F474006

General Info

Members Datasets Scaffolds Average Seq Length
669 367 1338 262

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10082720|Ga0157379_100827203
Length 272
Sequence MDTTETPTMSKPVQKLFDLTGQTALITGGSRGLGLQMAHALGEAGAKVMLSSRKAEDLEKAAAELQAAGIDARWIAADCAKEEDTRRLADETLERMGTIDILVNNAGASWGAPAEDHPVPAWDKVMDLNVRGYFILSQQVARNCMIPKKRGRIINIASIAGLNGNPPEMQTLAYNTSKSAVIGFTHTLAAEWGKYNITVNAICPGFFMTKMASGLIKSLGEDKMAAAAPLGRLGDDDDLKGIALLYASEAGKHITGQWLAVDGGVSVVLGAA

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
110 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
204 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
217 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
218 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
283 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
284 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
285 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
286 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
308 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
309 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
312 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
313 2547132374 Acidovorax radicis N35 Isolate Unclassified
314 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
315 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
316 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
317 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
318 2643221570 Acidovorax sp. Root568 Isolate Unclassified
319 2643221596 Acidovorax sp. Root70 Isolate Unclassified
320 2643221609 Acidovorax sp. Root217 Isolate Unclassified
321 2643221611 Acidovorax sp. Root219 Isolate Unclassified
322 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
323 2643221652 Acidovorax sp. Root402 Isolate Unclassified
324 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
325 2643221658 Variovorax sp. Root411 Isolate Unclassified
326 2643221672 Variovorax sp. Root434 Isolate Unclassified
327 2643221683 Variovorax sp. Root473 Isolate Unclassified
328 2643221717 Acidovorax sp. Root267 Isolate Unclassified
329 2738541277 Variovorax sp. GV051 Isolate Unclassified
330 2738541307 Variovorax sp. GV008 Isolate Unclassified
331 2738543012 Acidovorax sp. CF301 Isolate Unclassified
332 2738543013 Variovorax sp. BT01 Isolate Unclassified
333 2738543019 Variovorax sp. GV040 Isolate Unclassified
334 2816332133 Acidovorax radicis 2721A Isolate Unclassified
335 2818991446 Variovorax sp. 1180 Isolate Unclassified
336 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
337 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
338 2842677519 Variovorax sp. R-72495 Isolate Unclassified
339 2842733646 Variovorax sp. R-72446 Isolate Unclassified
340 2842747753 Variovorax sp. R-72060 Isolate Unclassified
341 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
342 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
343 2885198086 Variovorax sp. 679 Isolate Unclassified
344 2885211737 Variovorax sp. 553 Isolate Unclassified
345 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
346 2899924645 Variovorax sp. 369 Isolate Unclassified
347 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
348 2904456579 Variovorax sp. 2002 Isolate Unclassified
349 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
350 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
351 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
352 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
353 2928037797 Variovorax sp. 1126 Isolate Unclassified
354 2928044640 Variovorax sp. 1128 Isolate Unclassified
355 2928051484 Variovorax sp. 1133 Isolate Unclassified
356 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
357 2928070936 Variovorax gossypii 1167 Isolate Unclassified
358 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
359 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
360 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
361 2929520902 Variovorax beijingensis 502 Isolate Unclassified
362 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
363 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
364 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
365 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
366 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
367 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 0.15
Isolates 8.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.03
Nodule 0.9
Rhizoplane 3.29
Rhizosphere 49.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10082720 3300014968 Bacteria 2877
2 JGI24739J22299_10063818 3300001989 Bacteria 1158
3 JGI25155J39150_1000002 3300002704 Bacteria 292156
4 JGI25156J39149_1000003 3300002705 Bacteria 305434
5 JGI25154J39366_1000009 3300002738 Bacteria 305408
6 JGI25158J39367_1012831 3300002739 Bacteria 1101
7 JGI25157J39369_1000002 3300002741 Bacteria 305434
8 JGI25152J39213_1004862 3300002773 Bacteria 4102
9 JGI25150J39212_1000299 3300002774 Bacteria 25300
10 JGI25159J45721_1000302 3300002987 Bacteria 23151
11 JGI25159J45721_1000502 3300002987 Bacteria 17895
12 JGI25151J46595_10004029 3300003187 Bacteria 7884
13 JGI25151J46595_10017838 3300003187 Bacteria 3065
14 JGI25151J46595_10042425 3300003187 Bacteria 1639
15 JGI25151J46595_10044421 3300003187 Bacteria 1578
16 JGI25153J46596_10010784 3300003215 Bacteria 4102
17 JGI25153J46596_10024863 3300003215 Bacteria 2151
18 JGI25160J50197_1000145 3300003354 Bacteria 63479
19 JGI25161J50226_1000032 3300003374 Bacteria 138440
20 JGI25161J50226_1000064 3300003374 Bacteria 99448
21 JGI25161J50226_1005637 3300003374 Bacteria 2388
22 Ga0006562J51391_1053800 3300003578 Bacteria 4580
23 Ga0055527_1002929 3300003760 Bacteria 2691
24 Ga0055542_1000021 3300003762 Bacteria 331499
25 Ga0055526_1003563 3300003771 Bacteria 9805
26 Ga0055526_1029283 3300003771 Bacteria 1639
27 Ga0055526_1029388 3300003771 Bacteria 1633
28 Ga0055537_1000036 3300003773 Bacteria 96045
29 Ga0055537_1000043 3300003773 Bacteria 90816
30 Ga0055537_1008563 3300003773 Bacteria 2346
31 Ga0055537_1011422 3300003773 Bacteria 1803
32 Ga0055524_1000012 3300003775 Bacteria 260384
33 Ga0055524_1029145 3300003775 Bacteria 1639
34 Ga0055524_1029247 3300003775 Bacteria 1633
35 Ga0055536_1003402 3300003781 Bacteria 8561
36 Ga0055536_1006361 3300003781 Bacteria 5540
37 Ga0055534_1000018 3300003784 Bacteria 138136
38 Ga0055534_1001157 3300003784 Bacteria 11139
39 Ga0055534_1005165 3300003784 Bacteria 3576
40 Ga0055534_1005846 3300003784 Bacteria 3213
41 Ga0055534_1017071 3300003784 Bacteria 1289
42 Ga0055528_1000717 3300003790 Bacteria 23401
43 Ga0055528_1005325 3300003790 Bacteria 6010
