F473981

General Info

Members Datasets Scaffolds Average Seq Length
669 249 1338 261

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100060414|Ga0070698_1000604143
Length 294
Sequence LLLTLLSTDLDSFVWGNSKELPRDGAPDMSYANKVVIITGGSRGIGEGCVRTFVAAGAKVVFCAKGERTGVALAAEVNESGPGEACFIRCDVSQVEEIQRLIETTVSRYGRLDCLVNNAGWHPPLQPIDDFSIQDFRDLLELNLVSIFAACKFALPHLRQTRGNIINMSSLVGSIGQLHASTYVATKGAITALTKALAIDEARHGVRVNSVSPGNVYTPLWQEAIDAAPDPDQCRAQGEAAQLLSRMGTIDEVGKLCLFIAAEATFTTGVDHLISGGAELGYGDKGRSSNGPDK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
187 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
188 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 2.84
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 12.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100060414 3300005471 Bacteria 3825
2 JGI24751J29686_10038542 3300002459 Unclassified 990
3 rootL2_10219998 3300003322 Bacteria 2733
4 Ga0065712_10010488 3300005290 Unclassified 2203
5 Ga0065707_10113683 3300005295 Bacteria 2320
6 Ga0065707_10209890 3300005295 Bacteria 1270
7 Ga0070676_10312798 3300005328 Bacteria 1068
8 Ga0070683_100414827 3300005329 Bacteria 1284
9 Ga0070683_100577904 3300005329 Unclassified 1075
10 Ga0070690_100010815 3300005330 Bacteria 5322
11 Ga0070690_100080178 3300005330 Bacteria 2135
12 Ga0070690_100379851 3300005330 Bacteria 1033
13 Ga0070670_100004264 3300005331 Bacteria 11962
14 Ga0070670_100057421 3300005331 Bacteria 3341
15 Ga0070677_10025928 3300005333 Unclassified 2194
16 Ga0070677_10073989 3300005333 Bacteria 1440
17 Ga0068869_100033035 3300005334 Bacteria 3651
18 Ga0068869_100168571 3300005334 Bacteria 1709
19 Ga0068869_100301444 3300005334 Bacteria 1294
20 Ga0068869_100328211 3300005334 Bacteria 1242
21 Ga0068869_100501042 3300005334 Bacteria 1014
22 Ga0070666_10261996 3300005335 Bacteria 1226
23 Ga0070680_100005183 3300005336 Bacteria 9866
24 Ga0068868_100291331 3300005338 Bacteria 1384
25 Ga0070689_100005964 3300005340 Bacteria 8384
26 Ga0070689_100119132 3300005340 Bacteria 2107
27 Ga0070689_100293089 3300005340 Bacteria 1352
28 Ga0070689_100433703 3300005340 Bacteria 1116
29 Ga0070687_100010125 3300005343 Bacteria 4062
30 Ga0070661_100225640 3300005344 Bacteria 1438
31 Ga0070692_10158796 3300005345 Bacteria 1294
32 Ga0070668_100039031 3300005347 Unclassified 3632
33 Ga0070669_100005821 3300005353 Bacteria 8890
34 Ga0070669_100037227 3300005353 Bacteria 3529
35 Ga0070669_100461617 3300005353 Bacteria 1048
36 Ga0070675_100201174 3300005354 Bacteria 1729
37 Ga0070675_100340830 3300005354 Bacteria 1328
38 Ga0070675_100443907 3300005354 Bacteria 1163
39 Ga0070671_100005927 3300005355 Bacteria 9741
40 Ga0070671_100073417 3300005355 Bacteria 2857
41 Ga0070674_100007747 3300005356 Bacteria 6344
42 Ga0070674_100045320 3300005356 Bacteria 3005
43 Ga0070673_100028360 3300005364 Bacteria 4163
44 Ga0070673_100060306 3300005364 Bacteria 3006
45 Ga0070673_100078182 3300005364 Bacteria 2676
46 Ga0070673_100364946 3300005364 Unclassified 1284
47 Ga0070688_100000808 3300005365 Bacteria 15438
48 Ga0070688_100058035 3300005365 Bacteria 2436
49 Ga0070659_100354976 3300005366 Bacteria 1231
50 Ga0070667_100030191 3300005367 Unclassified 4520
51 Ga0070667_100057094 3300005367 Bacteria 3298
52 Ga0070667_100134468 3300005367 Unclassified 2161
53 Ga0070667_100158846 3300005367 Bacteria 1990
54 Ga0070667_100179181 3300005367 Bacteria 1874
55 Ga0070667_100233505 3300005367 Bacteria 1640
56 Ga0070667_100389117 3300005367 Bacteria 1268
57 Ga0070667_100620051 3300005367 Unclassified 997
58 Ga0070703_10116613 3300005406 Bacteria 963
59 Ga0070701_10015076 3300005438 Bacteria 3559
60 Ga0070701_10019919 3300005438 Unclassified 3175
61 Ga0070711_100514329 3300005439 Bacteria 989
62 Ga0070705_100178871 3300005440 Bacteria 1435
63 Ga0070705_100192223 3300005440 Bacteria 1392
64 Ga0070700_100007401 3300005441 Bacteria 5926
65 Ga0070700_100038062 3300005441 Bacteria 2930
66 Ga0070700_100050677 3300005441 Unclassified 2581
67 Ga0070700_100184570 3300005441 Bacteria 1454
68 Ga0070700_100200414 3300005441 Bacteria 1402
69 Ga0070694_100006927 3300005444 Bacteria 6891
70 Ga0070694_100011854 3300005444 Bacteria 5407
71 Ga0070694_100171409 3300005444 Bacteria 1599
72 Ga0070694_100264868 3300005444 Bacteria 1305
73 Ga0070708_100000720 3300005445 Bacteria 25109
74 Ga0070708_100026382 3300005445 Bacteria 4972
75 Ga0070708_100238723 3300005445 Unclassified 1706
76 Ga0070678_100071515 3300005456 Bacteria 2597
77 Ga0070678_100114834 3300005456 Bacteria 2113
78 Ga0070662_100016422 3300005457 Unclassified 4972
79 Ga0070662_100128497 3300005457 Bacteria 1951
80 Ga0070681_10000458 3300005458 Bacteria 33399
81 Ga0070681_10007211 3300005458 Bacteria 10841
82 Ga0070681_10199650 3300005458 Bacteria 1918
83 Ga0068867_100025433 3300005459 Bacteria 4248
84 Ga0068867_100031574 3300005459 Unclassified 3825
85 Ga0068867_100132944 3300005459 Bacteria 1936
86 Ga0068867_100264216 3300005459 Bacteria 1404
87 Ga0070685_10071873 3300005466 Bacteria 2052
88 Ga0070706_100017771 3300005467 Bacteria 6562
89 Ga0070706_100074991 3300005467 Bacteria 3131
90 Ga0070706_100099856 3300005467 Bacteria 2696
91 Ga0070706_100157257 3300005467 Bacteria 2122
92 Ga0070706_100209733 3300005467 Bacteria 1819
93 Ga0070706_100249862 3300005467 Bacteria 1656
94 Ga0070706_100275982 3300005467 Bacteria 1569
95 Ga0070706_100294966 3300005467 Bacteria 1513
96 Ga0070707_100000133 3300005468 Bacteria 69819
97 Ga0070707_100001360 3300005468 Bacteria 24022
98 Ga0070707_100022998 3300005468 Bacteria 5895
99 Ga0070707_100038954 3300005468 Bacteria 4541
100 Ga0070707_100070045 3300005468 Bacteria 3378
101 Ga0070707_100107657 3300005468 Bacteria 2704
102 Ga0070707_100136028 3300005468 Bacteria 2390
103 Ga0070707_100428558 3300005468 Bacteria 1283
104 Ga0070698_100000060 3300005471 Bacteria 78692
105 Ga0070698_100001691 3300005471 Bacteria 24608
106 Ga0070698_100009305 3300005471 Bacteria 10541
107 Ga0070698_100011198 3300005471 Bacteria 9531
108 Ga0070698_100012191 3300005471 Bacteria 9107
109 Ga0070698_100021653 3300005471 Bacteria 6730
110 Ga0070698_100079888 3300005471 Bacteria 3266
111 Ga0070698_100116941 3300005471 Unclassified 2629
112 Ga0070698_100611901 3300005471 Bacteria 1030
113 Ga0070699_100001008 3300005518 Bacteria 26211
114 Ga0070699_100044629 3300005518 Bacteria 3837
115 Ga0070699_100112613 3300005518 Bacteria 2390
116 Ga0070699_100153602 3300005518 Unclassified 2037
