067
784 Ga0070672_100224210
785 Ga0070686_100002485
786 Ga0070686_100004419
787 Ga0070686_100004724
788 Ga0070686_100014487
789 Ga0070686_100019207
790 Ga0070695_100047185
791 Ga0070695_100075792
792 Ga0070695_100205633
793 Ga0070696_100013338
794 Ga0070696_100019819
795 Ga0070696_100027274
796 Ga0070696_100125390
797 Ga0070696_100178722
798 Ga0070693_100000878
799 Ga0070693_100018480
800 Ga0070693_100026687
801 Ga0070693_100035585
802 Ga0070693_100043989
803 Ga0070693_100049706
804 Ga0070693_100080490
805 Ga0070704_100012733
806 Ga0070704_100036771
807 Ga0070704_100228009
808 Ga0068855_100335241
809 Ga0070664_100000399
810 Ga0068857_100003943
811 Ga0068854_100019481
812 Ga0068854_100044134
813 Ga0068854_100044960
814 Ga0068854_100169970
815 Ga0068856_100001146
816 Ga0068856_100082012
817 Ga0068856_100116379
818 Ga0070702_100015680
819 Ga0070702_100081130
820 Ga0068852_100429021
821 Ga0068859_100000994
822 Ga0068859_100013713
823 Ga0068859_100020559
824 Ga0068859_100065972
825 Ga0068859_100097141
826 Ga0068859_100126939
827 Ga0068859_100130997
828 Ga0068864_100002379
829 Ga0068864_100036778
830 Ga0068864_100215322
831 Ga0068864_100274530
832 Ga0068864_100546879
833 Ga0068866_10006640
834 Ga0068861_100002995
835 Ga0068861_100285509
836 Ga0068870_10019119
837 Ga0068870_10020803
838 Ga0068870_10212611
839 Ga0068863_100007830
840 Ga0068863_100014644
841 Ga0068863_100066196
842 Ga0068863_100118558
843 Ga0068863_100303113
844 Ga0068858_100000077
845 Ga0068858_100029631
846 Ga0068858_100058924
847 Ga0068858_100065325
848 Ga0068858_100327627
849 Ga0068860_100006429
850 Ga0068860_100007591
851 Ga0068860_100015475
852 Ga0068860_100019122
853 Ga0068860_100019966
854 Ga0068860_100127128
855 Ga0068860_100131223
856 Ga0068860_100163476
857 Ga0068862_100012348
858 Ga0081455_10005508
859 Ga0081455_10124760
860 Ga0081539_10001126
861 Ga0081539_10002144
862 Ga0070717_10010741
863 Ga0070715_10000010
864 Ga0070716_100000004
865 Ga0070716_100076873
866 Ga0097621_100002148
867 Ga0097621_100013481
868 Ga0097621_100049890
869 Ga0068871_100001307
870 Ga0068871_100015084
871 Ga0068871_100032871
872 Ga0068871_100045549
873 Ga0068871_100109002
874 Ga0075428_100048414
875 Ga0075428_100172873
876 Ga0075431_100208416
877 Ga0075431_100268104
878 Ga0075433_10005899
879 Ga0075433_10029652
880 Ga0075433_10033398
881 Ga0075433_10054727
882 Ga0075433_10217498
883 Ga0075434_100000642
884 Ga0075434_100035193
885 Ga0075434_100133673
886 Ga0075434_100321903
887 Ga0075434_100678012
888 Ga0075429_100152893
889 Ga0068865_100033930
890 Ga0075436_100051780
891 Ga0097620_100000994
892 Ga0097620_100013713
893 Ga0097620_100020559
894 Ga0097620_100065973
895 Ga0097620_100097141
896 Ga0097620_100126945
897 Ga0097620_100131001
898 Ga0097620_100217332
899 Ga0075435_100003777
900 Ga0075435_100233604
901 Ga0099794_10114538
902 Ga0105240_10003947
903 Ga0105240_10021642
904 Ga0105240_10058744
905 Ga0111539_10001706
906 Ga0111539_10021254
