F473925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 366 | 630 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10023732|Ga0207695_100237323 |
| Length | 285 |
| Sequence | VYRGGVLFGTTRTRYTNFDFIVPDGGIKIANFMSDLFSLKGKIALVTGCNKGIGRGMALGLAEAGADIIGVSSSLAPGSSIEKEIKALGRSFSPYQADLTDRTSLYEFIGKVRQENDRIDILMNNAGMILRNPAAQHPDEYWDKVLSINLDAAFILAREFGRDMLTRRSGKIIFTCSLLTFQGGINVPSYAASKGALGSLVKALANEWASQGVNVNGIAPGYISTDNTEALRNDLVRSKSILDRIPAGRWGDPEDFAGPAVFLASKAADYIHGTILTVDGGWMGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 5 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 8 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 9 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 10 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 13 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 14 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 15 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 16 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 17 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 18 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 19 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 20 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 21 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 22 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 23 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 24 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 25 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 26 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 27 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 28 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 29 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 30 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 31 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 32 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 33 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 34 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 35 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 36 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 37 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 38 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 39 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 40 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 41 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 42 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 43 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 44 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 45 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 46 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 47 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 70 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 98 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 99 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 100 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 112 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 222 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 223 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 224 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 225 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 226 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 257 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 258 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 259 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 334 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 352 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 354 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 366 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.31 |
| Metatranscriptomes | 0 |
| Isolates | 5.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.33 |