117 Ga0070699_100209015 3300005518 Bacteria 1737
118 Ga0070679_100000081 3300005530 Bacteria 71191
119 Ga0070679_100045165 3300005530 Bacteria 4390
120 Ga0070697_100000112 3300005536 Bacteria 63499
121 Ga0070697_100001902 3300005536 Bacteria 15967
122 Ga0070697_100011647 3300005536 Bacteria 6873
123 Ga0070697_100061441 3300005536 Bacteria 3064
124 Ga0070697_100132641 3300005536 Bacteria 2090
125 Ga0070697_100341026 3300005536 Archaea 1293
126 Ga0068853_100005143 3300005539 Bacteria 10228
127 Ga0068853_100113076 3300005539 Unclassified 2413
128 Ga0068853_100258500 3300005539 Bacteria 1600
129 Ga0068853_100355585 3300005539 Bacteria 1363
130 Ga0070672_100017397 3300005543 Bacteria 5172
131 Ga0070672_100078075 3300005543 Bacteria 2648
132 Ga0070672_100097456 3300005543 Bacteria 2381
133 Ga0070672_100127452 3300005543 Bacteria 2089
134 Ga0070672_100163738 3300005543 Archaea 1847
135 Ga0070672_100304659 3300005543 Bacteria 1351
136 Ga0070672_100333469 3300005543 Bacteria 1291
137 Ga0070686_100017575 3300005544 Unclassified 4181
138 Ga0070686_100031105 3300005544 Unclassified 3261
139 Ga0070686_100096758 3300005544 Bacteria 1986
140 Ga0070686_100437082 3300005544 Bacteria 1003
141 Ga0070695_100044282 3300005545 Bacteria 2833
142 Ga0070695_100057540 3300005545 Bacteria 2512
143 Ga0070695_100112055 3300005545 Bacteria 1853
144 Ga0070696_100017580 3300005546 Bacteria 4828
145 Ga0070696_100086552 3300005546 Bacteria 2225
146 Ga0070696_100159906 3300005546 Bacteria 1659
147 Ga0070696_100360795 3300005546 Bacteria 1128
148 Ga0070693_100232908 3300005547 Bacteria 1213
149 Ga0070665_100102689 3300005548 Bacteria 2863
150 Ga0070665_100215993 3300005548 Bacteria 1918
151 Ga0070665_100496033 3300005548 Bacteria 1232
152 Ga0070704_100000895 3300005549 Bacteria 14937
153 Ga0070704_100016579 3300005549 Bacteria 4659
154 Ga0070704_100023606 3300005549 Bacteria 4022
155 Ga0070704_100031991 3300005549 Bacteria 3543
156 Ga0070704_100230665 3300005549 Unclassified 1510
157 Ga0070704_100471636 3300005549 Bacteria 1084
158 Ga0068855_100762523 3300005563 Bacteria 1031
159 Ga0070664_100097396 3300005564 Bacteria 2554
160 Ga0070664_100178418 3300005564 Bacteria 1887
161 Ga0070664_100181496 3300005564 Bacteria 1871
162 Ga0070664_100653715 3300005564 Bacteria 977
163 Ga0068857_100031537 3300005577 Bacteria 4684
164 Ga0068857_100102202 3300005577 Bacteria 2572
165 Ga0068857_100133908 3300005577 Unclassified 2237
166 Ga0068857_100155388 3300005577 Bacteria 2074
167 Ga0068854_100089363 3300005578 Bacteria 2289
168 Ga0068854_100178795 3300005578 Bacteria 1656
169 Ga0068856_100028009 3300005614 Bacteria 5497
170 Ga0070702_100074210 3300005615 Bacteria 2017
171 Ga0068852_100154412 3300005616 Bacteria 2137
172 Ga0068859_100011011 3300005617 Bacteria 9101
173 Ga0068859_100042552 3300005617 Bacteria 4563
174 Ga0068859_100043876 3300005617 Bacteria 4494
175 Ga0068859_100068887 3300005617 Bacteria 3572
176 Ga0068859_100236011 3300005617 Unclassified 1917
177 Ga0068859_100458264 3300005617 Bacteria 1371
178 Ga0068859_101000904 3300005617 Bacteria 918
179 Ga0068864_100004110 3300005618 Bacteria 11942
180 Ga0068864_100061614 3300005618 Bacteria 3249
181 Ga0068864_100072639 3300005618 Unclassified 2999
182 Ga0068864_100230859 3300005618 Bacteria 1711
183 Ga0068864_100239488 3300005618 Bacteria 1681
184 Ga0068864_100278515 3300005618 Bacteria 1560
185 Ga0068864_100523501 3300005618 Bacteria 1143
186 Ga0068864_100779505 3300005618 Bacteria 938
187 Ga0068866_10103707 3300005718 Unclassified 1574
188 Ga0068861_100040685 3300005719 Bacteria 3478
189 Ga0068861_100150100 3300005719 Unclassified 1911
190 Ga0068861_100260038 3300005719 Bacteria 1486
191 Ga0068861_100500614 3300005719 Bacteria 1098
192 Ga0068851_10271515 3300005834 Bacteria 967
193 Ga0068870_10041308 3300005840 Bacteria 2396
194 Ga0068863_100022847 3300005841 Bacteria 5976
195 Ga0068863_100037302 3300005841 Bacteria 4628
196 Ga0068863_100069356 3300005841 Bacteria 3334
197 Ga0068863_100094745 3300005841 Unclassified 2833
198 Ga0068863_100191108 3300005841 Bacteria 1967
199 Ga0068863_100195873 3300005841 Unclassified 1942
200 Ga0068863_100619592 3300005841 Bacteria 1072
201 Ga0068863_100884897 3300005841 Bacteria 893
202 Ga0068858_100074362 3300005842 Bacteria 3155
203 Ga0068858_100328985 3300005842 Bacteria 1461
204 Ga0068858_100583407 3300005842 Bacteria 1083
205 Ga0068860_100015839 3300005843 Bacteria 7360
206 Ga0068860_100038985 3300005843 Bacteria 4545
207 Ga0068860_100040805 3300005843 Unclassified 4434
208 Ga0068860_100101361 3300005843 Bacteria 2747
209 Ga0068860_100260958 3300005843 Bacteria 1689
210 Ga0068860_100778097 3300005843 Bacteria 970
211 Ga0068862_100012345 3300005844 Bacteria 7062
212 Ga0068862_100108209 3300005844 Bacteria 2438
213 Ga0081539_10005400 3300005985 Bacteria 13074
214 Ga0075365_10007791 3300006038 Bacteria 6032
215 Ga0075368_10001890 3300006042 Bacteria 6720
216 Ga0075368_10012467 3300006042 Bacteria 3107
217 Ga0075368_10016134 3300006042 Bacteria 2780
218 Ga0075363_100139701 3300006048 Bacteria 1363
219 Ga0075364_10289038 3300006051 Bacteria 1115
220 Ga0070716_100293682 3300006173 Unclassified 1127
221 Ga0075362_10005837 3300006177 Bacteria 4541
222 Ga0075367_10003414 3300006178 Bacteria 7569
223 Ga0075367_10021486 3300006178 Bacteria 3607
224 Ga0075367_10047837 3300006178 Bacteria 2517
225 Ga0075367_10066324 3300006178 Bacteria 2163
226 Ga0075367_10160548 3300006178 Unclassified 1397
227 Ga0075367_10195365 3300006178 Bacteria 1263
228 Ga0075366_10004403 3300006195 Bacteria 7559
229 Ga0075366_10007720 3300006195 Bacteria 5959
230 Ga0075366_10125602 3300006195 Bacteria 1547
231 Ga0075366_10126519 3300006195 Bacteria 1541
232 Ga0097621_100003821 3300006237 Bacteria 10436
233 Ga0097621_100027276 3300006237 Unclassified 4490
234 Ga0097621_100029996 3300006237 Bacteria 4301
235 Ga0097621_100035381 3300006237 Bacteria 3990
236 Ga0068871_100024451 3300006358 Unclassified 4685
237 Ga0068871_100185408 3300006358 Unclassified 1790
238 Ga0068871_100231594 3300006358 Bacteria 1603
239 Ga0075428_100052997 3300006844 Bacteria 4444
240 Ga0075428_100056331 3300006844 Bacteria 4306
241 Ga0075428_100131327 3300006844 Bacteria 2724
242 Ga0075428_100199713 3300006844 Bacteria 2162
243 Ga0075428_100440298 3300006844 Bacteria 1396
244 Ga0075428_100486596 3300006844 Bacteria 1321
245 Ga0075428_100777829 3300006844 Bacteria 1018