907 Ga0111539_10023803
908 Ga0111539_10240752
909 Ga0105245_10005694
910 Ga0105245_10192631
911 Ga0105247_10000015
912 Ga0105247_10002274
913 Ga0114129_10006170
914 Ga0114129_10016614
915 Ga0114129_10018678
916 Ga0114129_10023494
917 Ga0114129_10040881
918 Ga0114129_10069585
919 Ga0114129_10087518
920 Ga0114129_10134259
921 Ga0114129_10168692
922 Ga0114129_10310863
923 Ga0105243_10000283
924 Ga0105243_10000350
925 Ga0105243_10009281
926 Ga0105243_10013270
927 Ga0105243_10089776
928 Ga0105243_10280671
929 Ga0105241_10040711
930 Ga0105241_10052494
931 Ga0105242_10000235
932 Ga0105242_10000694
933 Ga0105242_10006761
934 Ga0105242_10019042
935 Ga0105242_10034332
936 Ga0105242_10264162
937 Ga0105248_10005966
938 Ga0105248_10043134
939 Ga0105248_10076539
940 Ga0105248_10229451
941 Ga0105248_10344766
942 Ga0105248_10429542
943 Ga0105248_10564376
944 Ga0105248_10579047
945 Ga0105237_10006325
946 Ga0105237_10010011
947 Ga0105237_10026320
948 Ga0105237_10094132
949 Ga0105238_10005440
950 Ga0105238_10007235
951 Ga0105238_10039424
952 Ga0105238_10370216
953 Ga0105249_10000018
954 Ga0105249_10129141
955 Ga0105249_10148309
956 Ga0105249_10328081
957 Ga0105239_10058238
958 Ga0105239_10235428
959 Ga0105246_10026458
960 Ga0157373_10006546
961 Ga0157373_10099097
962 Ga0157373_10122099
963 Ga0157371_10090139
964 Ga0157370_10218513
965 Ga0157369_10084635
966 Ga0157374_10084409
967 Ga0157374_10121431
968 Ga0157374_10309407
969 Ga0157378_10000095
970 Ga0157378_10001621
971 Ga0157378_10012834
972 Ga0157378_10019191
973 Ga0157378_10020181
974 Ga0157378_10031802
975 Ga0157378_10036464
976 Ga0157378_10088772
977 Ga0157378_10111867
978 Ga0163162_10000001
979 Ga0163162_10001376
980 Ga0163162_10005973
981 Ga0163162_10023086
982 Ga0163162_10062368
983 Ga0163162_10123575
984 Ga0157372_10006380
985 Ga0157372_10042170
986 Ga0157375_10015321
987 Ga0157375_10097288
988 Ga0157375_10128480
989 Ga0157375_10313569
990 Ga0157375_10395901
991 Ga0157375_10524988
992 Ga0163163_10000298
993 Ga0163163_10000769
994 Ga0163163_10002579
995 Ga0163163_10017394
996 Ga0163163_10021823
997 Ga0163163_10032131
998 Ga0163163_10034727
999 Ga0163163_10149175
1000 Ga0163163_10278971
1001 Ga0163163_10294954
1002 Ga0163163_10386490
1003 Ga0157380_10000312
1004 Ga0157380_10000396
1005 Ga0157380_10001184
1006 Ga0157380_10039879
1007 Ga0157380_10043381
1008 Ga0157380_10192728
1009 Ga0157380_10331288
1010 Ga0157379_10038187
1011 Ga0157376_10000158
1012 Ga0157376_10258659
1013 Ga0163161_10012135
1014 Ga0163161_10023688
1015 Ga0213872_10018868
1016 Ga0213875_10027641
1017 Ga0207653_10000326
1018 Ga0207653_10020630
1019 Ga0207682_10028837
1020 Ga0207710_10000004
1021 Ga0207710_10000575
1022 Ga0207680_10041453
1023 Ga0207680_10063380
1024 Ga0207647_10011682
1025 Ga0207685_10000006
1026 Ga0207643_10001070
1027 Ga0207643_10010513
1028 Ga0207643_10032351
1029 Ga0207643_10081916
1030 Ga0207643_10211475
1031 Ga0207684_10000053
1032 Ga0207684_10004659