| Nodule | 0.15 |
| Rhizoplane | 1.05 |
| Rhizosphere | 79.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002393 | 3300001979 | Bacteria | 8536 |
| 2 | JGI24751J29686_10022049 | 3300002459 | Bacteria | 1321 |
| 3 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 4 | JGI25152J39213_1000173 | 3300002773 | Bacteria | 43619 |
| 5 | JGI25150J39212_1000015 | 3300002774 | Bacteria | 170613 |
| 6 | JGI25151J46595_10000043 | 3300003187 | Bacteria | 170613 |
| 7 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 8 | JGI25153J46596_10006198 | 3300003215 | Bacteria | 6117 |
| 9 | JGI25153J46596_10009612 | 3300003215 | Bacteria | 4463 |
| 10 | rootH1_10044602 | 3300003316 | Bacteria | 2470 |
| 11 | rootH2_10004521 | 3300003320 | Bacteria | 39563 |
| 12 | rootH2_10025566 | 3300003320 | Bacteria | 14348 |
| 13 | rootH2_10028784 | 3300003320 | Bacteria | 31504 |
| 14 | rootH2_10115381 | 3300003320 | Bacteria | 6434 |
| 15 | rootH2_10145766 | 3300003320 | Bacteria | 3105 |
| 16 | rootL2_10010741 | 3300003322 | Bacteria | 10957 |
| 17 | rootL2_10022160 | 3300003322 | Bacteria | 3286 |
| 18 | rootL2_10022161 | 3300003322 | Bacteria | 3016 |
| 19 | rootL2_10341458 | 3300003322 | Bacteria | 1719 |
| 20 | rootH1_10002657 | 3300003323 | Bacteria | 5544 |
| 21 | rootH1_10034646 | 3300003323 | Bacteria | 3121 |
| 22 | rootH1_10088863 | 3300003323 | Bacteria | 1751 |
| 23 | rootH1_10100195 | 3300003323 | Bacteria | 3903 |
| 24 | JGI25160J50197_1002338 | 3300003354 | Bacteria | 8869 |
| 25 | JGI25160J50197_1004863 | 3300003354 | Bacteria | 5721 |
| 26 | JGI25160J50197_1006688 | 3300003354 | Bacteria | 4632 |
| 27 | Ga0055535_1004467 | 3300003761 | Bacteria | 3390 |
| 28 | Ga0055542_1002394 | 3300003762 | Bacteria | 6325 |
| 29 | Ga0055529_1000421 | 3300003763 | Bacteria | 43457 |
| 30 | Ga0055536_1000038 | 3300003781 | Bacteria | 133102 |
| 31 | Ga0055528_1001027 | 3300003790 | Bacteria | 18451 |
| 32 | Ga0055530_10000288 | 3300003791 | Bacteria | 45971 |
| 33 | Ga0055530_10004665 | 3300003791 | Bacteria | 6950 |
| 34 | Ga0055531_10000102 | 3300003794 | Bacteria | 92703 |
| 35 | Ga0055531_10040389 | 3300003794 | Bacteria | 1368 |
| 36 | Ga0065165_1000128 | 3300005262 | Bacteria | 129513 |
| 37 | Ga0065714_10064423 | 3300005288 | Bacteria | 257266 |
| 38 | Ga0065704_10095126 | 3300005289 | Bacteria | 2496 |
| 39 | Ga0065704_10182599 | 3300005289 | Bacteria | 1220 |
| 40 | Ga0070658_10039194 | 3300005327 | Bacteria | 3822 |
| 41 | Ga0070676_10216074 | 3300005328 | Bacteria | 1264 |
| 42 | Ga0070676_10271310 | 3300005328 | Bacteria | 1140 |
| 43 | Ga0070683_100038066 | 3300005329 | Bacteria | 4407 |
| 44 | Ga0070683_100120125 | 3300005329 | Bacteria | 2482 |
| 45 | Ga0070683_100159176 | 3300005329 | Bacteria | 2142 |
| 46 | Ga0070690_100313143 | 3300005330 | Bacteria | 1129 |
| 47 | Ga0070670_100002522 | 3300005331 | Bacteria | 15098 |
| 48 | Ga0070677_10018190 | 3300005333 | Bacteria | 2528 |
| 49 | Ga0068869_100007354 | 3300005334 | Bacteria | 7029 |
| 50 | Ga0068869_100099918 | 3300005334 | Bacteria | 2193 |
| 51 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 52 | Ga0070666_10006667 | 3300005335 | Bacteria | 7102 |
| 53 | Ga0070666_10031488 | 3300005335 | Bacteria | 3501 |
| 54 | Ga0070680_100000878 | 3300005336 | Bacteria | 21341 |
| 55 | Ga0070682_100000015 | 3300005337 | Bacteria | 249390 |
| 56 | Ga0070682_100001122 | 3300005337 | Bacteria | 15300 |
| 57 | Ga0068868_100004734 | 3300005338 | Bacteria | 9556 |
| 58 | Ga0068868_100158262 | 3300005338 | Bacteria | 1869 |
| 59 | Ga0068868_100264975 | 3300005338 | Bacteria | 1450 |
| 60 | Ga0068868_100269746 | 3300005338 | Bacteria | 1437 |
| 61 | Ga0070660_100105936 | 3300005339 | Unclassified | 2232 |
| 62 | Ga0070689_100465007 | 3300005340 | Bacteria | 1078 |
| 63 | Ga0070691_10017297 | 3300005341 | Bacteria | 3317 |