246 Ga0075431_100001101 3300006847 Bacteria 24221
247 Ga0075431_100081969 3300006847 Bacteria 3330
248 Ga0075433_10032712 3300006852 Unclassified 4456
249 Ga0075433_10069568 3300006852 Archaea 3091
250 Ga0075433_10114113 3300006852 Bacteria 2397
251 Ga0075433_10124118 3300006852 Unclassified 2294
252 Ga0075433_10156554 3300006852 Bacteria 2027
253 Ga0075434_100003671 3300006871 Bacteria 13714
254 Ga0075434_100307457 3300006871 Bacteria 1605
255 Ga0075429_100038474 3300006880 Bacteria 4164
256 Ga0075429_100050896 3300006880 Bacteria 3604
257 Ga0075429_100176761 3300006880 Bacteria 1870
258 Ga0075429_100399189 3300006880 Bacteria 1204
259 Ga0068865_100002728 3300006881 Bacteria 10485
260 Ga0068865_100012665 3300006881 Bacteria 5314
261 Ga0068865_100090320 3300006881 Unclassified 2220
262 Ga0097620_100011011 3300006931 Bacteria 9101
263 Ga0097620_100042549 3300006931 Bacteria 4563
264 Ga0097620_100043873 3300006931 Bacteria 4494
265 Ga0097620_100068887 3300006931 Bacteria 3572
266 Ga0097620_100236045 3300006931 Unclassified 1917
267 Ga0097620_100458257 3300006931 Bacteria 1371
268 Ga0097620_101000977 3300006931 Bacteria 918
269 Ga0111539_10001456 3300009094 Bacteria 31594
270 Ga0111539_10395089 3300009094 Bacteria 1610
271 Ga0105245_10029607 3300009098 Bacteria 4839
272 Ga0105245_10130593 3300009098 Bacteria 2356
273 Ga0105245_11003696 3300009098 Bacteria 879
274 Ga0105247_10054323 3300009101 Bacteria 2472
275 Ga0114129_10002021 3300009147 Bacteria 27813
276 Ga0114129_10003031 3300009147 Bacteria 23551
277 Ga0114129_10018525 3300009147 Bacteria 9912
278 Ga0114129_10105945 3300009147 Bacteria 3885
279 Ga0114129_10111926 3300009147 Unclassified 3766
280 Ga0114129_10114059 3300009147 Bacteria 3726
281 Ga0114129_10150552 3300009147 Bacteria 3185
282 Ga0114129_10188024 3300009147 Bacteria 2806
283 Ga0114129_10232991 3300009147 Unclassified 2479
284 Ga0114129_10269535 3300009147 Bacteria 2278
285 Ga0114129_10285024 3300009147 Bacteria 2206
286 Ga0114129_10560207 3300009147 Bacteria 1485
287 Ga0114129_10586235 3300009147 Bacteria 1446
288 Ga0114129_10660583 3300009147 Bacteria 1348
289 Ga0114129_11043336 3300009147 Unclassified 1027
290 Ga0105243_10000187 3300009148 Bacteria 72048
291 Ga0105243_10015199 3300009148 Bacteria 5826
292 Ga0105243_10029318 3300009148 Unclassified 4231
293 Ga0105241_10014753 3300009174 Bacteria 5720
294 Ga0105241_10107495 3300009174 Bacteria 2228
295 Ga0105241_10370010 3300009174 Bacteria 1249
296 Ga0105242_10000008 3300009176 Bacteria 172348
297 Ga0105242_10006641 3300009176 Bacteria 8923
298 Ga0105248_10013017 3300009177 Bacteria 9169
299 Ga0105248_10123297 3300009177 Bacteria 2923
300 Ga0105248_10128061 3300009177 Bacteria 2864
301 Ga0105248_10256559 3300009177 Bacteria 1968
302 Ga0105248_10325774 3300009177 Unclassified 1730
303 Ga0105248_10402264 3300009177 Bacteria 1542
304 Ga0105237_10045947 3300009545 Bacteria 4393
305 Ga0105237_10178565 3300009545 Bacteria 2123
306 Ga0105237_10467413 3300009545 Bacteria 1267
307 Ga0105237_10607549 3300009545 Bacteria 1101
308 Ga0105249_10010661 3300009553 Bacteria 8073
309 Ga0105249_10050912 3300009553 Bacteria 3776
310 Ga0105249_10073710 3300009553 Bacteria 3158
311 Ga0105249_10109826 3300009553 Bacteria 2605
312 Ga0105249_10139640 3300009553 Bacteria 2322
313 Ga0105249_10198017 3300009553 Bacteria 1964
314 Ga0105249_10198426 3300009553 Bacteria 1962
315 Ga0105249_10340774 3300009553 Bacteria 1516
316 Ga0105249_10350021 3300009553 Unclassified 1496
317 Ga0105239_10030026 3300010375 Bacteria 5978
318 Ga0105239_10190984 3300010375 Unclassified 2292
319 Ga0105239_10196773 3300010375 Bacteria 2257
320 Ga0105239_10555121 3300010375 Bacteria 1308
321 Ga0105239_10709215 3300010375 Bacteria 1151
322 Ga0157373_10329420 3300013100 Unclassified 1087
323 Ga0157371_10173771 3300013102 Bacteria 1540
324 Ga0157370_10074837 3300013104 Bacteria 3194
325 Ga0157370_10265474 3300013104 Bacteria 1586
326 Ga0157369_10569669 3300013105 Bacteria 1170
327 Ga0157374_10008572 3300013296 Eukaryota 8743
328 Ga0157374_10210237 3300013296 Bacteria 1907
329 Ga0157378_10005014 3300013297 Bacteria 11619
330 Ga0157378_10006499 3300013297 Bacteria 10219
331 Ga0157378_10018168 3300013297 Bacteria 6175
332 Ga0157378_10689021 3300013297 Unclassified 1040
333 Ga0163162_10004780 3300013306 Bacteria 13075
334 Ga0163162_10007623 3300013306 Bacteria 10539
335 Ga0163162_10022050 3300013306 Bacteria 6275
336 Ga0163162_10093527 3300013306 Bacteria 3091
337 Ga0163162_10138843 3300013306 Unclassified 2542
338 Ga0163162_10147510 3300013306 Unclassified 2469
339 Ga0163162_10347422 3300013306 Bacteria 1616
340 Ga0163162_10804619 3300013306 Bacteria 1057
341 Ga0157372_10000564 3300013307 Bacteria 40762
342 Ga0157372_10086203 3300013307 Bacteria 3563
343 Ga0157372_10488115 3300013307 Bacteria 1436
344 Ga0157375_10010341 3300013308 Bacteria 8214
345 Ga0157375_10153854 3300013308 Bacteria 2437
346 Ga0157375_10154711 3300013308 Unclassified 2431
347 Ga0157375_10501877 3300013308 Bacteria 1377
348 Ga0157375_11071803 3300013308 Bacteria 943
349 Ga0163163_10026788 3300014325 Bacteria 5514
350 Ga0163163_10124870 3300014325 Bacteria 2611
351 Ga0163163_10137771 3300014325 Bacteria 2482
352 Ga0163163_10233234 3300014325 Unclassified 1890
353 Ga0163163_10373052 3300014325 Unclassified 1484
354 Ga0157380_10001690 3300014326 Bacteria 14575
355 Ga0157380_10019779 3300014326 Bacteria 5023
356 Ga0157380_10044123 3300014326 Bacteria 3492
357 Ga0157380_10355488 3300014326 Unclassified 1372
358 Ga0157377_10031372 3300014745 Bacteria 2887
359 Ga0157377_10394889 3300014745 Bacteria 940
360 Ga0157379_10184879 3300014968 Bacteria 1883
361 Ga0157379_10212961 3300014968 Unclassified 1749
362 Ga0157379_10464603 3300014968 Bacteria 1170
363 Ga0157379_10618498 3300014968 Bacteria 1012
364 Ga0157376_10045048 3300014969 Bacteria 3630
365 Ga0157376_10247197 3300014969 Bacteria 1664
366 Ga0157376_10390894 3300014969 Bacteria 1342
367 Ga0157376_10523699 3300014969 Bacteria 1169
368 Ga0163161_10003822 3300017792 Bacteria 10563
369 Ga0163161_10048631 3300017792 Unclassified 3063
370 Ga0163161_10063437 3300017792 Bacteria 2693
371 Ga0163161_10112195 3300017792 Bacteria 2040
372 Ga0163161_10118721 3300017792 Bacteria 1985
373 Ga0163161_10127102 3300017792 Unclassified 1920
374 Ga0213876_10000141 3300021384 Bacteria 78529
375 Ga0213876_10000144 3300021384 Bacteria 76915