44 Ga0055528_1024544 3300003790 Bacteria 1803
45 Ga0055530_10000015 3300003791 Bacteria 148790
46 Ga0055530_10001441 3300003791 Bacteria 17398
47 Ga0055530_10003937 3300003791 Bacteria 8038
48 Ga0055540_1000012 3300003792 Bacteria 262667
49 Ga0055540_1000039 3300003792 Bacteria 161844
50 Ga0055540_1000800 3300003792 Bacteria 21286
51 Ga0055540_1000917 3300003792 Bacteria 19241
52 Ga0055540_1000922 3300003792 Bacteria 19189
53 Ga0055540_1001090 3300003792 Bacteria 17194
54 Ga0055540_1010633 3300003792 Bacteria 3043
55 Ga0055540_1013853 3300003792 Bacteria 2440
56 Ga0055540_1026748 3300003792 Bacteria 1391
57 Ga0055531_10000783 3300003794 Bacteria 26398
58 Ga0055531_10001591 3300003794 Bacteria 16513
59 Ga0055531_10006340 3300003794 Bacteria 6734
60 Ga0055531_10017363 3300003794 Bacteria 3043
61 Ga0055531_10025023 3300003794 Bacteria 2182
62 Ga0055543_1000445 3300004625 Bacteria 25284
63 Ga0055543_1000752 3300004625 Bacteria 16244
64 Ga0065165_1001466 3300005262 Bacteria 25284
65 Ga0065165_1034260 3300005262 Bacteria 1572
66 Ga0065714_10106047 3300005288 Bacteria 1556
67 Ga0065704_10088873 3300005289 Bacteria 2903
68 Ga0070658_10424336 3300005327 Bacteria 1144
69 Ga0070676_10125960 3300005328 Bacteria 1614
70 Ga0070683_100023154 3300005329 Bacteria 5554
71 Ga0070670_100086168 3300005331 Bacteria 2699
72 Ga0068869_100126428 3300005334 Bacteria 1961
73 Ga0068869_100277196 3300005334 Bacteria 1347
74 Ga0070682_100069191 3300005337 Bacteria 2253
75 Ga0068868_100036763 3300005338 Bacteria 3793
76 Ga0068868_100039466 3300005338 Bacteria 3668
77 Ga0068868_100169745 3300005338 Bacteria 1806
78 Ga0070660_100018535 3300005339 Bacteria 5087
79 Ga0070660_100138639 3300005339 Bacteria 1950
80 Ga0070689_100357951 3300005340 Bacteria 1225
81 Ga0070671_100005987 3300005355 Bacteria 9690
82 Ga0070671_100261420 3300005355 Bacteria 1471
83 Ga0070673_100053169 3300005364 Bacteria 3180
84 Ga0070688_100042067 3300005365 Bacteria 2808
85 Ga0070688_100304543 3300005365 Bacteria 1153
86 Ga0070659_100104175 3300005366 Bacteria 2285
87 Ga0070667_100000740 3300005367 Bacteria 31261
88 Ga0070667_100344163 3300005367 Bacteria 1349
89 Ga0070714_100463314 3300005435 Bacteria 1205
90 Ga0070711_100169353 3300005439 Bacteria 1663
91 Ga0070663_100116610 3300005455 Bacteria 2013
92 Ga0070662_100053787 3300005457 Bacteria 2916
93 Ga0070662_100116649 3300005457 Bacteria 2041
94 Ga0068867_100003980 3300005459 Bacteria 10393
95 Ga0068867_100254608 3300005459 Bacteria 1429
96 Ga0070685_10006879 3300005466 Bacteria 5804
97 Ga0070706_100001360 3300005467 Bacteria 25993
98 Ga0070707_100026346 3300005468 Bacteria 5520
99 Ga0070679_100019048 3300005530 Bacteria 6667
100 Ga0070679_100032501 3300005530 Bacteria 5162
101 Ga0070679_100048853 3300005530 Bacteria 4215
102 Ga0070684_100019887 3300005535 Bacteria 5563
103 Ga0068853_100051532 3300005539 Bacteria 3542
104 Ga0068853_100180568 3300005539 Bacteria 1914
105 Ga0068853_100218067 3300005539 Bacteria 1741
106 Ga0070672_100089700 3300005543 Bacteria 2477
107 Ga0070665_100178385 3300005548 Bacteria 2125
108 Ga0068855_100128814 3300005563 Bacteria 2891
109 Ga0068855_100371572 3300005563 Bacteria 1572
110 Ga0068857_100072606 3300005577 Bacteria 3066
111 Ga0068857_100234502 3300005577 Bacteria 1679
112 Ga0068857_100337925 3300005577 Bacteria 1393
113 Ga0068857_100630061 3300005577 Bacteria 1015
114 Ga0068856_100014713 3300005614 Bacteria 7551
115 Ga0068856_100500716 3300005614 Bacteria 1236
116 Ga0068852_100026931 3300005616 Bacteria 4680
117 Ga0068852_100050610 3300005616 Bacteria 3560
118 Ga0068852_100064564 3300005616 Bacteria 3192
119 Ga0068864_100007691 3300005618 Bacteria 8876
120 Ga0068864_100045701 3300005618 Bacteria 3756
121 Ga0068861_100398336 3300005719 Bacteria 1221
122 Ga0068851_10021263 3300005834 Bacteria 3150
123 Ga0068870_10046046 3300005840 Bacteria 2286
124 Ga0068863_100032370 3300005841 Bacteria 4984
125 Ga0068863_100250504 3300005841 Bacteria 1711
126 Ga0068858_100623668 3300005842 Bacteria 1047
127 Ga0068862_100024240 3300005844 Bacteria 5091
128 Ga0075365_10021894 3300006038 Bacteria 3995
129 Ga0075365_10024580 3300006038 Bacteria 3802
130 Ga0075368_10024418 3300006042 Bacteria 2316
131 Ga0075368_10050310 3300006042 Bacteria 1655
132 Ga0075363_100039003 3300006048 Bacteria 2499
133 Ga0075363_100039336 3300006048 Bacteria 2489
134 Ga0075363_100106901 3300006048 Bacteria 1552
135 Ga0075364_10081220 3300006051 Bacteria 2143
136 Ga0075432_10067888 3300006058 Bacteria 1277
137 Ga0075362_10005566 3300006177 Bacteria 4625
138 Ga0075362_10008420 3300006177 Bacteria 3942
139 Ga0075362_10008792 3300006177 Bacteria 3879
140 Ga0075362_10131273 3300006177 Bacteria 1192
141 Ga0075367_10030320 3300006178 Bacteria 3100
142 Ga0075367_10214970 3300006178 Bacteria 1202
143 Ga0075367_10262799 3300006178 Bacteria 1084
144 Ga0075369_10025400 3300006186 Bacteria 2463
145 Ga0075366_10002134 3300006195 Bacteria 10056
146 Ga0075366_10005108 3300006195 Bacteria 7097
147 Ga0075366_10014460 3300006195 Bacteria 4508
148 Ga0075366_10054094 3300006195 Bacteria 2384
149 Ga0075366_10088086 3300006195 Bacteria 1859
150 Ga0075366_10103378 3300006195 Bacteria 1711
151 Ga0075366_10108480 3300006195 Bacteria 1669
152 Ga0075366_10269008 3300006195 Bacteria 1041
153 Ga0075370_10002071 3300006353 Bacteria 9132
154 Ga0075370_10002943 3300006353 Bacteria 8007
155 Ga0075370_10004326 3300006353 Bacteria 6884
156 Ga0075370_10010934 3300006353 Bacteria 4758
157 Ga0075370_10033022 3300006353 Bacteria 2896
158 Ga0075370_10033696 3300006353 Bacteria 2868
159 Ga0075370_10063650 3300006353 Bacteria 2103
160 Ga0075370_10088879 3300006353 Bacteria 1781
161 Ga0075370_10351372 3300006353 Bacteria 881
162 Ga0068871_100202725 3300006358 Bacteria 1713
163 Ga0068865_100126747 3300006881 Bacteria 1907
164 Ga0099826_10003934 3300006948 Bacteria 10271
165 Ga0099826_10024743 3300006948 Bacteria 4457
166 Ga0105244_10004770 3300009036 Bacteria 9224
167 Ga0105240_10001089 3300009093 Bacteria 47935
168 Ga0105240_10146778 3300009093 Bacteria 2814
169 Ga0105240_10172983 3300009093 Bacteria 2556
170 Ga0111539_10098507 3300009094 Bacteria 3434
171 Ga0105245_10022835 3300009098 Bacteria 5489
172 Ga0105243_10002130 3300009148 Bacteria 16732
173 Ga0105243_10011654 3300009148 Bacteria 6652
174 Ga0105243_10025185 3300009148 Bacteria 4544
175 Ga0105241_10097627 3300009174 Bacteria 2330
176 Ga0105241_10109592 3300009174 Bacteria 2208
177 Ga0105237_10160007 3300009545 Bacteria 2250
178 Ga0105238_10272126 3300009551 Bacteria 1674
179 Ga0105238_10348125 3300009551 Bacteria 1471
180 Ga0105249_10169590 3300009553 Bacteria 2115
181 Ga0105249_10513209 3300009553 Bacteria 1245