| 64 | Ga0070692_10416093 | 3300005345 | Bacteria | 852 |
| 65 | Ga0070668_100061242 | 3300005347 | Bacteria | 2915 |
| 66 | Ga0070668_100333339 | 3300005347 | Bacteria | 1280 |
| 67 | Ga0070668_100637107 | 3300005347 | Bacteria | 935 |
| 68 | Ga0070669_100000011 | 3300005353 | Bacteria | 216544 |
| 69 | Ga0070669_100017262 | 3300005353 | Bacteria | 5148 |
| 70 | Ga0070671_100102928 | 3300005355 | Bacteria | 2396 |
| 71 | Ga0070671_100228278 | 3300005355 | Bacteria | 1580 |
| 72 | Ga0070674_100198630 | 3300005356 | Bacteria | 1547 |
| 73 | Ga0070673_100284812 | 3300005364 | Bacteria | 1450 |
| 74 | Ga0070673_100304793 | 3300005364 | Unclassified | 1403 |
| 75 | Ga0070688_100119306 | 3300005365 | Bacteria | 1764 |
| 76 | Ga0070667_100013413 | 3300005367 | Bacteria | 6774 |
| 77 | Ga0070667_100044613 | 3300005367 | Bacteria | 3724 |
| 78 | Ga0070700_100000102 | 3300005441 | Bacteria | 53719 |
| 79 | Ga0070694_100216474 | 3300005444 | Bacteria | 1435 |
| 80 | Ga0070663_100005807 | 3300005455 | Bacteria | 7372 |
| 81 | Ga0070678_100078718 | 3300005456 | Bacteria | 2491 |
| 82 | Ga0070681_10028566 | 3300005458 | Bacteria | 5608 |
| 83 | Ga0068867_100341318 | 3300005459 | Bacteria | 1247 |
| 84 | Ga0070685_10055087 | 3300005466 | Bacteria | 2310 |
| 85 | Ga0070685_10080154 | 3300005466 | Bacteria | 1955 |
| 86 | Ga0070685_10286675 | 3300005466 | Bacteria | 1104 |
| 87 | Ga0070706_100222188 | 3300005467 | Bacteria | 1763 |
| 88 | Ga0070679_100000398 | 3300005530 | Bacteria | 37016 |
| 89 | Ga0070679_100003316 | 3300005530 | Bacteria | 14753 |
| 90 | Ga0070684_100109828 | 3300005535 | Unclassified | 2472 |
| 91 | Ga0070684_100117227 | 3300005535 | Bacteria | 2393 |
| 92 | Ga0070697_100020693 | 3300005536 | Bacteria | 5207 |
| 93 | Ga0068853_100010927 | 3300005539 | Bacteria | 7359 |
| 94 | Ga0068853_100017299 | 3300005539 | Bacteria | 5952 |
| 95 | Ga0068853_100084456 | 3300005539 | Unclassified | 2782 |
| 96 | Ga0068853_100130161 | 3300005539 | Bacteria | 2252 |
| 97 | Ga0068853_100204968 | 3300005539 | Bacteria | 1796 |
| 98 | Ga0068853_100252884 | 3300005539 | Bacteria | 1617 |
| 99 | Ga0070693_100000650 | 3300005547 | Bacteria | 15328 |
| 100 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 101 | Ga0070665_100000139 | 3300005548 | Bacteria | 135881 |
| 102 | Ga0070704_100014221 | 3300005549 | Bacteria | 4967 |
| 103 | Ga0068855_100029707 | 3300005563 | Bacteria | 6535 |
| 104 | Ga0068855_100077659 | 3300005563 | Bacteria | 3853 |
| 105 | Ga0068855_100138670 | 3300005563 | Unclassified | 2774 |
| 106 | Ga0068855_100224589 | 3300005563 | Bacteria | 2105 |
| 107 | Ga0068855_100259037 | 3300005563 | Bacteria | 1938 |
| 108 | Ga0068857_100001316 | 3300005577 | Bacteria | 19543 |
| 109 | Ga0068857_100078482 | 3300005577 | Bacteria | 2947 |
| 110 | Ga0068854_100381614 | 3300005578 | Bacteria | 1161 |
| 111 | Ga0068856_100097121 | 3300005614 | Bacteria | 2935 |
| 112 | Ga0070702_100071228 | 3300005615 | Bacteria | 2054 |
| 113 | Ga0068852_100001166 | 3300005616 | Bacteria | 17391 |
| 114 | Ga0068852_100002787 | 3300005616 | Bacteria | 12105 |
| 115 | Ga0068852_100009916 | 3300005616 | Bacteria | 7093 |
| 116 | Ga0068852_100026395 | 3300005616 | Bacteria | 4720 |
| 117 | Ga0068852_100036902 | 3300005616 | Bacteria | 4095 |
| 118 | Ga0068859_100000011 | 3300005617 | Bacteria | 309687 |
| 119 | Ga0068859_100013654 | 3300005617 | Bacteria | 8143 |
| 120 | Ga0068859_100039542 | 3300005617 | Bacteria | 4732 |
| 121 | Ga0068859_100067304 | 3300005617 | Bacteria | 3616 |
| 122 | Ga0068864_100009257 | 3300005618 | Bacteria | 8121 |
| 123 | Ga0068864_100201391 | 3300005618 | Bacteria | 1829 |
| 124 | Ga0068864_100480459 | 3300005618 | Unclassified | 1192 |
| 125 | Ga0068866_10276168 | 3300005718 | Bacteria | 1039 |
| 126 | Ga0068861_100379733 | 3300005719 | Bacteria | 1248 |