376 Ga0207697_10075496 3300025315 Bacteria 1416
377 Ga0207682_10015115 3300025893 Bacteria 3006
378 Ga0207682_10095063 3300025893 Bacteria 1297
379 Ga0207642_10024242 3300025899 Bacteria 2437
380 Ga0207688_10377308 3300025901 Unclassified 877
381 Ga0207680_10232459 3300025903 Bacteria 1268
382 Ga0207680_10394657 3300025903 Bacteria 977
383 Ga0207645_10078050 3300025907 Bacteria 2122
384 Ga0207645_10120877 3300025907 Bacteria 1700
385 Ga0207645_10255680 3300025907 Bacteria 1160
386 Ga0207645_10277885 3300025907 Bacteria 1112
387 Ga0207643_10041095 3300025908 Bacteria 2605
388 Ga0207684_10000371 3300025910 Bacteria 60703
389 Ga0207684_10015423 3300025910 Bacteria 6578
390 Ga0207684_10034093 3300025910 Bacteria 4327
391 Ga0207684_10060257 3300025910 Bacteria 3224
392 Ga0207684_10067761 3300025910 Bacteria 3033
393 Ga0207684_10124995 3300025910 Bacteria 2206
394 Ga0207684_10320192 3300025910 Bacteria 1337
395 Ga0207684_10328927 3300025910 Bacteria 1317
396 Ga0207684_10476000 3300025910 Unclassified 1071
397 Ga0207654_10337037 3300025911 Bacteria 1035
398 Ga0207707_10000007 3300025912 Bacteria 368555
399 Ga0207707_10000461 3300025912 Bacteria 42164
400 Ga0207671_10127343 3300025914 Bacteria 1952
401 Ga0207671_10270605 3300025914 Bacteria 1338
402 Ga0207660_10000803 3300025917 Bacteria 20728
403 Ga0207662_10000398 3300025918 Bacteria 19335
404 Ga0207662_10014742 3300025918 Bacteria 4389
405 Ga0207662_10392473 3300025918 Unclassified 939
406 Ga0207649_10113886 3300025920 Bacteria 1812
407 Ga0207649_10216541 3300025920 Bacteria 1362
408 Ga0207652_10000062 3300025921 Bacteria 113255
409 Ga0207652_10111520 3300025921 Bacteria 2426
410 Ga0207646_10000281 3300025922 Bacteria 69840
411 Ga0207646_10001360 3300025922 Bacteria 30289
412 Ga0207646_10003496 3300025922 Bacteria 17710
413 Ga0207646_10005934 3300025922 Bacteria 12739
414 Ga0207646_10017878 3300025922 Bacteria 6622
415 Ga0207646_10048236 3300025922 Bacteria 3818
416 Ga0207646_10097990 3300025922 Bacteria 2627
417 Ga0207646_10384441 3300025922 Bacteria 1268
418 Ga0207681_10024116 3300025923 Bacteria 3901
419 Ga0207650_10012105 3300025925 Bacteria 5946
420 Ga0207650_10015791 3300025925 Bacteria 5265
421 Ga0207650_10042265 3300025925 Bacteria 3344
422 Ga0207650_10101866 3300025925 Bacteria 2212
423 Ga0207659_10043118 3300025926 Bacteria 3167
424 Ga0207659_10094749 3300025926 Bacteria 2238
425 Ga0207687_10418144 3300025927 Bacteria 1106
426 Ga0207644_10021734 3300025931 Bacteria 4375
427 Ga0207644_10036437 3300025931 Unclassified 3453
428 Ga0207706_10030624 3300025933 Bacteria 4798
429 Ga0207706_10192151 3300025933 Bacteria 1792
430 Ga0207706_10347830 3300025933 Bacteria 1289
431 Ga0207706_10482739 3300025933 Bacteria 1071
432 Ga0207686_10000023 3300025934 Bacteria 172422
433 Ga0207709_10000062 3300025935 Bacteria 194534
434 Ga0207709_10055886 3300025935 Bacteria 2441
435 Ga0207709_10284512 3300025935 Bacteria 1222
436 Ga0207670_10007494 3300025936 Bacteria 6092
437 Ga0207670_10116646 3300025936 Bacteria 1933
438 Ga0207670_10443093 3300025936 Bacteria 1046
439 Ga0207670_10553634 3300025936 Bacteria 940
440 Ga0207669_10030637 3300025937 Bacteria 2992
441 Ga0207669_10239484 3300025937 Unclassified 1344
442 Ga0207704_10089047 3300025938 Bacteria 2021
443 Ga0207665_10339990 3300025939 Unclassified 1131
444 Ga0207691_10007983 3300025940 Bacteria 10180
445 Ga0207691_10025966 3300025940 Bacteria 5497
446 Ga0207691_10086271 3300025940 Bacteria 2817
447 Ga0207691_10349904 3300025940 Bacteria 1264
448 Ga0207711_10061643 3300025941 Bacteria 3234
449 Ga0207711_10093587 3300025941 Bacteria 2647
450 Ga0207711_10102681 3300025941 Bacteria 2531
451 Ga0207711_10137539 3300025941 Bacteria 2195
452 Ga0207711_10566990 3300025941 Bacteria 1059
453 Ga0207689_10131541 3300025942 Unclassified 2059
454 Ga0207689_10197795 3300025942 Bacteria 1659
455 Ga0207689_10219958 3300025942 Bacteria 1569
456 Ga0207689_10590648 3300025942 Bacteria 934
457 Ga0207661_10285640 3300025944 Bacteria 1476
458 Ga0207679_10143146 3300025945 Bacteria 1935
459 Ga0207679_10149372 3300025945 Bacteria 1900
460 Ga0207679_10153636 3300025945 Bacteria 1877
461 Ga0207651_10061994 3300025960 Bacteria 2604
462 Ga0207651_10065145 3300025960 Bacteria 2554
463 Ga0207651_10118845 3300025960 Bacteria 2000
464 Ga0207651_10159858 3300025960 Bacteria 1765
465 Ga0207651_10313925 3300025960 Unclassified 1308
466 Ga0207651_10382166 3300025960 Bacteria 1193
467 Ga0207651_10392699 3300025960 Bacteria 1178
468 Ga0207712_10004208 3300025961 Bacteria 9078
469 Ga0207712_10011708 3300025961 Bacteria 5593
470 Ga0207712_10025821 3300025961 Bacteria 3907
471 Ga0207712_10055755 3300025961 Bacteria 2781
472 Ga0207712_10080217 3300025961 Bacteria 2373
473 Ga0207712_10148689 3300025961 Bacteria 1807
474 Ga0207712_10339908 3300025961 Bacteria 1244
475 Ga0207640_10108206 3300025981 Bacteria 1964
476 Ga0207658_10044980 3300025986 Unclassified 3216
477 Ga0207658_10105804 3300025986 Bacteria 2214
478 Ga0207658_10112389 3300025986 Bacteria 2156
479 Ga0207658_10116769 3300025986 Bacteria 2120
480 Ga0207658_10327260 3300025986 Bacteria 1328
481 Ga0207677_10204570 3300026023 Bacteria 1572
482 Ga0207677_10631544 3300026023 Bacteria 943
483 Ga0207703_10125989 3300026035 Bacteria 2205
484 Ga0207703_10201119 3300026035 Bacteria 1770
485 Ga0207703_10563514 3300026035 Bacteria 1075
486 Ga0207703_10592583 3300026035 Unclassified 1048
487 Ga0207639_10053338 3300026041 Bacteria 3085
488 Ga0207639_10076184 3300026041 Bacteria 2640
489 Ga0207639_10195608 3300026041 Bacteria 1730
490 Ga0207678_10028834 3300026067 Bacteria 4846
491 Ga0207678_10072297 3300026067 Bacteria 2956
492 Ga0207708_10013380 3300026075 Bacteria 6130
493 Ga0207708_10014089 3300026075 Bacteria 5975
494 Ga0207708_10104827 3300026075 Unclassified 2191
495 Ga0207708_10141511 3300026075 Bacteria 1887
496 Ga0207702_10381475 3300026078 Bacteria 1356
497 Ga0207641_10017544 3300026088 Bacteria 5860
498 Ga0207641_10141717 3300026088 Bacteria 2169
499 Ga0207641_10155772 3300026088 Unclassified 2073
500 Ga0207641_10305198 3300026088 Bacteria 1505
501 Ga0207641_10382350 3300026088 Bacteria 1348
502 Ga0207641_10806597 3300026088 Bacteria 929
503 Ga0207648_10008341 3300026089 Bacteria 10048
504 Ga0207648_10065760 3300026089 Bacteria 3161
505 Ga0207648_10068148 3300026089 Bacteria 3100
506 Ga0207648_10438308 3300026089 Bacteria 1188