182 Ga0105239_10021489 3300010375 Bacteria 7115
183 Ga0105239_10220476 3300010375 Bacteria 2127
184 Ga0105239_10314657 3300010375 Bacteria 1765
185 Ga0105246_10015575 3300011119 Bacteria 4805
186 Ga0157373_10010819 3300013100 Bacteria 6715
187 Ga0157370_10000583 3300013104 Bacteria 45511
188 Ga0157370_10086305 3300013104 Bacteria 2948
189 Ga0157369_10009093 3300013105 Bacteria 11370
190 Ga0157374_10027594 3300013296 Bacteria 5125
191 Ga0157378_10059826 3300013297 Bacteria 3399
192 Ga0163162_10068555 3300013306 Bacteria 3599
193 Ga0157372_10123740 3300013307 Bacteria 2973
194 Ga0157372_10219446 3300013307 Bacteria 2204
195 Ga0157375_10041640 3300013308 Bacteria 4437
196 Ga0163163_10190383 3300014325 Bacteria 2100
197 Ga0182008_10001753 3300014497 Bacteria 14233
198 Ga0182008_10044364 3300014497 Bacteria 2211
199 Ga0157377_10002439 3300014745 Bacteria 8216
200 Ga0157376_10019485 3300014969 Bacteria 5231
201 Ga0157376_10129196 3300014969 Bacteria 2252
202 Ga0182006_1001664 3300015261 Bacteria 13088
203 Ga0182007_10000524 3300015262 Bacteria 22633
204 Ga0182007_10019206 3300015262 Bacteria 2461
205 Ga0183362_10001 3300015683 Bacteria 2046624
206 Ga0163161_10000139 3300017792 Bacteria 67878
207 Ga0163161_10058769 3300017792 Bacteria 2795
208 Ga0163161_10072582 3300017792 Bacteria 2520
209 Ga0163161_10349902 3300017792 Bacteria 1174
210 Ga0209435_100001 3300025206 Bacteria 1424171
211 Ga0209436_115027 3300025208 Bacteria 1212
212 Ga0209672_100751 3300025228 Bacteria 15798
213 Ga0209258_100058 3300025242 Bacteria 331567
214 Ga0207425_1000157 3300025245 Bacteria 57625
215 Ga0207425_1008756 3300025245 Bacteria 2563
216 Ga0207425_1009554 3300025245 Bacteria 2406
217 Ga0209646_1000001 3300025246 Bacteria 3092932
218 Ga0209026_1000003 3300025250 Bacteria 1060571
219 Ga0209148_1000071 3300025254 Bacteria 331551
220 Ga0209759_1000001 3300025256 Bacteria 2799452
221 Ga0209129_1000494 3300025258 Bacteria 28711
222 Ga0209129_1000562 3300025258 Bacteria 25600
223 Ga0209565_1000004 3300025263 Bacteria 983150
224 Ga0209565_1000038 3300025263 Bacteria 286433
225 Ga0209565_1000075 3300025263 Bacteria 162259
226 Ga0209565_1001286 3300025263 Bacteria 11626
227 Ga0209565_1006022 3300025263 Bacteria 3457
228 Ga0209673_1000066 3300025273 Bacteria 250037
229 Ga0209673_1000289 3300025273 Bacteria 93941
230 Ga0209673_1000357 3300025273 Bacteria 82249
231 Ga0209673_1000362 3300025273 Bacteria 81651
232 Ga0209673_1014452 3300025273 Bacteria 3053
233 Ga0209130_1000069 3300025284 Bacteria 179177
234 Ga0209130_1000082 3300025284 Bacteria 164441
235 Ga0209130_1000094 3300025284 Bacteria 145569
236 Ga0209130_1000131 3300025284 Bacteria 119977
237 Ga0209130_1003574 3300025284 Bacteria 6506
238 Ga0209675_1000061 3300025291 Bacteria 181096
239 Ga0209675_1000074 3300025291 Bacteria 162260
240 Ga0209675_1000177 3300025291 Bacteria 73574
241 Ga0209675_1006569 3300025291 Bacteria 4633
242 Ga0209675_1008579 3300025291 Bacteria 3734
243 Ga0209676_1000005 3300025292 Bacteria 1076001
244 Ga0209676_1000029 3300025292 Bacteria 520536
245 Ga0209676_1000142 3300025292 Bacteria 175752
246 Ga0209676_1000186 3300025292 Bacteria 142440
247 Ga0209676_1001149 3300025292 Bacteria 28950
248 Ga0209676_1003883 3300025292 Bacteria 8718
249 Ga0209676_1029457 3300025292 Bacteria 1695
250 Ga0209676_1046217 3300025292 Bacteria 1179
251 Ga0209025_1000056 3300025294 Bacteria 316188
252 Ga0209025_1000088 3300025294 Bacteria 255087
253 Ga0209025_1000579 3300025294 Bacteria 66370
254 Ga0209025_1004754 3300025294 Bacteria 11531
255 Ga0209025_1006826 3300025294 Bacteria 8715
256 Ga0209025_1010474 3300025294 Bacteria 6277
257 Ga0209025_1033881 3300025294 Bacteria 2348
258 Ga0209025_1036919 3300025294 Bacteria 2178
259 Ga0209564_1000090 3300025295 Bacteria 249298
260 Ga0209564_1000542 3300025295 Bacteria 60997
261 Ga0209564_1000969 3300025295 Bacteria 36292
262 Ga0209564_1010108 3300025295 Bacteria 4392
263 Ga0209758_1000044 3300025297 Bacteria 398448
264 Ga0209758_1002642 3300025297 Bacteria 17764
265 Ga0209758_1003972 3300025297 Bacteria 12820
266 Ga0209050_1000003 3300025298 Bacteria 1609245
267 Ga0209050_1000007 3300025298 Bacteria 1187891
268 Ga0209050_1001371 3300025298 Bacteria 26591
269 Ga0209050_1005923 3300025298 Bacteria 7452
270 Ga0209050_1033556 3300025298 Bacteria 1554
271 Ga0209256_1000001 3300025299 Bacteria 2166974
272 Ga0209256_1000020 3300025299 Bacteria 542402
273 Ga0209256_1000022 3300025299 Bacteria 481843
274 Ga0209256_1039745 3300025299 Bacteria 1207
275 Ga0207426_1000001 3300025302 Bacteria 1341301
276 Ga0207426_1000025 3300025302 Bacteria 532921
277 Ga0207426_1000031 3300025302 Bacteria 460699
278 Ga0209051_1000003 3300025303 Bacteria 1609245
279 Ga0209051_1000036 3300025303 Bacteria 339863
280 Ga0209051_1000078 3300025303 Bacteria 201965
281 Ga0209051_1000213 3300025303 Bacteria 98755
282 Ga0209051_1000243 3300025303 Bacteria 91605
283 Ga0209051_1000455 3300025303 Bacteria 54195
284 Ga0209051_1055976 3300025303 Bacteria 1276
285 Ga0209257_1000011 3300025304 Bacteria 1112630
286 Ga0209257_1000012 3300025304 Bacteria 1111138
287 Ga0209257_1000018 3300025304 Bacteria 836016
288 Ga0209257_1000226 3300025304 Bacteria 133836
289 Ga0209257_1000980 3300025304 Bacteria 38745
290 Ga0209257_1005033 3300025304 Bacteria 9619
291 Ga0209257_1009850 3300025304 Bacteria 4994
292 Ga0207655_1004354 3300025728 Bacteria 10071
293 Ga0207692_10161149 3300025898 Bacteria 1293
294 Ga0207688_10005897 3300025901 Bacteria 6669
295 Ga0207645_10002443 3300025907 Bacteria 14624
296 Ga0207645_10084106 3300025907 Bacteria 2042
297 Ga0207643_10091900 3300025908 Bacteria 1770
298 Ga0207705_10290095 3300025909 Bacteria 1253
299 Ga0207684_10029430 3300025910 Bacteria 4677
300 Ga0207695_10038007 3300025913 Bacteria 5189
301 Ga0207695_10049144 3300025913 Bacteria 4449
302 Ga0207695_10148614 3300025913 Bacteria 2284
303 Ga0207695_10216207 3300025913 Bacteria 1825
304 Ga0207671_10028247 3300025914 Bacteria 4192
305 Ga0207663_10032366 3300025916 Bacteria 3103
306 Ga0207657_10054433 3300025919 Bacteria 3460
307 Ga0207657_10095312 3300025919 Bacteria 2476
308 Ga0207657_10139848 3300025919 Bacteria 1979
309 Ga0207649_10327865 3300025920 Bacteria 1127
310 Ga0207652_10073160 3300025921 Bacteria 2981
311 Ga0207652_10197470 3300025921 Bacteria 1810
312 Ga0207681_10027536 3300025923 Bacteria 3676
313 Ga0207694_10127612 3300025924 Bacteria 2036
314 Ga0207694_10204478 3300025924 Bacteria 1607
315 Ga0207650_10065460 3300025925 Bacteria 2724
316 Ga0207687_10216432 3300025927 Bacteria 1506
317 Ga0207644_10034779 3300025931 Bacteria 3527
318 Ga0207644_10337769 3300025931 Bacteria 1221
319 Ga0207706_10036208 3300025933 Bacteria 4384