| 127 | Ga0068851_10012661 | 3300005834 | Bacteria | 3982 |
| 128 | Ga0068863_100005978 | 3300005841 | Bacteria | 11939 |
| 129 | Ga0068863_100017784 | 3300005841 | Bacteria | 6803 |
| 130 | Ga0068863_100052271 | 3300005841 | Bacteria | 3872 |
| 131 | Ga0068858_100046101 | 3300005842 | Bacteria | 4041 |
| 132 | Ga0068858_100169837 | 3300005842 | Bacteria | 2056 |
| 133 | Ga0068858_100461936 | 3300005842 | Bacteria | 1224 |
| 134 | Ga0068860_100000005 | 3300005843 | Bacteria | 472349 |
| 135 | Ga0068860_100001923 | 3300005843 | Bacteria | 21994 |
| 136 | Ga0068860_100002561 | 3300005843 | Bacteria | 19014 |
| 137 | Ga0068860_100003920 | 3300005843 | Bacteria | 15287 |
| 138 | Ga0068860_100488887 | 3300005843 | Bacteria | 1227 |
| 139 | Ga0068860_100662269 | 3300005843 | Bacteria | 1052 |
| 140 | Ga0081455_10003869 | 3300005937 | Bacteria | 17062 |
| 141 | Ga0081540_1020082 | 3300005983 | Bacteria | 4032 |
| 142 | Ga0081539_10003256 | 3300005985 | Bacteria | 20379 |
| 143 | Ga0075366_10050396 | 3300006195 | Bacteria | 2472 |
| 144 | Ga0075366_10106217 | 3300006195 | Bacteria | 1688 |
| 145 | Ga0097621_100002185 | 3300006237 | Bacteria | 13386 |
| 146 | Ga0097621_100637491 | 3300006237 | Bacteria | 977 |
| 147 | Ga0068871_100019766 | 3300006358 | Bacteria | 5146 |
| 148 | Ga0068871_100113091 | 3300006358 | Bacteria | 2286 |
| 149 | Ga0068871_100368432 | 3300006358 | Bacteria | 1274 |
| 150 | Ga0075431_100000720 | 3300006847 | Bacteria | 28520 |
| 151 | Ga0075431_100053263 | 3300006847 | Bacteria | 4172 |
| 152 | Ga0075434_100005109 | 3300006871 | Bacteria | 11916 |
| 153 | Ga0075434_100227180 | 3300006871 | Bacteria | 1886 |
| 154 | Ga0075434_100329091 | 3300006871 | Bacteria | 1548 |
| 155 | Ga0075434_100367612 | 3300006871 | Bacteria | 1459 |
| 156 | Ga0075429_100106113 | 3300006880 | Bacteria | 2454 |
| 157 | Ga0068865_100567849 | 3300006881 | Bacteria | 955 |
| 158 | Ga0097620_100000011 | 3300006931 | Bacteria | 309687 |
| 159 | Ga0097620_100013654 | 3300006931 | Bacteria | 8143 |
| 160 | Ga0097620_100039542 | 3300006931 | Bacteria | 4732 |
| 161 | Ga0097620_100067307 | 3300006931 | Bacteria | 3616 |
| 162 | Ga0105244_10012248 | 3300009036 | Bacteria | 5080 |
| 163 | Ga0105240_10000140 | 3300009093 | Bacteria | 148591 |
| 164 | Ga0105240_10000419 | 3300009093 | Bacteria | 78633 |
| 165 | Ga0105240_10001671 | 3300009093 | Bacteria | 37660 |
| 166 | Ga0105240_10002364 | 3300009093 | Bacteria | 30415 |
| 167 | Ga0105240_10026048 | 3300009093 | Bacteria | 7679 |
| 168 | Ga0105240_10056829 | 3300009093 | Bacteria | 4895 |
| 169 | Ga0105240_10070744 | 3300009093 | Bacteria | 4316 |
| 170 | Ga0105240_10169808 | 3300009093 | Bacteria | 2584 |
| 171 | Ga0105240_10186537 | 3300009093 | Bacteria | 2442 |
| 172 | Ga0105240_10456337 | 3300009093 | Bacteria | 1429 |
| 173 | Ga0105240_10711610 | 3300009093 | Bacteria | 1095 |
| 174 | Ga0105245_10639164 | 3300009098 | Bacteria | 1093 |
| 175 | Ga0105247_10022031 | 3300009101 | Bacteria | 3835 |
| 176 | Ga0114129_10021791 | 3300009147 | Bacteria | 9096 |
| 177 | Ga0105243_10000046 | 3300009148 | Bacteria | 155277 |
| 178 | Ga0105241_10003484 | 3300009174 | Bacteria | 11705 |
| 179 | Ga0105241_10006161 | 3300009174 | Bacteria | 8845 |
| 180 | Ga0105241_10009180 | 3300009174 | Bacteria | 7279 |
| 181 | Ga0105241_10040937 | 3300009174 | Bacteria | 3499 |
| 182 | Ga0105241_10170247 | 3300009174 | Bacteria | 1798 |
| 183 | Ga0105241_10429835 | 3300009174 | Bacteria | 1164 |
| 184 | Ga0105242_10377038 | 3300009176 | Bacteria | 1318 |
| 185 | Ga0105242_11085776 | 3300009176 | Bacteria | 813 |
| 186 | Ga0105248_10665272 | 3300009177 | Bacteria | 1175 |
| 187 | Ga0105237_10000390 | 3300009545 | Bacteria | 62424 |
| 188 | Ga0105237_10002312 | 3300009545 | Bacteria | 23678 |
| 189 | Ga0105237_10011376 | 3300009545 | Bacteria | 9413 |