507 Ga0207676_10047092 3300026095 Bacteria 3340
508 Ga0207676_10054014 3300026095 Bacteria 3146
509 Ga0207676_10071753 3300026095 Bacteria 2781
510 Ga0207676_10074452 3300026095 Unclassified 2736
511 Ga0207676_10094041 3300026095 Unclassified 2469
512 Ga0207676_10112006 3300026095 Bacteria 2285
513 Ga0207676_10348032 3300026095 Bacteria 1370
514 Ga0207674_10107084 3300026116 Bacteria 2772
515 Ga0207674_10154229 3300026116 Unclassified 2252
516 Ga0207675_100050449 3300026118 Bacteria 3882
517 Ga0207675_100083699 3300026118 Bacteria 2992
518 Ga0207675_100145656 3300026118 Unclassified 2252
519 Ga0207675_100150187 3300026118 Bacteria 2217
520 Ga0207675_100584000 3300026118 Bacteria 1119
521 Ga0207683_10058058 3300026121 Bacteria 3398
522 Ga0207683_10311170 3300026121 Bacteria 1442
523 Ga0207683_10723031 3300026121 Bacteria 923
524 Ga0209588_1082159 3300027671 Bacteria 1041
525 Ga0209813_10010999 3300027866 Bacteria 2355
526 Ga0207428_10000139 3300027907 Bacteria 98277
527 Ga0207428_10144492 3300027907 Bacteria 1814
528 Ga0268266_10090550 3300028379 Bacteria 2681
529 Ga0268266_10130918 3300028379 Bacteria 2244
530 Ga0268265_10083138 3300028380 Bacteria 2534
531 Ga0268265_10097804 3300028380 Unclassified 2362
532 Ga0268265_10149826 3300028380 Bacteria 1966
533 Ga0268265_10299002 3300028380 Unclassified 1448
534 Ga0268264_10008279 3300028381 Bacteria 8640
535 Ga0268264_10017131 3300028381 Bacteria 5934
536 Ga0268264_10024042 3300028381 Unclassified 4971
537 Ga0268264_10144248 3300028381 Bacteria 2127
538 Ga0268264_10472500 3300028381 Bacteria 1218
539 Ga0268264_10475732 3300028381 Bacteria 1214
540 Ga0268264_10587509 3300028381 Bacteria 1096
541 Ga0268264_10596310 3300028381 Unclassified 1088
542 Ga0307513_10376969 3300031456 Bacteria 1159
543 Ga0265314_10005683 3300031711 Bacteria 11198
544 Ga0307410_10643868 3300031852 Bacteria 888
545 Ga0307407_10262764 3300031903 Bacteria 1188
546 Ga0307409_100118125 3300031995 Bacteria 2239
547 Ga0307409_100409234 3300031995 Unclassified 1298
548 Ga0307409_100509407 3300031995 Bacteria 1174
549 Ga0307416_100320685 3300032002 Unclassified 1551
550 Ga0307416_100905185 3300032002 Bacteria 982
551 Ga0307414_10183949 3300032004 Unclassified 1684
552 Ga0373948_0070643 3300034817 Bacteria 782
553 Ga0373955_0371978 3300035172 Bacteria 867
554 Ga0373931_0302011 3300035691 Bacteria 989
555 Ga0373933_0028600 3300035724 Bacteria 3218
556 Ga0373937_0152114 3300036401 Bacteria 2168
557 Ga0373937_0401309 3300036401 Bacteria 1301
558 Ga0373925_0030233 3300037068 Bacteria 3976
559 Ga0395898_0836652 3300037466 Bacteria 860
560 Ga0395905_0044079 3300037471 Unclassified 4186
561 Ga0436365_0255646 3300039437 Bacteria 91230
562 Ga0436365_0289912 3300039437 Bacteria 336570
563 Ga0450898_006203 3300042134 Bacteria 1829
564 Ga0450907_030980 3300042146 Bacteria 909
565 Ga0450908_006750 3300042184 Bacteria 2172
566 Ga0451577_0228523 3300042876 Bacteria 1682
567 Ga0453683_0380775 3300044673 Bacteria 908
568 Ga0453684_0236799 3300044712 Bacteria 2104
569 Ga0453684_0629610 3300044712 Bacteria 1173
570 Ga0495608_0413974 3300046511 Bacteria 823
571 Ga0495628_0081228 3300046516 Bacteria 2518
572 Ga0495630_0346598 3300046517 Bacteria 1137
573 Ga0495668_0000396 3300046616 Bacteria 57340
574 Ga0495635_0038445 3300046663 Bacteria 3314
575 Ga0495659_0200711 3300046664 Bacteria 818
576 Ga0495669_0111838 3300046684 Bacteria 1276
577 Ga0495600_0084243 3300046809 Unclassified 2075
578 Ga0495674_0153268 3300047319 Bacteria 1932
579 Ga0495674_0443291 3300047319 Bacteria 1044
580 Ga0495684_0071933 3300047471 Bacteria 2628
581 Ga0496104_0005912 3300048907 Bacteria 10714
582 Ga0496104_0016431 3300048907 Bacteria 6723
583 Ga0496105_0041469 3300048908 Bacteria 3794
584 Ga0496105_0143626 3300048908 Bacteria 1963
585 Ga0496106_0222327 3300048909 Bacteria 1506
586 Ga0496108_0015830 3300048911 Bacteria 6147
587 Ga0496108_0056397 3300048911 Unclassified 3301
588 Ga0496108_0120959 3300048911 Bacteria 2246
589 Ga0496108_0270852 3300048911 Bacteria 1478
590 Ga0496109_0001487 3300048912 Bacteria 19461
591 Ga0496110_0028546 3300048913 Bacteria 4794
592 Ga0496110_0795797 3300048913 Bacteria 850
593 Ga0496112_0006009 3300048915 Bacteria 10596
594 Ga0496113_0007492 3300048916 Bacteria 7030
595 Ga0496113_0458192 3300048916 Unclassified 1025
596 Ga0496114_0008943 3300048917 Bacteria 7938
597 Ga0496114_0245963 3300048917 Bacteria 1573
598 Ga0496115_0013522 3300048918 Bacteria 6174
599 Ga0496115_0211463 3300048918 Unclassified 1602
600 Ga0501036_0025883 3300049572 Bacteria 4951
601 Ga0501038_0392911 3300049574 Bacteria 1074
602 Ga0501041_0152382 3300049577 Bacteria 1444
603 Ga0501042_0419305 3300049578 Bacteria 970
604 Ga0501048_0133796 3300049582 Bacteria 1752
605 Ga0501067_0285052 3300049583 Bacteria 920
606 Ga0501068_0130931 3300049584 Bacteria 1568
607 Ga0501068_0360043 3300049584 Bacteria 936
608 Ga0501071_0288518 3300049587 Bacteria 1242
609 Ga0501075_0081370 3300049591 Bacteria 2452
610 Ga0501075_0142864 3300049591 Bacteria 1824
611 Ga0501075_0161038 3300049591 Bacteria 1712
612 Ga0501080_0594252 3300049742 Bacteria 983
613 Ga0501081_0197596 3300049743 Bacteria 1458
614 Ga0501035_0581265 3300049822 Bacteria 915
615 Ga0501045_0133425 3300049824 Bacteria 1846
616 nmdc:mga03n38_141383_c1 3300050490 Bacteria 1202
617 nmdc:mga00v17_56188_c1 3300050491 Bacteria 2406
618 nmdc:mga0k408_20080_c1 3300050493 Bacteria 3739
619 nmdc:mga0k408_258010_c1 3300050493 Bacteria 1041
620 nmdc:mga0k408_56369_c2 3300050493 Bacteria 1390
621 nmdc:mga0k408_6948_c1 3300050493 Bacteria 6037
622 nmdc:mga06z11_10604_c1 3300050494 Bacteria 3935
623 nmdc:mga06z11_32689_c1 3300050494 Bacteria 2539
624 nmdc:mga06z11_33474_c1 3300050494 Bacteria 2514
625 nmdc:mga06z11_4585_c1 3300050494 Bacteria 5449
626 nmdc:mga06z11_51650_c1 3300050494 Bacteria 2106
627 nmdc:mga06z11_56673_c1 3300050494 Bacteria 2028
628 nmdc:mga04h51_12908_c1 3300050495 Bacteria 2355
629 nmdc:mga07m45_18963_c1 3300050496 Bacteria 3722
630 nmdc:mga07m45_55181_c1 3300050496 Bacteria 2246
631 nmdc:mga05p37_1012519_c1 3300050507 Bacteria 881
632 nmdc:mga05p37_183707_c1 3300050507 Bacteria 2543
633 nmdc:mga05p37_207262_c1 3300050507 Bacteria 2371
634 nmdc:mga05p37_28745_c1 3300050507 Bacteria 6782
635 nmdc:mga05p37_323537_c1 3300050507 Bacteria 1824
636 nmdc:mga05p37_458743_c1 3300050507 Bacteria 1473
637 nmdc:mga05p37_62006_c1 3300050507 Bacteria 4602