320 Ga0207706_10051319 3300025933 Bacteria 3642
321 Ga0207709_10000147 3300025935 Bacteria 97401
322 Ga0207709_10002508 3300025935 Bacteria 11471
323 Ga0207709_10024243 3300025935 Bacteria 3462
324 Ga0207669_10159612 3300025937 Bacteria 1591
325 Ga0207704_10065298 3300025938 Bacteria 2278
326 Ga0207704_10254464 3300025938 Bacteria 1320
327 Ga0207691_10019248 3300025940 Bacteria 6463
328 Ga0207691_10131363 3300025940 Bacteria 2212
329 Ga0207689_10051305 3300025942 Bacteria 3401
330 Ga0207689_10373278 3300025942 Bacteria 1187
331 Ga0207661_10027021 3300025944 Bacteria 4381
332 Ga0207667_10072624 3300025949 Bacteria 3576
333 Ga0207667_10114656 3300025949 Bacteria 2778
334 Ga0207712_10510354 3300025961 Bacteria 1029
335 Ga0207658_10001354 3300025986 Bacteria 19174
336 Ga0207658_10016294 3300025986 Bacteria 5112
337 Ga0207658_10184376 3300025986 Bacteria 1730
338 Ga0207677_10020551 3300026023 Bacteria 4011
339 Ga0207677_10046764 3300026023 Bacteria 2900
340 Ga0207639_10719286 3300026041 Bacteria 927
341 Ga0207678_10032235 3300026067 Bacteria 4567
342 Ga0207708_10114220 3300026075 Bacteria 2099
343 Ga0207641_10085788 3300026088 Bacteria 2744
344 Ga0207648_10005998 3300026089 Bacteria 12142
345 Ga0207648_10148493 3300026089 Bacteria 2068
346 Ga0207676_10036135 3300026095 Bacteria 3756
347 Ga0207676_10074356 3300026095 Bacteria 2737
348 Ga0207674_10011244 3300026116 Bacteria 10060
349 Ga0207674_10261662 3300026116 Bacteria 1677
350 Ga0207674_10408344 3300026116 Bacteria 1312
351 Ga0207674_10575313 3300026116 Bacteria 1088
352 Ga0207675_100540527 3300026118 Bacteria 1163
353 Ga0207683_10044998 3300026121 Bacteria 3859
354 Ga0207683_10138501 3300026121 Bacteria 2192
355 Ga0207698_10017802 3300026142 Bacteria 4829
356 Ga0207698_10120521 3300026142 Bacteria 2219
357 Ga0207698_10159512 3300026142 Bacteria 1970
358 Ga0209282_1001367 3300027666 Bacteria 13338
359 Ga0209282_1108574 3300027666 Bacteria 1413
360 Ga0209974_10008331 3300027876 Bacteria 3547
361 Ga0207428_10177411 3300027907 Bacteria 1611
362 Ga0268266_10032323 3300028379 Bacteria 4446
363 Ga0268266_10267039 3300028379 Bacteria 1587
364 Ga0268265_10070138 3300028380 Bacteria 2724
365 Ga0307517_10000708 3300028786 Bacteria 57419
366 Ga0307517_10105031 3300028786 Bacteria 2195
367 Ga0307517_10125962 3300028786 Bacteria 1869
368 Ga0307517_10160721 3300028786 Bacteria 1509
369 Ga0307515_10001103 3300028794 Bacteria 61754
370 Ga0307515_10002977 3300028794 Bacteria 35954
371 Ga0307515_10103741 3300028794 Bacteria 3405
372 Ga0307515_10249927 3300028794 Bacteria 1528
373 Ga0307515_10325379 3300028794 Bacteria 1200
374 Ga0316176_1170439 3300030732 Bacteria 3064
375 Ga0314311_1060310 3300030733 Bacteria 2642
376 Ga0316183_1052752 3300030742 Bacteria 4850
377 Ga0265332_10000094 3300031238 Bacteria 77636
378 Ga0265328_10035422 3300031239 Bacteria 1846
379 Ga0307513_10000051 3300031456 Bacteria 149733
380 Ga0307513_10010735 3300031456 Bacteria 11451
381 Ga0307513_10203299 3300031456 Bacteria 1819
382 Ga0307513_10231372 3300031456 Bacteria 1661
383 Ga0307513_10288136 3300031456 Bacteria 1415
384 Ga0307509_10003890 3300031507 Bacteria 22097
385 Ga0307509_10179670 3300031507 Bacteria 1983
386 Ga0307408_100000407 3300031548 Bacteria 38725
387 Ga0307408_100005073 3300031548 Bacteria 8837
388 Ga0307408_100037597 3300031548 Bacteria 3410
389 Ga0307408_100058277 3300031548 Bacteria 2807
390 Ga0307408_100080391 3300031548 Bacteria 2434
391 Ga0307408_100262296 3300031548 Bacteria 1430
392 Ga0307508_10009033 3300031616 Bacteria 9182
393 Ga0307508_10011731 3300031616 Bacteria 8008
394 Ga0307514_10003221 3300031649 Bacteria 15940
395 Ga0307514_10202570 3300031649 Bacteria 1245
396 Ga0265314_10068049 3300031711 Bacteria 2396
397 Ga0307516_10131651 3300031730 Bacteria 2280
398 Ga0307405_10008413 3300031731 Bacteria 5228
399 Ga0307405_10082393 3300031731 Bacteria 2105
400 Ga0307405_10143768 3300031731 Bacteria 1667
401 Ga0307406_10005046 3300031901 Bacteria 7196
402 Ga0307406_10039594 3300031901 Bacteria 2926
403 Ga0307407_10511174 3300031903 Bacteria 882
404 Ga0307412_10012799 3300031911 Bacteria 4897
405 Ga0307412_10143173 3300031911 Bacteria 1754
406 Ga0307414_10042431 3300032004 Bacteria 3090
407 Ga0307411_10073930 3300032005 Bacteria 2320
408 Ga0307510_10014875 3300033180 Bacteria 9206
409 Ga0307510_10102678 3300033180 Bacteria 2640
410 Ga0395899_0001240 3300037312 Bacteria 22229
411 Ga0395899_0002622 3300037312 Bacteria 14501
412 Ga0395900_0036004 3300037418 Bacteria 5100
413 Ga0395900_0078158 3300037418 Bacteria 3400
414 Ga0395900_0564536 3300037418 Bacteria 1081
415 Ga0395898_0037857 3300037466 Bacteria 4782
416 Ga0395905_0000148 3300037471 Bacteria 116301
417 Ga0395905_0012792 3300037471 Bacteria 8072
418 Ga0395905_0027898 3300037471 Bacteria 5323
419 Ga0395905_0046926 3300037471 Bacteria 4049
420 Ga0395905_0065049 3300037471 Bacteria 3413
421 Ga0395905_0069889 3300037471 Bacteria 3289
422 Ga0395905_0113784 3300037471 Bacteria 2542
423 Ga0395905_0131818 3300037471 Bacteria 2350
424 Ga0395905_0318920 3300037471 Bacteria 1444
425 Ga0395905_0677423 3300037471 Bacteria 933
426 Ga0395901_0054576 3300038443 Bacteria 4153
427 Ga0395901_0067556 3300038443 Bacteria 3723
428 Ga0395901_0305687 3300038443 Bacteria 1648
429 Ga0395901_0377054 3300038443 Bacteria 1460
430 Ga0439436_0002034 3300041404 Bacteria 6022
431 Ga0439436_0005335 3300041404 Bacteria 3941
432 Ga0439436_0050868 3300041404 Bacteria 1171
433 Ga0439447_021858 3300041407 Bacteria 1681
434 Ga0439466_0018661 3300041411 Bacteria 2488
435 Ga0439466_0032236 3300041411 Bacteria 1788
436 Ga0439465_0002279 3300041413 Bacteria 6303
437 Ga0451837_0928771 3300041494 Bacteria 1353
438 Ga0439431_0005918 3300041997 Bacteria 2702
439 Ga0439433_0012841 3300041999 Bacteria 1838
440 Ga0439433_0031982 3300041999 Bacteria 1206
441 Ga0439445_0000638 3300042004 Bacteria 7206
442 Ga0439432_012810 3300042006 Bacteria 2859
443 Ga0439432_025563 3300042006 Bacteria 1936
444 Ga0439449_0000688 3300042007 Bacteria 12885
445 Ga0439449_0001507 3300042007 Bacteria 9126
446 Ga0439449_0002450 3300042007 Bacteria 7254
447 Ga0439449_0087903 3300042007 Bacteria 1147
448 Ga0439452_001768 3300042010 Bacteria 8428
449 Ga0439457_018422 3300042014 Bacteria 1551
450 Ga0439457_033667 3300042014 Bacteria 1138
451 Ga0450920_013580 3300042122 Bacteria 1535
452 Ga0450923_000170 3300042125 Bacteria 6022
453 Ga0450923_018629 3300042125 Bacteria 1330
454 Ga0450898_004125 3300042134 Bacteria 2127
455 Ga0450899_010621 3300042135 Bacteria 1023
456 Ga0450906_043602 3300042145 Bacteria 792
457 Ga0439446_0010317 3300042156 Bacteria 2514
458 Ga0439446_0010951 3300042156 Bacteria 2453