| 190 | Ga0105237_10022955 | 3300009545 | Bacteria | 6398 |
| 191 | Ga0105237_10067355 | 3300009545 | Bacteria | 3574 |
| 192 | Ga0105237_10103921 | 3300009545 | Bacteria | 2833 |
| 193 | Ga0105238_10010129 | 3300009551 | Bacteria | 9453 |
| 194 | Ga0105238_10029135 | 3300009551 | Bacteria | 5625 |
| 195 | Ga0105238_10070744 | 3300009551 | Bacteria | 3487 |
| 196 | Ga0105238_10083693 | 3300009551 | Bacteria | 3179 |
| 197 | Ga0105249_10084947 | 3300009553 | Bacteria | 2948 |
| 198 | Ga0105249_10111323 | 3300009553 | Unclassified | 2589 |
| 199 | Ga0105239_10000093 | 3300010375 | Bacteria | 125821 |
| 200 | Ga0105239_10002826 | 3300010375 | Bacteria | 21717 |
| 201 | Ga0105239_10006736 | 3300010375 | Bacteria | 13273 |
| 202 | Ga0105239_10061586 | 3300010375 | Bacteria | 4119 |
| 203 | Ga0105239_10081746 | 3300010375 | Bacteria | 3556 |
| 204 | Ga0105239_10119469 | 3300010375 | Unclassified | 2925 |
| 205 | Ga0105239_10145959 | 3300010375 | Bacteria | 2638 |
| 206 | Ga0105239_10147561 | 3300010375 | Bacteria | 2624 |
| 207 | Ga0105246_10022431 | 3300011119 | Bacteria | 4073 |
| 208 | Ga0157371_10000076 | 3300013102 | Bacteria | 161805 |
| 209 | Ga0157371_10003455 | 3300013102 | Bacteria | 14322 |
| 210 | Ga0157370_10003006 | 3300013104 | Bacteria | 20011 |
| 211 | Ga0157370_10003873 | 3300013104 | Bacteria | 17430 |
| 212 | Ga0157370_10007415 | 3300013104 | Bacteria | 11943 |
| 213 | Ga0157370_10034523 | 3300013104 | Bacteria | 4923 |
| 214 | Ga0157370_10042959 | 3300013104 | Bacteria | 4352 |
| 215 | Ga0157370_10083964 | 3300013104 | Bacteria | 2994 |
| 216 | Ga0157370_10104991 | 3300013104 | Bacteria | 2645 |
| 217 | Ga0157370_10170202 | 3300013104 | Unclassified | 2025 |
| 218 | Ga0157370_10194856 | 3300013104 | Bacteria | 1881 |
| 219 | Ga0157370_10307374 | 3300013104 | Bacteria | 1463 |
| 220 | Ga0157369_10000007 | 3300013105 | Bacteria | 402562 |
| 221 | Ga0157369_10000461 | 3300013105 | Bacteria | 54029 |
| 222 | Ga0157369_10061089 | 3300013105 | Bacteria | 4063 |
| 223 | Ga0157369_10124911 | 3300013105 | Bacteria | 2729 |
| 224 | Ga0157369_10167491 | 3300013105 | Bacteria | 2316 |
| 225 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 226 | Ga0157374_10182361 | 3300013296 | Bacteria | 2051 |
| 227 | Ga0157374_11251229 | 3300013296 | Bacteria | 764 |
| 228 | Ga0157378_10045074 | 3300013297 | Bacteria | 3918 |
| 229 | Ga0157378_10055052 | 3300013297 | Bacteria | 3543 |
| 230 | Ga0157378_10182995 | 3300013297 | Bacteria | 1972 |
| 231 | Ga0163162_10000035 | 3300013306 | Bacteria | 147102 |
| 232 | Ga0163162_10005547 | 3300013306 | Bacteria | 12200 |
| 233 | Ga0163162_10031627 | 3300013306 | Bacteria | 5250 |
| 234 | Ga0163162_10079249 | 3300013306 | Bacteria | 3351 |
| 235 | Ga0163162_10096379 | 3300013306 | Bacteria | 3046 |
| 236 | Ga0163162_10251694 | 3300013306 | Bacteria | 1898 |
| 237 | Ga0163162_10540197 | 3300013306 | Unclassified | 1294 |
| 238 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 239 | Ga0157372_10000052 | 3300013307 | Bacteria | 135497 |
| 240 | Ga0157372_10008256 | 3300013307 | Bacteria | 11071 |
| 241 | Ga0157372_10055789 | 3300013307 | Unclassified | 4413 |
| 242 | Ga0157372_10109475 | 3300013307 | Bacteria | 3164 |
| 243 | Ga0157372_10121203 | 3300013307 | Bacteria | 3004 |
| 244 | Ga0157372_10155631 | 3300013307 | Bacteria | 2640 |
| 245 | Ga0157372_11158708 | 3300013307 | Bacteria | 894 |
| 246 | Ga0157375_10000047 | 3300013308 | Bacteria | 141526 |
| 247 | Ga0157375_10192383 | 3300013308 | Bacteria | 2195 |
| 248 | Ga0157375_10245141 | 3300013308 | Bacteria | 1952 |
| 249 | Ga0157375_10268339 | 3300013308 | Bacteria | 1868 |
| 250 | Ga0157375_10349206 | 3300013308 | Bacteria | 1645 |
| 251 | Ga0163163_10189424 | 3300014325 | Bacteria | 2105 |
| 252 | Ga0157380_10511169 | 3300014326 | Bacteria | 1169 |
| 253 | Ga0182008_10000222 | 3300014497 | Bacteria | 44722 |