638 nmdc:mga05p37_824728_c1 3300050507 Bacteria 1011
639 nmdc:mga05p37_955974_c1 3300050507 Bacteria 916
640 nmdc:mga09592_160803_c1 3300050508 Bacteria 1940
641 nmdc:mga09592_59825_c1 3300050508 Bacteria 3220
642 nmdc:mga09592_60393_c1 3300050508 Bacteria 3205
643 nmdc:mga09592_807_c1 3300050508 Bacteria 24210
644 nmdc:mga0qj67_321314_c1 3300050509 Bacteria 1253
645 nmdc:mga06r32_1701_c1 3300050510 Bacteria 19832
646 nmdc:mga06r32_252431_c1 3300050510 Unclassified 1751
647 nmdc:mga06r32_31455_c1 3300050510 Bacteria 4984
648 nmdc:mga06r32_51689_c1 3300050510 Bacteria 3933
649 nmdc:mga08y16_315654_c1 3300050511 Bacteria 1609
650 nmdc:mga08y16_58622_c1 3300050511 Bacteria 4023
651 nmdc:mga08y16_628_c1 3300050511 Bacteria 33034
652 nmdc:mga0n895_12155_c1 3300050512 Bacteria 7707
653 nmdc:mga0rr50_108079_c1 3300050513 Bacteria 2197
654 nmdc:mga0a205_116355_c1 3300050515 Bacteria 2572
655 nmdc:mga0a205_140078_c1 3300050515 Unclassified 2319
656 nmdc:mga0a205_152000_c1 3300050515 Bacteria 2214
657 nmdc:mga0a205_179278_c1 3300050515 Archaea 2013
658 nmdc:mga0a205_22548_c1 3300050515 Bacteria 5966
659 nmdc:mga0sz30_125708_c1 3300050516 Unclassified 1128
660 Ga0495601_0031606 3300053077 Bacteria 3291
661 Ga0495612_0028017 3300053078 Bacteria 2267
662 Ga0495619_0019836 3300053085 Bacteria 4278
663 Ga0500555_000057 3300053103 Bacteria 56490
664 Ga0500645_000367 3300053730 Bacteria 31808
665 Ga0590074_006632 3300059423 Bacteria 1921
666 Ga0590075_002939 3300059424 Bacteria 4054
667 Ga0590077_000284 3300059426 Bacteria 14374
668 Ga0501082_0094402 3300060353 Bacteria 2585
669 2980182906 2980182181 Bacteria 9454109
670 Ga0070698_100060414
671 JGI24751J29686_10038542
672 rootL2_10219998
673 Ga0065712_10010488
674 Ga0065707_10113683
675 Ga0065707_10209890
676 Ga0070676_10312798
677 Ga0070683_100414827
678 Ga0070683_100577904
679 Ga0070690_100010815
680 Ga0070690_100080178
681 Ga0070690_100379851
682 Ga0070670_100004264
683 Ga0070670_100057421
684 Ga0070677_10025928
685 Ga0070677_10073989
686 Ga0068869_100033035
687 Ga0068869_100168571
688 Ga0068869_100301444
689 Ga0068869_100328211
690 Ga0068869_100501042
691 Ga0070666_10261996
692 Ga0070680_100005183
693 Ga0068868_100291331
694 Ga0070689_100005964
695 Ga0070689_100119132
696 Ga0070689_100293089
697 Ga0070689_100433703
698 Ga0070687_100010125
699 Ga0070661_100225640
700 Ga0070692_10158796
701 Ga0070668_100039031
702 Ga0070669_100005821
703 Ga0070669_100037227
704 Ga0070669_100461617
705 Ga0070675_100201174
706 Ga0070675_100340830
707 Ga0070675_100443907
708 Ga0070671_100005927
709 Ga0070671_100073417
710 Ga0070674_100007747
711 Ga0070674_100045320
712 Ga0070673_100028360
713 Ga0070673_100060306
714 Ga0070673_100078182
715 Ga0070673_100364946
716 Ga0070688_100000808
717 Ga0070688_100058035
718 Ga0070659_100354976
719 Ga0070667_100030191
720 Ga0070667_100057094
721 Ga0070667_100134468
722 Ga0070667_100158846
723 Ga0070667_100179181
724 Ga0070667_100233505
725 Ga0070667_100389117
726 Ga0070667_100620051
727 Ga0070703_10116613
728 Ga0070701_10015076
729 Ga0070701_10019919
730 Ga0070711_100514329
731 Ga0070705_100178871
732 Ga0070705_100192223
733 Ga0070700_100007401
734 Ga0070700_100038062
735 Ga0070700_100050677
736 Ga0070700_100184570
737 Ga0070700_100200414
738 Ga0070694_100006927
739 Ga0070694_100011854
740 Ga0070694_100171409
741 Ga0070694_100264868
742 Ga0070708_100000720
743 Ga0070708_100026382
744 Ga0070708_100238723
745 Ga0070678_100071515
746 Ga0070678_100114834
747 Ga0070662_100016422
748 Ga0070662_100128497
749 Ga0070681_10000458
750 Ga0070681_10007211
751 Ga0070681_10199650
752 Ga0068867_100025433
753 Ga0068867_100031574
754 Ga0068867_100132944
755 Ga0068867_100264216
756 Ga0070685_10071873
757 Ga0070706_100017771
758 Ga0070706_100074991
759 Ga0070706_100099856
760 Ga0070706_100157257
761 Ga0070706_100209733
762 Ga0070706_100249862
763 Ga0070706_100275982
764 Ga0070706_100294966
765 Ga0070707_100000133
766 Ga0070707_100001360
767 Ga0070707_100022998
768 Ga0070707_100038954
769 Ga0070707_100070045
770 Ga0070707_100107657
771 Ga0070707_100136028
772 Ga0070707_100428558
773 Ga0070698_100000060
774 Ga0070698_100001691
775 Ga0070698_100009305
776 Ga0070698_100011198
777 Ga0070698_100012191
778 Ga0070698_100021653
779 Ga0070698_100079888
780 Ga0070698_100116941
781 Ga0070698_100611901
782 Ga0070699_100001008
783 Ga0070699_100044629
784 Ga0070699_100112613
785 Ga0070699_100153602
786 Ga0070699_100209015
787 Ga0070679_100000081
788 Ga0070679_100045165
789 Ga0070697_100000112
790 Ga0070697_100001902
791 Ga0070697_100011647
792 Ga0070697_100061441
793 Ga0070697_100132641
794 Ga0070697_100341026
795 Ga0068853_100005143
796 Ga0068853_100113076
797 Ga0068853_100258500
798 Ga0068853_100355585
799 Ga0070672_100017397
800 Ga0070672_100078075
801 Ga0070672_100097456
802 Ga0070672_100127452
803 Ga0070672_100163738
804 Ga0070672_100304659
805 Ga0070672_100333469
806 Ga0070686_100017575
807 Ga0070686_100031105
808 Ga0070686_100096758
809 Ga0070686_100437082
810 Ga0070695_100044282
811 Ga0070695_100057540
812 Ga0070695_100112055
813 Ga0070696_100017580
814 Ga0070696_100086552
815 Ga0070696_100159906
816 Ga0070696_100360795
817 Ga0070693_100232908
818 Ga0070665_100102689
819 Ga0070665_100215993
820 Ga0070665_100496033
821 Ga0070704_100000895
822 Ga0070704_100016579
823 Ga0070704_100023606
824 Ga0070704_100031991
825 Ga0070704_100230665
826 Ga0070704_100471636
827 Ga0068855_100762523
828 Ga0070664_100097396
829 Ga0070664_100178418
830 Ga0070664_100181496
831 Ga0070664_100653715
832 Ga0068857_100031537
833 Ga0068857_100102202
834 Ga0068857_100133908
835 Ga0068857_100155388
836 Ga0068854_100089363
837 Ga0068854_100178795
838 Ga0068856_100028009
839 Ga0070702_100074210
840 Ga0068852_100154412
841 Ga0068859_100011011
842 Ga0068859_100042552
843 Ga0068859_100043876
844 Ga0068859_100068887
845 Ga0068859_100236011
846 Ga0068859_100458264
847 Ga0068859_101000904
848 Ga0068864_100004110
849 Ga0068864_100061614
850 Ga0068864_100072639
851 Ga0068864_100230859
852 Ga0068864_100239488
853 Ga0068864_100278515
854 Ga0068864_100523501
855 Ga0068864_100779505
856 Ga0068866_10103707
857 Ga0068861_100040685
858 Ga0068861_100150100
859 Ga0068861_100260038
860 Ga0068861_100500614
861 Ga0068851_10271515
862 Ga0068870_10041308
863 Ga0068863_100022847
864 Ga0068863_100037302
865 Ga0068863_100069356
866 Ga0068863_100094745
867 Ga0068863_100191108
868 Ga0068863_100195873