459 Ga0450908_002494 3300042184 Bacteria 3600
460 Ga0450918_005066 3300042531 Bacteria 2372
461 Ga0451577_0010101 3300042876 Bacteria 9044
462 Ga0451577_0104069 3300042876 Bacteria 2537
463 Ga0466969_0016312 3300044656 Bacteria 3890
464 Ga0453683_0009651 3300044673 Bacteria 6436
465 Ga0453683_0011859 3300044673 Bacteria 5735
466 Ga0466965_0017955 3300044683 Bacteria 3385
467 Ga0466966_0016959 3300044684 Bacteria 4813
468 Ga0466961_0026070 3300044693 Bacteria 3758
469 Ga0466960_0055495 3300044901 Bacteria 1927
470 Ga0466959_0047085 3300045049 Bacteria 3172
471 Ga0451576_0045100 3300045051 Bacteria 4644
472 Ga0451576_0053188 3300045051 Bacteria 4242
473 Ga0451576_0087179 3300045051 Bacteria 3247
474 Ga0451576_0176080 3300045051 Bacteria 2233
475 Ga0495627_008920 3300046453 Bacteria 3713
476 Ga0495592_0000295 3300046454 Bacteria 42617
477 Ga0495651_0072261 3300046462 Bacteria 2621
478 Ga0495583_0031571 3300046506 Bacteria 2567
479 Ga0495610_0018664 3300046512 Bacteria 3908
480 Ga0495630_0583664 3300046517 Bacteria 857
481 Ga0495631_0000441 3300046518 Bacteria 28421
482 Ga0495632_0023318 3300046519 Bacteria 3306
483 Ga0495637_0001468 3300046520 Bacteria 13872
484 Ga0495648_0208988 3300046524 Bacteria 971
485 Ga0495642_0010858 3300046528 Bacteria 3491
486 Ga0495654_0021062 3300046530 Bacteria 3394
487 Ga0495654_0095562 3300046530 Bacteria 1374
488 Ga0495654_0119228 3300046530 Bacteria 1196
489 Ga0495621_0018383 3300046539 Bacteria 2269
490 Ga0495597_0000065 3300046542 Bacteria 90745
491 Ga0495597_0023755 3300046542 Bacteria 2834
492 Ga0495656_0000051 3300046615 Bacteria 55112
493 Ga0495656_0008104 3300046615 Bacteria 3740
494 Ga0495656_0015334 3300046615 Bacteria 2891
495 Ga0495625_0000044 3300046660 Bacteria 203855
496 Ga0495625_0071156 3300046660 Bacteria 2441
497 Ga0495659_0000254 3300046664 Bacteria 22018
498 Ga0495588_0022398 3300046674 Bacteria 3123
499 Ga0495658_0059949 3300046683 Bacteria 2181
500 Ga0495670_0126356 3300046691 Bacteria 1331
501 Ga0495649_0003708 3300046694 Bacteria 10162
502 Ga0495600_0068818 3300046809 Bacteria 2314
503 Ga0495660_0224639 3300046810 Bacteria 883
504 Ga0495687_010796 3300047443 Bacteria 4971
505 Ga0495687_017419 3300047443 Bacteria 3585
506 Ga0495614_0011922 3300048089 Bacteria 3821
507 Ga0495615_0011836 3300048090 Bacteria 1784
508 Ga0495615_0021297 3300048090 Bacteria 1461
509 Ga0496100_0035619 3300048903 Bacteria 3132
510 Ga0496100_0846395 3300048903 Bacteria 717
511 Ga0496101_0000752 3300048904 Bacteria 19194
512 Ga0496101_0038596 3300048904 Bacteria 3392
513 Ga0496101_0051000 3300048904 Bacteria 2980
514 Ga0496102_0082120 3300048905 Bacteria 2972
515 Ga0496104_0004467 3300048907 Bacteria 12184
516 Ga0496105_0077531 3300048908 Bacteria 2744
517 Ga0496106_0026942 3300048909 Bacteria 4280
518 Ga0496107_0065895 3300048910 Bacteria 2626
519 Ga0496107_0151351 3300048910 Bacteria 1716
520 Ga0496108_0016978 3300048911 Bacteria 5950
521 Ga0496109_0373223 3300048912 Bacteria 1347
522 Ga0496110_0023776 3300048913 Bacteria 5215
523 Ga0496110_0058218 3300048913 Bacteria 3403
524 Ga0496110_0111276 3300048913 Bacteria 2461
525 Ga0496111_0020834 3300048914 Bacteria 4571
526 Ga0496112_0023856 3300048915 Bacteria 5851
527 Ga0496113_0033092 3300048916 Bacteria 3761
528 Ga0496116_0047631 3300048919 Bacteria 2884
529 Ga0496116_0122861 3300048919 Bacteria 1498
530 Ga0496117_0058727 3300048920 Bacteria 2662
531 Ga0496118_0009730 3300048921 Bacteria 9648
532 Ga0496118_0085315 3300048921 Bacteria 2199
533 Ga0496121_0004998 3300048924 Bacteria 17360
534 Ga0496121_0081177 3300048924 Bacteria 2567
535 Ga0496121_0088354 3300048924 Bacteria 2430
536 Ga0496121_0089436 3300048924 Bacteria 2410
537 Ga0496121_0143809 3300048924 Bacteria 1765
538 Ga0496122_0000274 3300048925 Bacteria 115100
539 Ga0496122_0019248 3300048925 Bacteria 6247
540 Ga0496122_0201831 3300048925 Bacteria 1162
541 Ga0496123_0000262 3300048926 Bacteria 106366
542 Ga0496123_0028920 3300048926 Bacteria 4092
543 Ga0496123_0045591 3300048926 Bacteria 2985
544 Ga0496123_0102230 3300048926 Bacteria 1664
545 Ga0496124_0066126 3300048927 Bacteria 3012
546 Ga0496124_0097443 3300048927 Bacteria 2388
547 Ga0496124_0328743 3300048927 Bacteria 1091
548 Ga0496125_0118964 3300048928 Bacteria 1890
549 Ga0496125_0149967 3300048928 Bacteria 1603
550 Ga0496126_0063466 3300048929 Bacteria 3311
551 Ga0496126_0225099 3300048929 Bacteria 1574
552 Ga0501031_0009899 3300049568 Bacteria 6208
553 Ga0501047_0137285 3300049581 Bacteria 2325
554 Ga0501249_004832 3300049679 Bacteria 2744
555 Ga0501261_018534 3300049690 Bacteria 982
556 Ga0501225_0003751 3300049705 Bacteria 4571
557 Ga0501262_000052 3300049759 Bacteria 14942
558 Ga0501266_001326 3300049763 Bacteria 3156
559 Ga0501268_033485 3300049765 Bacteria 940
560 nmdc:mga03683_121618_c1 3300050489 Bacteria 1161
561 nmdc:mga03683_3881_c2 3300050489 Bacteria 3294
562 nmdc:mga03n38_47132_c1 3300050490 Bacteria 1906
563 nmdc:mga00v17_60377_c1 3300050491 Bacteria 2328
564 nmdc:mga0yw44_4196_c1 3300050492 Bacteria 6558
565 nmdc:mga0yw44_90175_c1 3300050492 Bacteria 1936
566 nmdc:mga0k408_153691_c1 3300050493 Bacteria 1370
567 nmdc:mga0k408_19989_c1 3300050493 Bacteria 3748
568 nmdc:mga0k408_243505_c1 3300050493 Bacteria 1074
569 nmdc:mga0k408_41921_c1 3300050493 Bacteria 2636
570 nmdc:mga0k408_504_c1 3300050493 Bacteria 21443
571 nmdc:mga0k408_77170_c1 3300050493 Bacteria 1948
572 nmdc:mga0k408_7882_c1 3300050493 Bacteria 5702
573 nmdc:mga0k408_8130_c1 3300050493 Bacteria 5622
574 nmdc:mga0k408_9301_c1 3300050493 Bacteria 5296
575 nmdc:mga06z11_122823_c1 3300050494 Bacteria 1450
576 nmdc:mga06z11_148053_c1 3300050494 Bacteria 1332
577 nmdc:mga06z11_78122_c1 3300050494 Bacteria 1768
578 nmdc:mga07m45_103320_c1 3300050496 Bacteria 1638
579 nmdc:mga07m45_10888_c1 3300050496 Bacteria 4762
580 nmdc:mga07m45_116617_c1 3300050496 Bacteria 1540
581 nmdc:mga07m45_119377_c1 3300050496 Bacteria 1522
582 nmdc:mga07m45_150_c1 3300050496 Bacteria 27900
583 nmdc:mga07m45_2017_c1 3300050496 Bacteria 9417
584 nmdc:mga07m45_24397_c1 3300050496 Bacteria 3312
585 nmdc:mga07m45_25743_c1 3300050496 Bacteria 3229
586 nmdc:mga07m45_27853_c1 3300050496 Bacteria 3117
587 nmdc:mga07m45_7130_c1 3300050496 Bacteria 5693
588 nmdc:mga07m45_73068_c1 3300050496 Bacteria 1953
589 nmdc:mga07m45_8835_c1 3300050496 Bacteria 5198
590 nmdc:mga09592_248223_c1 3300050508 Bacteria 1542
591 Ga0500651_0000053 3300053093 Bacteria 76219
592 Ga0500651_0292034 3300053093 Bacteria 937
593 Ga0500566_0115294 3300053094 Bacteria 1455
594 Ga0500562_037719 3300053108 Bacteria 1283
595 Ga0500593_008552 3300053117 Bacteria 4211