| 254 | Ga0157376_10001819 | 3300014969 | Bacteria | 14199 |
| 255 | Ga0157376_10002899 | 3300014969 | Bacteria | 11760 |
| 256 | Ga0182006_1000220 | 3300015261 | Bacteria | 55777 |
| 257 | Ga0182006_1000233 | 3300015261 | Bacteria | 52709 |
| 258 | Ga0182006_1087055 | 3300015261 | Bacteria | 1129 |
| 259 | Ga0182007_10000007 | 3300015262 | Bacteria | 376596 |
| 260 | Ga0182005_1000040 | 3300015265 | Bacteria | 151222 |
| 261 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 262 | Ga0163161_10000130 | 3300017792 | Bacteria | 70533 |
| 263 | Ga0163161_10002968 | 3300017792 | Bacteria | 12021 |
| 264 | Ga0163161_10003393 | 3300017792 | Bacteria | 11184 |
| 265 | Ga0213876_10005187 | 3300021384 | Bacteria | 7187 |
| 266 | Ga0209436_101120 | 3300025208 | Bacteria | 9942 |
| 267 | Ga0209258_100356 | 3300025242 | Bacteria | 62716 |
| 268 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 269 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 270 | Ga0209026_1000380 | 3300025250 | Bacteria | 40692 |
| 271 | Ga0209148_1000129 | 3300025254 | Bacteria | 175720 |
| 272 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 273 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 274 | Ga0209673_1000085 | 3300025273 | Bacteria | 215647 |
| 275 | Ga0209130_1002305 | 3300025284 | Bacteria | 9768 |
| 276 | Ga0209675_1022540 | 3300025291 | Bacteria | 1652 |
| 277 | Ga0209676_1000201 | 3300025292 | Bacteria | 133195 |
| 278 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 279 | Ga0209564_1003860 | 3300025295 | Bacteria | 9659 |
| 280 | Ga0209758_1000144 | 3300025297 | Bacteria | 170724 |
| 281 | Ga0209758_1012637 | 3300025297 | Bacteria | 4703 |
| 282 | Ga0209758_1014696 | 3300025297 | Bacteria | 4138 |
| 283 | Ga0209758_1025035 | 3300025297 | Bacteria | 2634 |
| 284 | Ga0209758_1073087 | 3300025297 | Unclassified | 1070 |
| 285 | Ga0209050_1000203 | 3300025298 | Bacteria | 133156 |
| 286 | Ga0209050_1000524 | 3300025298 | Bacteria | 63793 |
| 287 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 288 | Ga0207426_1000261 | 3300025302 | Bacteria | 112697 |
| 289 | Ga0207426_1004611 | 3300025302 | Bacteria | 6638 |
| 290 | Ga0207426_1006919 | 3300025302 | Bacteria | 4822 |
| 291 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 292 | Ga0209257_1005255 | 3300025304 | Bacteria | 9237 |
| 293 | Ga0207655_1056887 | 3300025728 | Bacteria | 1539 |
| 294 | Ga0207682_10015472 | 3300025893 | Unclassified | 2969 |
| 295 | Ga0207710_10008199 | 3300025900 | Bacteria | 4410 |
| 296 | Ga0207680_10000228 | 3300025903 | Bacteria | 27141 |
| 297 | Ga0207647_10065536 | 3300025904 | Bacteria | 2204 |
| 298 | Ga0207705_10482521 | 3300025909 | Bacteria | 962 |
| 299 | Ga0207654_10004675 | 3300025911 | Bacteria | 6924 |
| 300 | Ga0207654_10013126 | 3300025911 | Unclassified | 4257 |
| 301 | Ga0207654_10017743 | 3300025911 | Bacteria | 3726 |
| 302 | Ga0207654_10108666 | 3300025911 | Bacteria | 1721 |
| 303 | Ga0207707_10000722 | 3300025912 | Bacteria | 32676 |
| 304 | Ga0207707_10036114 | 3300025912 | Bacteria | 4321 |
| 305 | Ga0207695_10000027 | 3300025913 | Bacteria | 612456 |
| 306 | Ga0207695_10000164 | 3300025913 | Bacteria | 196777 |
| 307 | Ga0207695_10003547 | 3300025913 | Bacteria | 21861 |
| 308 | Ga0207695_10023732 | 3300025913 | Bacteria | 6921 |
| 309 | Ga0207695_10034360 | 3300025913 | Bacteria | 5515 |
| 310 | Ga0207695_10038685 | 3300025913 | Bacteria | 5133 |
| 311 | Ga0207695_10186053 | 3300025913 | Bacteria | 1996 |
| 312 | Ga0207695_10221885 | 3300025913 | Bacteria | 1797 |
| 313 | Ga0207671_10001247 | 3300025914 | Bacteria | 29996 |
| 314 | Ga0207671_10001635 | 3300025914 | Bacteria | 25501 |
| 315 | Ga0207671_10004939 | 3300025914 | Bacteria | 12506 |
| 316 | Ga0207671_10242774 | 3300025914 | Unclassified | 1415 |
| 317 | Ga0207671_10341463 | 3300025914 | Bacteria | 1186 |