869 Ga0068863_100619592
870 Ga0068863_100884897
871 Ga0068858_100074362
872 Ga0068858_100328985
873 Ga0068858_100583407
874 Ga0068860_100015839
875 Ga0068860_100038985
876 Ga0068860_100040805
877 Ga0068860_100101361
878 Ga0068860_100260958
879 Ga0068860_100778097
880 Ga0068862_100012345
881 Ga0068862_100108209
882 Ga0081539_10005400
883 Ga0075365_10007791
884 Ga0075368_10001890
885 Ga0075368_10012467
886 Ga0075368_10016134
887 Ga0075363_100139701
888 Ga0075364_10289038
889 Ga0070716_100293682
890 Ga0075362_10005837
891 Ga0075367_10003414
892 Ga0075367_10021486
893 Ga0075367_10047837
894 Ga0075367_10066324
895 Ga0075367_10160548
896 Ga0075367_10195365
897 Ga0075366_10004403
898 Ga0075366_10007720
899 Ga0075366_10125602
900 Ga0075366_10126519
901 Ga0097621_100003821
902 Ga0097621_100027276
903 Ga0097621_100029996
904 Ga0097621_100035381
905 Ga0068871_100024451
906 Ga0068871_100185408
907 Ga0068871_100231594
908 Ga0075428_100052997
909 Ga0075428_100056331
910 Ga0075428_100131327
911 Ga0075428_100199713
912 Ga0075428_100440298
913 Ga0075428_100486596
914 Ga0075428_100777829
915 Ga0075431_100001101
916 Ga0075431_100081969
917 Ga0075433_10032712
918 Ga0075433_10069568
919 Ga0075433_10114113
920 Ga0075433_10124118
921 Ga0075433_10156554
922 Ga0075434_100003671
923 Ga0075434_100307457
924 Ga0075429_100038474
925 Ga0075429_100050896
926 Ga0075429_100176761
927 Ga0075429_100399189
928 Ga0068865_100002728
929 Ga0068865_100012665
930 Ga0068865_100090320
931 Ga0097620_100011011
932 Ga0097620_100042549
933 Ga0097620_100043873
934 Ga0097620_100068887
935 Ga0097620_100236045
936 Ga0097620_100458257
937 Ga0097620_101000977
938 Ga0111539_10001456
939 Ga0111539_10395089
940 Ga0105245_10029607
941 Ga0105245_10130593
942 Ga0105245_11003696
943 Ga0105247_10054323
944 Ga0114129_10002021
945 Ga0114129_10003031
946 Ga0114129_10018525
947 Ga0114129_10105945
948 Ga0114129_10111926
949 Ga0114129_10114059
950 Ga0114129_10150552
951 Ga0114129_10188024
952 Ga0114129_10232991
953 Ga0114129_10269535
954 Ga0114129_10285024
955 Ga0114129_10560207
956 Ga0114129_10586235
957 Ga0114129_10660583
958 Ga0114129_11043336
959 Ga0105243_10000187
960 Ga0105243_10015199
961 Ga0105243_10029318
962 Ga0105241_10014753
963 Ga0105241_10107495
964 Ga0105241_10370010
965 Ga0105242_10000008
966 Ga0105242_10006641
967 Ga0105248_10013017
968 Ga0105248_10123297
969 Ga0105248_10128061
970 Ga0105248_10256559
971 Ga0105248_10325774
972 Ga0105248_10402264
973 Ga0105237_10045947
974 Ga0105237_10178565
975 Ga0105237_10467413
976 Ga0105237_10607549
977 Ga0105249_10010661
978 Ga0105249_10050912
979 Ga0105249_10073710
980 Ga0105249_10109826
981 Ga0105249_10139640
982 Ga0105249_10198017
983 Ga0105249_10198426
984 Ga0105249_10340774
985 Ga0105249_10350021
986 Ga0105239_10030026
987 Ga0105239_10190984
988 Ga0105239_10196773
989 Ga0105239_10555121
990 Ga0105239_10709215
991 Ga0157373_10329420
992 Ga0157371_10173771
993 Ga0157370_10074837
994 Ga0157370_10265474
995 Ga0157369_10569669
996 Ga0157374_10008572
997 Ga0157374_10210237
998 Ga0157378_10005014
999 Ga0157378_10006499
1000 Ga0157378_10018168
1001 Ga0157378_10689021
1002 Ga0163162_10004780
1003 Ga0163162_10007623
1004 Ga0163162_10022050
1005 Ga0163162_10093527
1006 Ga0163162_10138843
1007 Ga0163162_10147510
1008 Ga0163162_10347422
1009 Ga0163162_10804619
1010 Ga0157372_10000564
1011 Ga0157372_10086203
1012 Ga0157372_10488115
1013 Ga0157375_10010341
1014 Ga0157375_10153854
1015 Ga0157375_10154711
1016 Ga0157375_10501877
1017 Ga0157375_11071803
1018 Ga0163163_10026788
1019 Ga0163163_10124870
1020 Ga0163163_10137771
1021 Ga0163163_10233234
1022 Ga0163163_10373052
1023 Ga0157380_10001690
1024 Ga0157380_10019779
1025 Ga0157380_10044123
1026 Ga0157380_10355488
1027 Ga0157377_10031372
1028 Ga0157377_10394889
1029 Ga0157379_10184879
1030 Ga0157379_10212961
1031 Ga0157379_10464603
1032 Ga0157379_10618498
1033 Ga0157376_10045048
1034 Ga0157376_10247197
1035 Ga0157376_10390894
1036 Ga0157376_10523699
1037 Ga0163161_10003822
1038 Ga0163161_10048631
1039 Ga0163161_10063437
1040 Ga0163161_10112195
1041 Ga0163161_10118721
1042 Ga0163161_10127102
1043 Ga0213876_10000141
1044 Ga0213876_10000144
1045 Ga0207697_10075496
1046 Ga0207682_10015115
1047 Ga0207682_10095063
1048 Ga0207642_10024242
1049 Ga0207688_10377308
1050 Ga0207680_10232459
1051 Ga0207680_10394657
1052 Ga0207645_10078050
1053 Ga0207645_10120877
1054 Ga0207645_10255680
1055 Ga0207645_10277885
1056 Ga0207643_10041095
1057 Ga0207684_10000371
1058 Ga0207684_10015423
1059 Ga0207684_10034093
1060 Ga0207684_10060257
1061 Ga0207684_10067761
1062 Ga0207684_10124995
1063 Ga0207684_10320192
1064 Ga0207684_10328927
1065 Ga0207684_10476000
1066 Ga0207654_10337037
1067 Ga0207707_10000007
1068 Ga0207707_10000461
1069 Ga0207671_10127343
1070 Ga0207671_10270605
1071 Ga0207660_10000803
1072 Ga0207662_10000398
1073 Ga0207662_10014742
1074 Ga0207662_10392473
1075 Ga0207649_10113886
1076 Ga0207649_10216541
1077 Ga0207652_10000062
1078 Ga0207652_10111520
1079 Ga0207646_10000281
1080 Ga0207646_10001360
1081 Ga0207646_10003496
1082 Ga0207646_10005934
1083 Ga0207646_10017878
1084 Ga0207646_10048236
1085 Ga0207646_10097990
1086 Ga0207646_10384441
1087 Ga0207681_10024116
1088 Ga0207650_10012105
1089 Ga0207650_10015791
1090 Ga0207650_10042265
1091 Ga0207650_10101866
1092 Ga0207659_10043118
1093 Ga0207659_10094749
1094 Ga0207687_10418144
1095 Ga0207644_10021734
1096 Ga0207644_10036437
1097 Ga0207706_10030624
1098 Ga0207706_10192151
1099 Ga0207706_10347830
1100 Ga0207706_10482739
1101 Ga0207686_10000023
1102 Ga0207709_10000062
1103 Ga0207709_10055886
1104 Ga0207709_10284512
1105 Ga0207670_10007494
1106 Ga0207670_10116646
1107 Ga0207670_10443093
1108 Ga0207670_10553634
1109 Ga0207669_10030637
1110 Ga0207669_10239484
1111 Ga0207704_10089047
1112 Ga0207665_10339990
1113 Ga0207691_10007983
1114 Ga0207691_10025966
1115 Ga0207691_10086271
1116 Ga0207691_10349904
1117 Ga0207711_10061643
1118 Ga0207711_10093587
1119 Ga0207711_10102681
1120 Ga0207711_10137539
1121 Ga0207711_10566990
1122 Ga0207689_10131541
1123 Ga0207689_10197795
1124 Ga0207689_10219958
1125 Ga0207689_10590648
1126 Ga0207661_10285640
1127 Ga0207679_10143146
1128 Ga0207679_10149372
1129 Ga0207679_10153636
1130 Ga0207651_10061994
1131 Ga0207651_10065145
1132 Ga0207651_10118845
1133 Ga0207651_10159858
1134 Ga0207651_10313925
1135 Ga0207651_10382166
1136 Ga0207651_10392699
1137 Ga0207712_10004208