596 Ga0500594_0002924 3300053118 Bacteria 3730
597 Ga0500607_005687 3300053121 Bacteria 8065
598 Ga0500608_090247 3300053122 Bacteria 1434
599 Ga0500658_0000385 3300053134 Bacteria 19451
600 Ga0500658_0001747 3300053134 Bacteria 8577
601 Ga0500559_0000948 3300053136 Bacteria 18266
602 Ga0500559_0005034 3300053136 Bacteria 6129
603 Ga0500559_0025348 3300053136 Bacteria 2523
604 Ga0500568_0002715 3300053139 Bacteria 10257
605 Ga0500616_0076531 3300053153 Bacteria 1691
606 Ga0500616_0145686 3300053153 Bacteria 1102
607 Ga0500622_0001258 3300053156 Bacteria 20685
608 Ga0500627_0085769 3300053158 Bacteria 1406
609 Ga0500634_0029128 3300053161 Bacteria 3009
610 Ga0500634_0063472 3300053161 Bacteria 1953
611 Ga0500587_001172 3300053739 Bacteria 3623
612 Ga0466962_0063319 3300061719 Bacteria 1766
613 2511247027 2511231002 Bacteria 5042903
614 2513228921 2513020051 Bacteria 6053213
615 2548500990 2547132374 Bacteria 5530232
616 2599626596 2599185214 Bacteria 8209958
617 2599675660 2599185226 Bacteria 8233575
618 2599684133 2599185227 Bacteria 8246414
619 2599696147 2599185229 Bacteria 8216126
620 2643866699 2643221570 Bacteria 5103772
621 2643993432 2643221596 Bacteria 5006805
622 2644062704 2643221609 Bacteria 6756331
623 2644076282 2643221611 Bacteria 6820941
624 2644163269 2643221628 Bacteria 5745828
625 2644294570 2643221652 Bacteria 5140275
626 2644305110 2643221654 Bacteria 5273570
627 2644327876 2643221658 Bacteria 6064537
628 2644397837 2643221672 Bacteria 6322190
629 2644468325 2643221683 Bacteria 5749203
630 2644645875 2643221717 Bacteria 5676132
631 2738718006 2738541277 Bacteria 7458140
632 2738885099 2738541307 Bacteria 8606193
633 2739244616 2738543012 Bacteria 7115078
634 2739251485 2738543013 Bacteria 5618633
635 2739278692 2738543019 Bacteria 7459457
636 2816475180 2816332133 Bacteria 7249298
637 2819595699 2818991446 Bacteria 7757362
638 2831266711 2831265667 Bacteria 7184833
639 2838057209 2838054893 Bacteria 7451788
640 2842679619 2842677519 Bacteria 5615038
641 2842734991 2842733646 Bacteria 5716726
642 2842751195 2842747753 Bacteria 5578255
643 2881101924 2881101125 Bacteria 4590519
644 2885192484 2885192300 Bacteria 5882526
645 2885200267 2885198086 Bacteria 7212419
646 2885213938 2885211737 Bacteria 7212420
647 2894025943 2894023352 Bacteria 5167372
648 2899925045 2899924645 Bacteria 7487985
649 2904455724 2904449895 Bacteria 6927402
650 2904462766 2904456579 Bacteria 6819253
651 2904482655 2904479285 Bacteria 5073931
652 2904544826 2904541872 Bacteria 8915136
653 2919467285 2919462493 Bacteria 5817112
654 2919707493 2919704043 Bacteria 5560311
655 2928038830 2928037797 Bacteria 7273642
656 2928045565 2928044640 Bacteria 7271509
657 2928053181 2928051484 Bacteria 7773759
658 2928066787 2928064002 Bacteria 7419480
659 2928071320 2928070936 Bacteria 8062541
660 2928084745 2928084124 Bacteria 7159212
661 2928119878 2928115317 Bacteria 6477646
662 2929163502 2929160207 Bacteria 9075316
663 2929522707 2929520902 Bacteria 6765052
664 2945947743 2945945610 Bacteria 5951079
665 2945977396 2945972063 Bacteria 6086495
666 2945985493 2945984333 Bacteria 7358892
667 2954772063 2954767861 Bacteria 5535784
668 2974323102 2974320154 Bacteria 4571377
669 2990712668 2990710928 Bacteria 5002431
670 Ga0157379_10082720
671 JGI24739J22299_10063818
672 JGI25155J39150_1000002
673 JGI25156J39149_1000003
674 JGI25154J39366_1000009
675 JGI25158J39367_1012831
676 JGI25157J39369_1000002
677 JGI25152J39213_1004862
678 JGI25150J39212_1000299
679 JGI25159J45721_1000302
680 JGI25159J45721_1000502
681 JGI25151J46595_10004029
682 JGI25151J46595_10017838
683 JGI25151J46595_10042425
684 JGI25151J46595_10044421
685 JGI25153J46596_10010784
686 JGI25153J46596_10024863
687 JGI25160J50197_1000145
688 JGI25161J50226_1000032
689 JGI25161J50226_1000064
690 JGI25161J50226_1005637
691 Ga0006562J51391_1053800
692 Ga0055527_1002929
693 Ga0055542_1000021
694 Ga0055526_1003563
695 Ga0055526_1029283
696 Ga0055526_1029388
697 Ga0055537_1000036
698 Ga0055537_1000043
699 Ga0055537_1008563
700 Ga0055537_1011422
701 Ga0055524_1000012
702 Ga0055524_1029145
703 Ga0055524_1029247
704 Ga0055536_1003402
705 Ga0055536_1006361
706 Ga0055534_1000018
707 Ga0055534_1001157
708 Ga0055534_1005165
709 Ga0055534_1005846
710 Ga0055534_1017071
711 Ga0055528_1000717
712 Ga0055528_1005325
713 Ga0055528_1024544
714 Ga0055530_10000015
715 Ga0055530_10001441
716 Ga0055530_10003937
717 Ga0055540_1000012
718 Ga0055540_1000039
719 Ga0055540_1000800
720 Ga0055540_1000917
721 Ga0055540_1000922
722 Ga0055540_1001090
723 Ga0055540_1010633
724 Ga0055540_1013853
725 Ga0055540_1026748
726 Ga0055531_10000783
727 Ga0055531_10001591
728 Ga0055531_10006340
729 Ga0055531_10017363
730 Ga0055531_10025023
731 Ga0055543_1000445
732 Ga0055543_1000752
733 Ga0065165_1001466
734 Ga0065165_1034260
735 Ga0065714_10106047
736 Ga0065704_10088873
737 Ga0070658_10424336
738 Ga0070676_10125960
739 Ga0070683_100023154
740 Ga0070670_100086168
741 Ga0068869_100126428
742 Ga0068869_100277196
743 Ga0070682_100069191
744 Ga0068868_100036763
745 Ga0068868_100039466
746 Ga0068868_100169745
747 Ga0070660_100018535
748 Ga0070660_100138639
749 Ga0070689_100357951
750 Ga0070671_100005987
751 Ga0070671_100261420
752 Ga0070673_100053169
753 Ga0070688_100042067
754 Ga0070688_100304543
755 Ga0070659_100104175
756 Ga0070667_100000740
757 Ga0070667_100344163
758 Ga0070714_100463314
759 Ga0070711_100169353
760 Ga0070663_100116610
761 Ga0070662_100053787
762 Ga0070662_100116649
763 Ga0068867_100003980
764 Ga0068867_100254608
765 Ga0070685_10006879
766 Ga0070706_100001360
767 Ga0070707_100026346
768 Ga0070679_100019048
769 Ga0070679_100032501
770 Ga0070679_100048853
771 Ga0070684_100019887
772 Ga0068853_100051532
773 Ga0068853_100180568
774 Ga0068853_100218067
775 Ga0070672_100089700
776 Ga0070665_100178385
777 Ga0068855_100128814
778 Ga0068855_100371572
779 Ga0068857_100072606
780 Ga0068857_100234502
781 Ga0068857_100337925
782 Ga0068857_100630061
783 Ga0068856_100014713
784 Ga0068856_100500716
785 Ga0068852_100026931
786 Ga0068852_100050610
787 Ga0068852_100064564
788 Ga0068864_100007691
789 Ga0068864_100045701
790 Ga0068861_100398336
791 Ga0068851_10021263
792 Ga0068870_10046046
793 Ga0068863_100032370
794 Ga0068863_100250504
795 Ga0068858_100623668
796 Ga0068862_100024240
797 Ga0075365_10021894
798 Ga0075365_10024580
799 Ga0075368_10024418
800 Ga0075368_10050310
801 Ga0075363_100039003
802 Ga0075363_100039336
803 Ga0075363_100106901
804 Ga0075364_10081220
805 Ga0075432_10067888
806 Ga0075362_10005566
807 Ga0075362_10008420
808 Ga0075362_10008792
809 Ga0075362_10131273
810 Ga0075367_10030320
811 Ga0075367_10214970
812 Ga0075367_10262799