| 318 | Ga0207671_10667057 | 3300025914 | Bacteria | 828 |
| 319 | Ga0207693_10257495 | 3300025915 | Bacteria | 1369 |
| 320 | Ga0207660_10004797 | 3300025917 | Bacteria | 8795 |
| 321 | Ga0207657_10025764 | 3300025919 | Bacteria | 5417 |
| 322 | Ga0207652_10006617 | 3300025921 | Bacteria | 9340 |
| 323 | Ga0207652_10069673 | 3300025921 | Bacteria | 3054 |
| 324 | Ga0207681_10000012 | 3300025923 | Bacteria | 361565 |
| 325 | Ga0207681_10053814 | 3300025923 | Bacteria | 2734 |
| 326 | Ga0207694_10019125 | 3300025924 | Bacteria | 5178 |
| 327 | Ga0207694_10023285 | 3300025924 | Unclassified | 4702 |
| 328 | Ga0207694_10050498 | 3300025924 | Bacteria | 3221 |
| 329 | Ga0207694_10056158 | 3300025924 | Bacteria | 3058 |
| 330 | Ga0207700_10425131 | 3300025928 | Bacteria | 1167 |
| 331 | Ga0207644_10206585 | 3300025931 | Bacteria | 1551 |
| 332 | Ga0207644_10345614 | 3300025931 | Bacteria | 1207 |
| 333 | Ga0207690_10204777 | 3300025932 | Bacteria | 1501 |
| 334 | Ga0207686_10200092 | 3300025934 | Bacteria | 1430 |
| 335 | Ga0207709_10000020 | 3300025935 | Bacteria | 392366 |
| 336 | Ga0207670_10080714 | 3300025936 | Bacteria | 2274 |
| 337 | Ga0207670_10142134 | 3300025936 | Bacteria | 1771 |
| 338 | Ga0207669_10263127 | 3300025937 | Bacteria | 1291 |
| 339 | Ga0207704_10497020 | 3300025938 | Bacteria | 982 |
| 340 | Ga0207691_10137081 | 3300025940 | Bacteria | 2158 |
| 341 | Ga0207691_10461343 | 3300025940 | Unclassified | 1081 |
| 342 | Ga0207689_10009695 | 3300025942 | Bacteria | 8295 |
| 343 | Ga0207689_10115395 | 3300025942 | Bacteria | 2207 |
| 344 | Ga0207689_10151400 | 3300025942 | Bacteria | 1912 |
| 345 | Ga0207661_10157990 | 3300025944 | Bacteria | 1965 |
| 346 | Ga0207667_10002024 | 3300025949 | Bacteria | 25418 |
| 347 | Ga0207667_10063189 | 3300025949 | Bacteria | 3869 |
| 348 | Ga0207667_10144494 | 3300025949 | Bacteria | 2449 |
| 349 | Ga0207667_10177371 | 3300025949 | Bacteria | 2189 |
| 350 | Ga0207667_10401637 | 3300025949 | Bacteria | 1395 |
| 351 | Ga0207651_10063857 | 3300025960 | Bacteria | 2574 |
| 352 | Ga0207651_10297158 | 3300025960 | Bacteria | 1341 |
| 353 | Ga0207712_10009009 | 3300025961 | Bacteria | 6313 |
| 354 | Ga0207712_10016687 | 3300025961 | Bacteria | 4759 |
| 355 | Ga0207668_10043711 | 3300025972 | Bacteria | 3043 |
| 356 | Ga0207668_10592526 | 3300025972 | Bacteria | 965 |
| 357 | Ga0207640_10071765 | 3300025981 | Bacteria | 2333 |
| 358 | Ga0207640_10363459 | 3300025981 | Bacteria | 1167 |
| 359 | Ga0207658_10497426 | 3300025986 | Bacteria | 1085 |
| 360 | Ga0207677_10049146 | 3300026023 | Bacteria | 2844 |
| 361 | Ga0207677_10417611 | 3300026023 | Bacteria | 1142 |
| 362 | Ga0207703_10004767 | 3300026035 | Bacteria | 11059 |
| 363 | Ga0207639_10016287 | 3300026041 | Bacteria | 5255 |
| 364 | Ga0207639_10032202 | 3300026041 | Bacteria | 3858 |
| 365 | Ga0207639_10034683 | 3300026041 | Bacteria | 3731 |
| 366 | Ga0207639_10082848 | 3300026041 | Bacteria | 2544 |
| 367 | Ga0207639_10599231 | 3300026041 | Bacteria | 1016 |
| 368 | Ga0207639_10822897 | 3300026041 | Bacteria | 866 |
| 369 | Ga0207678_10012680 | 3300026067 | Bacteria | 7406 |
| 370 | Ga0207678_10544187 | 3300026067 | Bacteria | 1015 |
| 371 | Ga0207708_10000021 | 3300026075 | Bacteria | 186005 |
| 372 | Ga0207702_10058064 | 3300026078 | Bacteria | 3292 |
| 373 | Ga0207702_10898410 | 3300026078 | Bacteria | 878 |
| 374 | Ga0207641_10000158 | 3300026088 | Bacteria | 96378 |
| 375 | Ga0207641_10006686 | 3300026088 | Bacteria | 9667 |
| 376 | Ga0207648_10847054 | 3300026089 | Bacteria | 853 |
| 377 | Ga0207676_10004127 | 3300026095 | Bacteria | 10254 |
| 378 | Ga0207676_10180655 | 3300026095 | Bacteria | 1847 |
| 379 | Ga0207674_10016794 | 3300026116 | Bacteria | 8002 |
| 380 | Ga0207674_10070485 | 3300026116 | Bacteria | 3515 |