1033 Ga0207684_10011087
1034 Ga0207684_10014452
1035 Ga0207707_10000033
1036 Ga0207707_10043224
1037 Ga0207707_10071675
1038 Ga0207707_10095161
1039 Ga0207695_10006656
1040 Ga0207671_10004666
1041 Ga0207671_10030000
1042 Ga0207671_10061854
1043 Ga0207663_10106893
1044 Ga0207663_10246065
1045 Ga0207660_10000364
1046 Ga0207660_10011501
1047 Ga0207660_10048302
1048 Ga0207662_10001073
1049 Ga0207662_10006092
1050 Ga0207662_10012150
1051 Ga0207662_10060778
1052 Ga0207657_10209247
1053 Ga0207649_10276657
1054 Ga0207652_10000032
1055 Ga0207652_10032165
1056 Ga0207652_10174121
1057 Ga0207646_10001700
1058 Ga0207646_10003397
1059 Ga0207646_10028626
1060 Ga0207646_10055709
1061 Ga0207646_10066102
1062 Ga0207646_10099853
1063 Ga0207681_10000902
1064 Ga0207681_10029293
1065 Ga0207681_10036365
1066 Ga0207694_10003281
1067 Ga0207694_10009398
1068 Ga0207694_10016080
1069 Ga0207694_10059105
1070 Ga0207650_10000007
1071 Ga0207650_10000504
1072 Ga0207650_10135137
1073 Ga0207650_10332485
1074 Ga0207687_10004879
1075 Ga0207687_10011956
1076 Ga0207644_10001811
1077 Ga0207644_10001852
1078 Ga0207644_10167535
1079 Ga0207690_10198739
1080 Ga0207686_10000021
1081 Ga0207686_10000318
1082 Ga0207686_10001321
1083 Ga0207686_10023046
1084 Ga0207686_10034960
1085 Ga0207686_10036511
1086 Ga0207686_10050115
1087 Ga0207709_10000069
1088 Ga0207709_10004936
1089 Ga0207709_10014659
1090 Ga0207670_10307910
1091 Ga0207704_10009942
1092 Ga0207665_10000139
1093 Ga0207665_10063134
1094 Ga0207691_10000991
1095 Ga0207691_10237448
1096 Ga0207711_10004098
1097 Ga0207711_10005871
1098 Ga0207711_10018504
1099 Ga0207711_10029508
1100 Ga0207689_10022598
1101 Ga0207689_10062015
1102 Ga0207689_10148402
1103 Ga0207689_10279422
1104 Ga0207661_10027684
1105 Ga0207679_10285361
1106 Ga0207679_10481233
1107 Ga0207667_10002312
1108 Ga0207651_10019355
1109 Ga0207651_10033719
1110 Ga0207651_10141966
1111 Ga0207651_10220085
1112 Ga0207712_10000081
1113 Ga0207712_10004444
1114 Ga0207712_10029295
1115 Ga0207712_10158569
1116 Ga0207668_10004533
1117 Ga0207640_10014000
1118 Ga0207640_10110238
1119 Ga0207658_10083773
1120 Ga0207677_10007186
1121 Ga0207677_10083524
1122 Ga0207677_10261100
1123 Ga0207703_10011010
1124 Ga0207703_10016670
1125 Ga0207703_10050171
1126 Ga0207703_10075478
1127 Ga0207703_10092744
1128 Ga0207703_10093180
1129 Ga0207703_10114577
1130 Ga0207703_10116319
1131 Ga0207703_10276323
1132 Ga0207703_10402281
1133 Ga0207639_10064225
1134 Ga0207639_10219902
1135 Ga0207708_10000096
1136 Ga0207708_10005969
1137 Ga0207708_10016590
1138 Ga0207708_10017440
1139 Ga0207708_10042621
1140 Ga0207708_10060669
1141 Ga0207708_10185985
1142 Ga0207702_10010876
1143 Ga0207702_10086434
1144 Ga0207641_10009016
1145 Ga0207641_10116896
1146 Ga0207641_10166413
1147 Ga0207641_10333330
1148 Ga0207648_10001293
1149 Ga0207648_10085218
1150 Ga0207676_10003315
1151 Ga0207676_10055935
1152 Ga0207676_10073384
1153 Ga0207676_10078963
1154 Ga0207674_10000058
1155 Ga0207674_10043224