1138 Ga0207712_10011708
1139 Ga0207712_10025821
1140 Ga0207712_10055755
1141 Ga0207712_10080217
1142 Ga0207712_10148689
1143 Ga0207712_10339908
1144 Ga0207640_10108206
1145 Ga0207658_10044980
1146 Ga0207658_10105804
1147 Ga0207658_10112389
1148 Ga0207658_10116769
1149 Ga0207658_10327260
1150 Ga0207677_10204570
1151 Ga0207677_10631544
1152 Ga0207703_10125989
1153 Ga0207703_10201119
1154 Ga0207703_10563514
1155 Ga0207703_10592583
1156 Ga0207639_10053338
1157 Ga0207639_10076184
1158 Ga0207639_10195608
1159 Ga0207678_10028834
1160 Ga0207678_10072297
1161 Ga0207708_10013380
1162 Ga0207708_10014089
1163 Ga0207708_10104827
1164 Ga0207708_10141511
1165 Ga0207702_10381475
1166 Ga0207641_10017544
1167 Ga0207641_10141717
1168 Ga0207641_10155772
1169 Ga0207641_10305198
1170 Ga0207641_10382350
1171 Ga0207641_10806597
1172 Ga0207648_10008341
1173 Ga0207648_10065760
1174 Ga0207648_10068148
1175 Ga0207648_10438308
1176 Ga0207676_10047092
1177 Ga0207676_10054014
1178 Ga0207676_10071753
1179 Ga0207676_10074452
1180 Ga0207676_10094041
1181 Ga0207676_10112006
1182 Ga0207676_10348032
1183 Ga0207674_10107084
1184 Ga0207674_10154229
1185 Ga0207675_100050449
1186 Ga0207675_100083699
1187 Ga0207675_100145656
1188 Ga0207675_100150187
1189 Ga0207675_100584000
1190 Ga0207683_10058058
1191 Ga0207683_10311170
1192 Ga0207683_10723031
1193 Ga0209588_1082159
1194 Ga0209813_10010999
1195 Ga0207428_10000139
1196 Ga0207428_10144492
1197 Ga0268266_10090550
1198 Ga0268266_10130918
1199 Ga0268265_10083138
1200 Ga0268265_10097804
1201 Ga0268265_10149826
1202 Ga0268265_10299002
1203 Ga0268264_10008279
1204 Ga0268264_10017131
1205 Ga0268264_10024042
1206 Ga0268264_10144248
1207 Ga0268264_10472500
1208 Ga0268264_10475732
1209 Ga0268264_10587509
1210 Ga0268264_10596310
1211 Ga0307513_10376969
1212 Ga0265314_10005683
1213 Ga0307410_10643868
1214 Ga0307407_10262764
1215 Ga0307409_100118125
1216 Ga0307409_100409234
1217 Ga0307409_100509407
1218 Ga0307416_100320685
1219 Ga0307416_100905185
1220 Ga0307414_10183949
1221 Ga0373948_0070643
1222 Ga0373955_0371978
1223 Ga0373931_0302011
1224 Ga0373933_0028600
1225 Ga0373937_0152114
1226 Ga0373937_0401309
1227 Ga0373925_0030233
1228 Ga0395898_0836652
1229 Ga0395905_0044079
1230 Ga0436365_0255646
1231 Ga0436365_0289912
1232 Ga0450898_006203
1233 Ga0450907_030980
1234 Ga0450908_006750
1235 Ga0451577_0228523
1236 Ga0453683_0380775
1237 Ga0453684_0236799
1238 Ga0453684_0629610
1239 Ga0495608_0413974
1240 Ga0495628_0081228
1241 Ga0495630_0346598
1242 Ga0495668_0000396
1243 Ga0495635_0038445
1244 Ga0495659_0200711
1245 Ga0495669_0111838
1246 Ga0495600_0084243
1247 Ga0495674_0153268
1248 Ga0495674_0443291
1249 Ga0495684_0071933
1250 Ga0496104_0005912
1251 Ga0496104_0016431
1252 Ga0496105_0041469
1253 Ga0496105_0143626
1254 Ga0496106_0222327
1255 Ga0496108_0015830
1256 Ga0496108_0056397
1257 Ga0496108_0120959
1258 Ga0496108_0270852
1259 Ga0496109_0001487
1260 Ga0496110_0028546
1261 Ga0496110_0795797
1262 Ga0496112_0006009
1263 Ga0496113_0007492
1264 Ga0496113_0458192
1265 Ga0496114_0008943
1266 Ga0496114_0245963
1267 Ga0496115_0013522
1268 Ga0496115_0211463
1269 Ga0501036_0025883
1270 Ga0501038_0392911
1271 Ga0501041_0152382
1272 Ga0501042_0419305
1273 Ga0501048_0133796
1274 Ga0501067_0285052
1275 Ga0501068_0130931
1276 Ga0501068_0360043
1277 Ga0501071_0288518
1278 Ga0501075_0081370
1279 Ga0501075_0142864
1280 Ga0501075_0161038
1281 Ga0501080_0594252
1282 Ga0501081_0197596
1283 Ga0501035_0581265
1284 Ga0501045_0133425
1285 nmdc:mga03n38_141383_c1
1286 nmdc:mga00v17_56188_c1
1287 nmdc:mga0k408_20080_c1
1288 nmdc:mga0k408_258010_c1
1289 nmdc:mga0k408_56369_c2
1290 nmdc:mga0k408_6948_c1
1291 nmdc:mga06z11_10604_c1
1292 nmdc:mga06z11_32689_c1
1293 nmdc:mga06z11_33474_c1
1294 nmdc:mga06z11_4585_c1
1295 nmdc:mga06z11_51650_c1
1296 nmdc:mga06z11_56673_c1
1297 nmdc:mga04h51_12908_c1
1298 nmdc:mga07m45_18963_c1
1299 nmdc:mga07m45_55181_c1
1300 nmdc:mga05p37_1012519_c1
1301 nmdc:mga05p37_183707_c1
1302 nmdc:mga05p37_207262_c1
1303 nmdc:mga05p37_28745_c1
1304 nmdc:mga05p37_323537_c1
1305 nmdc:mga05p37_458743_c1
1306 nmdc:mga05p37_62006_c1
1307 nmdc:mga05p37_824728_c1
1308 nmdc:mga05p37_955974_c1
1309 nmdc:mga09592_160803_c1
1310 nmdc:mga09592_59825_c1
1311 nmdc:mga09592_60393_c1
1312 nmdc:mga09592_807_c1
1313 nmdc:mga0qj67_321314_c1
1314 nmdc:mga06r32_1701_c1
1315 nmdc:mga06r32_252431_c1
1316 nmdc:mga06r32_31455_c1
1317 nmdc:mga06r32_51689_c1
1318 nmdc:mga08y16_315654_c1
1319 nmdc:mga08y16_58622_c1
1320 nmdc:mga08y16_628_c1
1321 nmdc:mga0n895_12155_c1
1322 nmdc:mga0rr50_108079_c1
1323 nmdc:mga0a205_116355_c1
1324 nmdc:mga0a205_140078_c1
1325 nmdc:mga0a205_152000_c1
1326 nmdc:mga0a205_179278_c1
1327 nmdc:mga0a205_22548_c1
1328 nmdc:mga0sz30_125708_c1
1329 Ga0495601_0031606
1330 Ga0495612_0028017
1331 Ga0495619_0019836
1332 Ga0500555_000057
1333 Ga0500645_000367
1334 Ga0590074_006632
1335 Ga0590075_002939
1336 Ga0590077_000284
1337 Ga0501082_0094402
1338 2980182906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

34

228

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

279

0.93

PF08659

KR

KR domain

34

216

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yde-assembly3.cif.gz_K crystal structure of human retinal short-chain dehydrogenase/reductase 3 0.9798 2 255
1yde-assembly4.cif.gz_N crystal structure of human retinal short-chain dehydrogenase/reductase 3 0.9721 6 258
6hno-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant s205 - mutant h93a 0.9695 1 256
6emm-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid 0.9683 1 256
1yde-assembly3.cif.gz_K crystal structure of human retinal short-chain dehydrogenase/reductase 3 0.9682 2 255
ID Description Score Start End Superfamily
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9554 1 255 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 3 183 3.40.50.720
5icsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 1 262 3.40.50.720
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 1 255 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 1 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520X369-F1-model_v4 deleted 0.9597 3 185
AF-A0A1F4BCM0-F1-model_v4 3-oxoacyl-ACP reductase 0.9577 1 186 GO:0016491
AF-A0A6N6XI17-F1-model_v4 deleted 0.9566 4 147
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.9564 3 186 GO:0016491
AF-A0A525W518-F1-model_v4 SDR family oxidoreductase 0.9554 1 254

Map