813 Ga0075369_10025400
814 Ga0075366_10002134
815 Ga0075366_10005108
816 Ga0075366_10014460
817 Ga0075366_10054094
818 Ga0075366_10088086
819 Ga0075366_10103378
820 Ga0075366_10108480
821 Ga0075366_10269008
822 Ga0075370_10002071
823 Ga0075370_10002943
824 Ga0075370_10004326
825 Ga0075370_10010934
826 Ga0075370_10033022
827 Ga0075370_10033696
828 Ga0075370_10063650
829 Ga0075370_10088879
830 Ga0075370_10351372
831 Ga0068871_100202725
832 Ga0068865_100126747
833 Ga0099826_10003934
834 Ga0099826_10024743
835 Ga0105244_10004770
836 Ga0105240_10001089
837 Ga0105240_10146778
838 Ga0105240_10172983
839 Ga0111539_10098507
840 Ga0105245_10022835
841 Ga0105243_10002130
842 Ga0105243_10011654
843 Ga0105243_10025185
844 Ga0105241_10097627
845 Ga0105241_10109592
846 Ga0105237_10160007
847 Ga0105238_10272126
848 Ga0105238_10348125
849 Ga0105249_10169590
850 Ga0105249_10513209
851 Ga0105239_10021489
852 Ga0105239_10220476
853 Ga0105239_10314657
854 Ga0105246_10015575
855 Ga0157373_10010819
856 Ga0157370_10000583
857 Ga0157370_10086305
858 Ga0157369_10009093
859 Ga0157374_10027594
860 Ga0157378_10059826
861 Ga0163162_10068555
862 Ga0157372_10123740
863 Ga0157372_10219446
864 Ga0157375_10041640
865 Ga0163163_10190383
866 Ga0182008_10001753
867 Ga0182008_10044364
868 Ga0157377_10002439
869 Ga0157376_10019485
870 Ga0157376_10129196
871 Ga0182006_1001664
872 Ga0182007_10000524
873 Ga0182007_10019206
874 Ga0183362_10001
875 Ga0163161_10000139
876 Ga0163161_10058769
877 Ga0163161_10072582
878 Ga0163161_10349902
879 Ga0209435_100001
880 Ga0209436_115027
881 Ga0209672_100751
882 Ga0209258_100058
883 Ga0207425_1000157
884 Ga0207425_1008756
885 Ga0207425_1009554
886 Ga0209646_1000001
887 Ga0209026_1000003
888 Ga0209148_1000071
889 Ga0209759_1000001
890 Ga0209129_1000494
891 Ga0209129_1000562
892 Ga0209565_1000004
893 Ga0209565_1000038
894 Ga0209565_1000075
895 Ga0209565_1001286
896 Ga0209565_1006022
897 Ga0209673_1000066
898 Ga0209673_1000289
899 Ga0209673_1000357
900 Ga0209673_1000362
901 Ga0209673_1014452
902 Ga0209130_1000069
903 Ga0209130_1000082
904 Ga0209130_1000094
905 Ga0209130_1000131
906 Ga0209130_1003574
907 Ga0209675_1000061
908 Ga0209675_1000074
909 Ga0209675_1000177
910 Ga0209675_1006569
911 Ga0209675_1008579
912 Ga0209676_1000005
913 Ga0209676_1000029
914 Ga0209676_1000142
915 Ga0209676_1000186
916 Ga0209676_1001149
917 Ga0209676_1003883
918 Ga0209676_1029457
919 Ga0209676_1046217
920 Ga0209025_1000056
921 Ga0209025_1000088
922 Ga0209025_1000579
923 Ga0209025_1004754
924 Ga0209025_1006826
925 Ga0209025_1010474
926 Ga0209025_1033881
927 Ga0209025_1036919
928 Ga0209564_1000090
929 Ga0209564_1000542
930 Ga0209564_1000969
931 Ga0209564_1010108
932 Ga0209758_1000044
933 Ga0209758_1002642
934 Ga0209758_1003972
935 Ga0209050_1000003
936 Ga0209050_1000007
937 Ga0209050_1001371
938 Ga0209050_1005923
939 Ga0209050_1033556
940 Ga0209256_1000001
941 Ga0209256_1000020
942 Ga0209256_1000022
943 Ga0209256_1039745
944 Ga0207426_1000001
945 Ga0207426_1000025
946 Ga0207426_1000031
947 Ga0209051_1000003
948 Ga0209051_1000036
949 Ga0209051_1000078
950 Ga0209051_1000213
951 Ga0209051_1000243
952 Ga0209051_1000455
953 Ga0209051_1055976
954 Ga0209257_1000011
955 Ga0209257_1000012
956 Ga0209257_1000018
957 Ga0209257_1000226
958 Ga0209257_1000980
959 Ga0209257_1005033
960 Ga0209257_1009850
961 Ga0207655_1004354
962 Ga0207692_10161149
963 Ga0207688_10005897
964 Ga0207645_10002443
965 Ga0207645_10084106
966 Ga0207643_10091900
967 Ga0207705_10290095
968 Ga0207684_10029430
969 Ga0207695_10038007
970 Ga0207695_10049144
971 Ga0207695_10148614
972 Ga0207695_10216207
973 Ga0207671_10028247
974 Ga0207663_10032366
975 Ga0207657_10054433
976 Ga0207657_10095312
977 Ga0207657_10139848
978 Ga0207649_10327865
979 Ga0207652_10073160
980 Ga0207652_10197470
981 Ga0207681_10027536
982 Ga0207694_10127612
983 Ga0207694_10204478
984 Ga0207650_10065460
985 Ga0207687_10216432
986 Ga0207644_10034779
987 Ga0207644_10337769
988 Ga0207706_10036208
989 Ga0207706_10051319
990 Ga0207709_10000147
991 Ga0207709_10002508
992 Ga0207709_10024243
993 Ga0207669_10159612
994 Ga0207704_10065298
995 Ga0207704_10254464
996 Ga0207691_10019248
997 Ga0207691_10131363
998 Ga0207689_10051305
999 Ga0207689_10373278
1000 Ga0207661_10027021
1001 Ga0207667_10072624
1002 Ga0207667_10114656
1003 Ga0207712_10510354
1004 Ga0207658_10001354
1005 Ga0207658_10016294
1006 Ga0207658_10184376
1007 Ga0207677_10020551
1008 Ga0207677_10046764
1009 Ga0207639_10719286
1010 Ga0207678_10032235
1011 Ga0207708_10114220
1012 Ga0207641_10085788
1013 Ga0207648_10005998
1014 Ga0207648_10148493
1015 Ga0207676_10036135
1016 Ga0207676_10074356
1017 Ga0207674_10011244
1018 Ga0207674_10261662
1019 Ga0207674_10408344
1020 Ga0207674_10575313
1021 Ga0207675_100540527
1022 Ga0207683_10044998
1023 Ga0207683_10138501
1024 Ga0207698_10017802
1025 Ga0207698_10120521
1026 Ga0207698_10159512
1027 Ga0209282_1001367
1028 Ga0209282_1108574
1029 Ga0209974_10008331
1030 Ga0207428_10177411
1031 Ga0268266_10032323
1032 Ga0268266_10267039
1033 Ga0268265_10070138
1034 Ga0307517_10000708
1035 Ga0307517_10105031
1036 Ga0307517_10125962
1037 Ga0307517_10160721
1038 Ga0307515_10001103
1039 Ga0307515_10002977
1040 Ga0307515_10103741
1041 Ga0307515_10249927
1042 Ga0307515_10325379
1043 Ga0316176_1170439
1044 Ga0314311_1060310
1045 Ga0316183_1052752
1046 Ga0265332_10000094
1047 Ga0265328_10035422
1048 Ga0307513_10000051
1049 Ga0307513_10010735
1050 Ga0307513_10203299
1051 Ga0307513_10231372
1052 Ga0307513_10288136
1053 Ga0307509_10003890
1054 Ga0307509_10179670
1055 Ga0307408_100000407
1056 Ga0307408_100005073
1057 Ga0307408_100037597
1058 Ga0307408_100058277
1059 Ga0307408_100080391
1060 Ga0307408_100262296
1061 Ga0307508_10009033
1062 Ga0307508_10011731
1063 Ga0307514_10003221
1064 Ga0307514_10202570
1065 Ga0265314_10068049
1066 Ga0307516_10131651
1067 Ga0307405_10008413
1068 Ga0307405_10082393
1069 Ga0307405_10143768
1070 Ga0307406_10005046
1071 Ga0307406_10039594
1072 Ga0307407_10511174
1073 Ga0307412_10012799
1074 Ga0307412_10143173
1075 Ga0307414_10042431
1076 Ga0307411_10073930
1077 Ga0307510_10014875
1078 Ga0307510_10102678
1079 Ga0395899_0001240
1080 Ga0395899_0002622
1081 Ga0395900_0036004
1082 Ga0395900_0078158
1083 Ga0395900_0564536
1084 Ga0395898_0037857
1085 Ga0395905_0000148
1086 Ga0395905_0012792
1087 Ga0395905_0027898
1088 Ga0395905_0046926
1089 Ga0395905_0065049
1090 Ga0395905_0069889
1091 Ga0395905_0113784
1092 Ga0395905_0131818
1093 Ga0395905_0318920
1094 Ga0395905_0677423
1095 Ga0395901_0054576
1096 Ga0395901_0067556
1097 Ga0395901_0305687
1098 Ga0395901_0377054
1099 Ga0439436_0002034
1100 Ga0439436_0005335