1156 Ga0207674_10097352
1157 Ga0207674_10132940
1158 Ga0207674_10330714
1159 Ga0207675_100001711
1160 Ga0207675_100005590
1161 Ga0207675_100014439
1162 Ga0207675_100024259
1163 Ga0207675_100186980
1164 Ga0207698_10278906
1165 Ga0207428_10006650
1166 Ga0207428_10013108
1167 Ga0207428_10280788
1168 Ga0268264_10009577
1169 Ga0268264_10017289
1170 Ga0268264_10018974
1171 Ga0268264_10093460
1172 Ga0268264_10104585
1173 Ga0268264_10233891
1174 Ga0307405_10064940
1175 Ga0307413_10028563
1176 Ga0307406_10062816
1177 Ga0307412_10002204
1178 Ga0307409_100046695
1179 Ga0307409_100079862
1180 Ga0307416_100186698
1181 Ga0307416_100452099
1182 Ga0307414_10002865
1183 Ga0307411_10015779
1184 Ga0307415_100040909
1185 Ga0373943_0006189
1186 Ga0373942_0003133
1187 Ga0373925_0028297
1188 Ga0373925_0335844
1189 Ga0395900_0094831
1190 Ga0436364_0566928
1191 Ga0436364_1078325
1192 Ga0395901_0039638
1193 Ga0242422_00204
1194 Ga0242420_025267
1195 Ga0436365_0224719
1196 Ga0436361_1039433
1197 Ga0436362_1169302
1198 Ga0439448_0010185
1199 Ga0439455_0050329
1200 Ga0439434_0048382
1201 Ga0453683_0083739
1202 Ga0451576_0072114
1203 Ga0451576_0370311
1204 Ga0451576_0540803
1205 Ga0495580_0000800
1206 Ga0495582_0000117
1207 Ga0495662_0017931
1208 Ga0495618_0102750
1209 Ga0495630_0239428
1210 Ga0495643_0037054
1211 Ga0495663_0000086
1212 Ga0495598_0000022
1213 Ga0495599_0018096
1214 Ga0495658_0021146
1215 Ga0495658_0088013
1216 Ga0495613_0066387
1217 Ga0495636_0026492
1218 Ga0495674_0171976
1219 Ga0495672_0014261
1220 Ga0496100_0085321
1221 Ga0496102_0045769
1222 Ga0496103_0252067
1223 Ga0496104_0136004
1224 Ga0496104_0288005
1225 Ga0496106_0001611
1226 Ga0496106_0148481
1227 Ga0496106_0256035
1228 Ga0496107_0199231
1229 Ga0496107_0369341
1230 Ga0496108_0044067
1231 Ga0496108_0160284
1232 Ga0496108_0430753
1233 Ga0496109_0000151
1234 Ga0496109_0117114
1235 Ga0496110_0221978
1236 Ga0496112_0040600
1237 Ga0496112_0054171
1238 Ga0496112_0081576
1239 Ga0496113_0189446
1240 Ga0496115_0002364
1241 Ga0501291_007177
1242 Ga0501296_002086
1243 Ga0501297_004774
1244 Ga0501298_000750
1245 Ga0501298_001029
1246 Ga0501300_006002
1247 Ga0501037_0124388
1248 Ga0501038_0005634
1249 Ga0501038_0153743
1250 Ga0501039_0128033
1251 Ga0501040_0021222
1252 Ga0501040_0277882
1253 Ga0501042_0000856
1254 Ga0501043_0012892
1255 Ga0501046_0018770
1256 Ga0501046_0028416
1257 Ga0501048_0013522
1258 Ga0501048_0169708
1259 Ga0501068_0008502
1260 Ga0501070_0015855
1261 Ga0501071_0015441
1262 Ga0501072_0003762
1263 Ga0501074_0061177
1264 Ga0501074_0097545
1265 Ga0501075_0001651
1266 Ga0501076_0002128
1267 Ga0501077_0220349
1268 Ga0501207_003735
1269 Ga0501209_003496
1270 Ga0501216_003936
1271 Ga0501217_000958
1272 Ga0501217_031303
1273 Ga0501224_001749
1274 Ga0501227_005436
1275 Ga0501227_029313
1276 Ga0501233_015533
1277 Ga0501235_007610
1278 Ga0501235_028301
1279 Ga0501249_013737
1280 Ga0501257_002806
1281 Ga0501225_0000502
1282 Ga0501225_0035424