1101 Ga0439436_0050868
1102 Ga0439447_021858
1103 Ga0439466_0018661
1104 Ga0439466_0032236
1105 Ga0439465_0002279
1106 Ga0451837_0928771
1107 Ga0439431_0005918
1108 Ga0439433_0012841
1109 Ga0439433_0031982
1110 Ga0439445_0000638
1111 Ga0439432_012810
1112 Ga0439432_025563
1113 Ga0439449_0000688
1114 Ga0439449_0001507
1115 Ga0439449_0002450
1116 Ga0439449_0087903
1117 Ga0439452_001768
1118 Ga0439457_018422
1119 Ga0439457_033667
1120 Ga0450920_013580
1121 Ga0450923_000170
1122 Ga0450923_018629
1123 Ga0450898_004125
1124 Ga0450899_010621
1125 Ga0450906_043602
1126 Ga0439446_0010317
1127 Ga0439446_0010951
1128 Ga0450908_002494
1129 Ga0450918_005066
1130 Ga0451577_0010101
1131 Ga0451577_0104069
1132 Ga0466969_0016312
1133 Ga0453683_0009651
1134 Ga0453683_0011859
1135 Ga0466965_0017955
1136 Ga0466966_0016959
1137 Ga0466961_0026070
1138 Ga0466960_0055495
1139 Ga0466959_0047085
1140 Ga0451576_0045100
1141 Ga0451576_0053188
1142 Ga0451576_0087179
1143 Ga0451576_0176080
1144 Ga0495627_008920
1145 Ga0495592_0000295
1146 Ga0495651_0072261
1147 Ga0495583_0031571
1148 Ga0495610_0018664
1149 Ga0495630_0583664
1150 Ga0495631_0000441
1151 Ga0495632_0023318
1152 Ga0495637_0001468
1153 Ga0495648_0208988
1154 Ga0495642_0010858
1155 Ga0495654_0021062
1156 Ga0495654_0095562
1157 Ga0495654_0119228
1158 Ga0495621_0018383
1159 Ga0495597_0000065
1160 Ga0495597_0023755
1161 Ga0495656_0000051
1162 Ga0495656_0008104
1163 Ga0495656_0015334
1164 Ga0495625_0000044
1165 Ga0495625_0071156
1166 Ga0495659_0000254
1167 Ga0495588_0022398
1168 Ga0495658_0059949
1169 Ga0495670_0126356
1170 Ga0495649_0003708
1171 Ga0495600_0068818
1172 Ga0495660_0224639
1173 Ga0495687_010796
1174 Ga0495687_017419
1175 Ga0495614_0011922
1176 Ga0495615_0011836
1177 Ga0495615_0021297
1178 Ga0496100_0035619
1179 Ga0496100_0846395
1180 Ga0496101_0000752
1181 Ga0496101_0038596
1182 Ga0496101_0051000
1183 Ga0496102_0082120
1184 Ga0496104_0004467
1185 Ga0496105_0077531
1186 Ga0496106_0026942
1187 Ga0496107_0065895
1188 Ga0496107_0151351
1189 Ga0496108_0016978
1190 Ga0496109_0373223
1191 Ga0496110_0023776
1192 Ga0496110_0058218
1193 Ga0496110_0111276
1194 Ga0496111_0020834
1195 Ga0496112_0023856
1196 Ga0496113_0033092
1197 Ga0496116_0047631
1198 Ga0496116_0122861
1199 Ga0496117_0058727
1200 Ga0496118_0009730
1201 Ga0496118_0085315
1202 Ga0496121_0004998
1203 Ga0496121_0081177
1204 Ga0496121_0088354
1205 Ga0496121_0089436
1206 Ga0496121_0143809
1207 Ga0496122_0000274
1208 Ga0496122_0019248
1209 Ga0496122_0201831
1210 Ga0496123_0000262
1211 Ga0496123_0028920
1212 Ga0496123_0045591
1213 Ga0496123_0102230
1214 Ga0496124_0066126
1215 Ga0496124_0097443
1216 Ga0496124_0328743
1217 Ga0496125_0118964
1218 Ga0496125_0149967
1219 Ga0496126_0063466
1220 Ga0496126_0225099
1221 Ga0501031_0009899
1222 Ga0501047_0137285
1223 Ga0501249_004832
1224 Ga0501261_018534
1225 Ga0501225_0003751
1226 Ga0501262_000052
1227 Ga0501266_001326
1228 Ga0501268_033485
1229 nmdc:mga03683_121618_c1
1230 nmdc:mga03683_3881_c2
1231 nmdc:mga03n38_47132_c1
1232 nmdc:mga00v17_60377_c1
1233 nmdc:mga0yw44_4196_c1
1234 nmdc:mga0yw44_90175_c1
1235 nmdc:mga0k408_153691_c1
1236 nmdc:mga0k408_19989_c1
1237 nmdc:mga0k408_243505_c1
1238 nmdc:mga0k408_41921_c1
1239 nmdc:mga0k408_504_c1
1240 nmdc:mga0k408_77170_c1
1241 nmdc:mga0k408_7882_c1
1242 nmdc:mga0k408_8130_c1
1243 nmdc:mga0k408_9301_c1
1244 nmdc:mga06z11_122823_c1
1245 nmdc:mga06z11_148053_c1
1246 nmdc:mga06z11_78122_c1
1247 nmdc:mga07m45_103320_c1
1248 nmdc:mga07m45_10888_c1
1249 nmdc:mga07m45_116617_c1
1250 nmdc:mga07m45_119377_c1
1251 nmdc:mga07m45_150_c1
1252 nmdc:mga07m45_2017_c1
1253 nmdc:mga07m45_24397_c1
1254 nmdc:mga07m45_25743_c1
1255 nmdc:mga07m45_27853_c1
1256 nmdc:mga07m45_7130_c1
1257 nmdc:mga07m45_73068_c1
1258 nmdc:mga07m45_8835_c1
1259 nmdc:mga09592_248223_c1
1260 Ga0500651_0000053
1261 Ga0500651_0292034
1262 Ga0500566_0115294
1263 Ga0500562_037719
1264 Ga0500593_008552
1265 Ga0500594_0002924
1266 Ga0500607_005687
1267 Ga0500608_090247
1268 Ga0500658_0000385
1269 Ga0500658_0001747
1270 Ga0500559_0000948
1271 Ga0500559_0005034
1272 Ga0500559_0025348
1273 Ga0500568_0002715
1274 Ga0500616_0076531
1275 Ga0500616_0145686
1276 Ga0500622_0001258
1277 Ga0500627_0085769
1278 Ga0500634_0029128
1279 Ga0500634_0063472
1280 Ga0500587_001172
1281 Ga0466962_0063319
1282 2511247027
1283 2513228921
1284 2548500990
1285 2599626596
1286 2599675660
1287 2599684133
1288 2599696147
1289 2643866699
1290 2643993432
1291 2644062704
1292 2644076282
1293 2644163269
1294 2644294570
1295 2644305110
1296 2644327876
1297 2644397837
1298 2644468325
1299 2644645875
1300 2738718006
1301 2738885099
1302 2739244616
1303 2739251485
1304 2739278692
1305 2816475180
1306 2819595699
1307 2831266711
1308 2838057209
1309 2842679619
1310 2842734991
1311 2842751195
1312 2881101924
1313 2885192484
1314 2885200267
1315 2885213938
1316 2894025943
1317 2899925045
1318 2904455724
1319 2904462766
1320 2904482655
1321 2904544826
1322 2919467285
1323 2919707493
1324 2928038830
1325 2928045565
1326 2928053181
1327 2928066787
1328 2928071320
1329 2928084745
1330 2928119878
1331 2929163502
1332 2929522707
1333 2945947743
1334 2945977396
1335 2945985493
1336 2954772063
1337 2974323102
1338 2990712668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

22

219

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

28

266

0.93

PF08659

KR

KR domain

22

197

0.9

PF23441

16

268

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t6p-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fabg2(nadh-dependent) at 1.57 a resolution 0.9599 12 257
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9567 12 258
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.956 12 258
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9557 12 258
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.9555 9 257
ID Description Score Start End Superfamily
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9557 12 258 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 14 61 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 15 261 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9516 9 257 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 12 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C7JRJ5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.964 11 152
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9624 12 135 GO:0005829
GO:0009688
GO:0010301
AF-A0A1J5IPR9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9609 15 258 GO:0004316
GO:0006633
GO:0051287
AF-A0A6J5JQ41-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.96 19 134 GO:0016491
AF-A0A4V2AIP9-F1-model_v4 deleted 0.9578 4 80

Map