1283 Ga0501234_017100
1284 Ga0501245_012803
1285 Ga0501079_0021340
1286 Ga0501080_0002839
1287 Ga0501080_0151552
1288 Ga0501081_0003753
1289 Ga0501264_003302
1290 Ga0501268_009090
1291 Ga0501272_002749
1292 Ga0501272_004189
1293 Ga0501273_000676
1294 Ga0501035_0010538
1295 Ga0501035_0239662
1296 Ga0501044_0031485
1297 Ga0501045_0000752
1298 Ga0501212_000220
1299 Ga0501226_001347
1300 nmdc:mga05p37_125124_c1
1301 nmdc:mga05p37_143453_c1
1302 nmdc:mga05p37_31687_c1
1303 nmdc:mga05p37_38485_c1
1304 nmdc:mga05p37_55941_c1
1305 nmdc:mga05p37_6284_c1
1306 nmdc:mga09592_395317_c1
1307 nmdc:mga0qj67_19659_c1
1308 nmdc:mga06r32_102322_c1
1309 nmdc:mga06r32_129213_c1
1310 nmdc:mga06r32_309760_c1
1311 nmdc:mga06r32_34585_c1
1312 nmdc:mga06r32_94279_c1
1313 nmdc:mga08y16_171581_c1
1314 nmdc:mga08y16_18816_c1
1315 nmdc:mga08y16_47607_c1
1316 nmdc:mga0n895_224117_c1
1317 nmdc:mga0n895_265260_c1
1318 nmdc:mga0n895_312716_c1
1319 nmdc:mga0n895_43491_c1
1320 nmdc:mga0rr50_102_c1
1321 nmdc:mga0rr50_114886_c1
1322 nmdc:mga08x19_29_c1
1323 nmdc:mga08x19_9600_c1
1324 nmdc:mga0a205_10093_c1
1325 nmdc:mga0a205_11585_c1
1326 nmdc:mga0a205_137578_c1
1327 nmdc:mga0a205_227111_c1
1328 nmdc:mga0a205_70461_c1
1329 nmdc:mga0a205_72069_c1
1330 nmdc:mga0a205_9020_c1
1331 Ga0500616_0001243
1332 Ga0501084_0004575
1333 Ga0501084_0099622
1334 Ga0501084_0260547
1335 Ga0501082_0001413
1336 Ga0501082_0126238
1337 Ga0530510_0006514
1338 Ga0530510_0082574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

62

230

0.88

PF13353

Fer4_12

4Fe-4S single cluster domain

62

183

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.7727 31 224
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.7389 24 299
5exi-assembly1.cif.gz_A crystal structure of m. tuberculosis lipoyl synthase at 2.28 a resolution 0.7309 31 222
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.7121 33 218
7voc-assembly1.cif.gz_C the crystal structure of a radical sam enzyme blse involved in the biosynthesis of blasticidin s 0.71 26 319
ID Description Score Start End Superfamily
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7843 31 224 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7783 26 224 3.20.20.70
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7699 17 268 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7678 32 223 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7666 28 200 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3N5XMT7-F1-model_v4 Radical SAM protein 0.9754 1 304 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V9TXE9-F1-model_v4 Radical SAM protein 0.9743 2 222 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V8FWE1-F1-model_v4 Radical SAM protein 0.9638 28 316 GO:0003824
GO:0046872
GO:0051536
AF-A0A3N5XMT7-F1-model_v4 Radical SAM protein 0.9629 1 304 GO:0003824
GO:0046872
GO:0051536
AF-A0A0J7N5D5-F1-model_v4 Radical sam protein 0.955 32 312 GO:0003824
GO:0046872
GO:0051536

Map