| 381 | Ga0207698_10001210 | 3300026142 | Bacteria | 15065 |
| 382 | Ga0207698_10008221 | 3300026142 | Bacteria | 6582 |
| 383 | Ga0207698_10014430 | 3300026142 | Bacteria | 5251 |
| 384 | Ga0207698_10049231 | 3300026142 | Bacteria | 3206 |
| 385 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 386 | Ga0268266_10004453 | 3300028379 | Bacteria | 13399 |
| 387 | Ga0268265_10472501 | 3300028380 | Bacteria | 1176 |
| 388 | Ga0268264_10000012 | 3300028381 | Bacteria | 521740 |
| 389 | Ga0268264_10009194 | 3300028381 | Bacteria | 8187 |
| 390 | Ga0268264_10031602 | 3300028381 | Bacteria | 4340 |
| 391 | Ga0307517_10157592 | 3300028786 | Bacteria | 1535 |
| 392 | Ga0307517_10196962 | 3300028786 | Bacteria | 1267 |
| 393 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 394 | Ga0265338_10074654 | 3300028800 | Unclassified | 2882 |
| 395 | Ga0307511_10000850 | 3300030521 | Bacteria | 32503 |
| 396 | Ga0316177_1035139 | 3300030731 | Bacteria | 21564 |
| 397 | Ga0316176_1042321 | 3300030732 | Bacteria | 10512 |
| 398 | Ga0316183_1134560 | 3300030742 | Bacteria | 13366 |
| 399 | Ga0316181_1167506 | 3300030744 | Bacteria | 16152 |
| 400 | Ga0316182_1005945 | 3300030745 | Bacteria | 2146 |
| 401 | Ga0265340_10157090 | 3300031247 | Eukaryota | 1035 |
| 402 | Ga0265327_10000488 | 3300031251 | Bacteria | 69809 |
| 403 | Ga0265316_10011620 | 3300031344 | Bacteria | 7928 |
| 404 | Ga0265316_10024806 | 3300031344 | Bacteria | 5013 |
| 405 | Ga0307513_10095002 | 3300031456 | Bacteria | 3024 |
| 406 | Ga0307513_10128438 | 3300031456 | Bacteria | 2485 |
| 407 | Ga0307509_10264318 | 3300031507 | Bacteria | 1493 |
| 408 | Ga0307509_10290943 | 3300031507 | Bacteria | 1388 |
| 409 | Ga0307408_100111614 | 3300031548 | Bacteria | 2101 |
| 410 | Ga0307508_10001227 | 3300031616 | Bacteria | 29288 |
| 411 | Ga0307508_10229940 | 3300031616 | Bacteria | 1453 |
| 412 | Ga0307516_10002277 | 3300031730 | Bacteria | 25890 |
| 413 | Ga0307405_10000037 | 3300031731 | Bacteria | 91045 |
| 414 | Ga0307405_10033941 | 3300031731 | Bacteria | 3032 |
| 415 | Ga0307413_10008102 | 3300031824 | Bacteria | 4935 |
| 416 | Ga0307518_10045018 | 3300031838 | Bacteria | 3210 |
| 417 | Ga0307407_10000025 | 3300031903 | Bacteria | 112811 |
| 418 | Ga0307407_10262336 | 3300031903 | Bacteria | 1189 |
| 419 | Ga0307412_10097081 | 3300031911 | Bacteria | 2076 |
| 420 | Ga0307412_10329066 | 3300031911 | Bacteria | 1219 |
| 421 | Ga0307409_100005817 | 3300031995 | Bacteria | 7154 |
| 422 | Ga0307416_100000068 | 3300032002 | Bacteria | 86974 |
| 423 | Ga0307416_100011062 | 3300032002 | Bacteria | 5998 |
| 424 | Ga0307414_10001935 | 3300032004 | Bacteria | 10717 |
| 425 | Ga0307414_10018687 | 3300032004 | Bacteria | 4275 |
| 426 | Ga0307414_10220546 | 3300032004 | Bacteria | 1557 |
| 427 | Ga0307414_10236412 | 3300032004 | Bacteria | 1510 |
| 428 | Ga0307414_10281480 | 3300032004 | Bacteria | 1398 |
| 429 | Ga0307414_10355908 | 3300032004 | Bacteria | 1258 |
| 430 | Ga0307415_100127958 | 3300032126 | Bacteria | 1917 |
| 431 | Ga0307415_100555413 | 3300032126 | Bacteria | 1014 |
| 432 | Ga0307510_10007660 | 3300033180 | Bacteria | 12874 |
| 433 | Ga0307510_10303575 | 3300033180 | Bacteria | 1058 |
| 434 | Ga0316574_0108115 | 3300035398 | Bacteria | 1782 |
| 435 | Ga0373935_0325288 | 3300035692 | Bacteria | 1092 |
| 436 | Ga0316584_0166051 | 3300036712 | Bacteria | 1639 |
| 437 | Ga0395899_0000844 | 3300037312 | Bacteria | 29507 |
| 438 | Ga0395899_0066596 | 3300037312 | Bacteria | 2644 |
| 439 | Ga0395899_0336844 | 3300037312 | Bacteria | 1012 |
| 440 | Ga0395900_0009771 | 3300037418 | Bacteria | 9831 |
| 441 | Ga0395900_0014052 | 3300037418 | Bacteria | 8175 |
| 442 | Ga0395900_0113365 | 3300037418 | Bacteria | 2783 |
| 443 | Ga0395900_0148325 | 3300037418 | Bacteria | 2398 |
| 444 | Ga0395898_0019394 | 3300037466 | Bacteria | 6922 |
| 445 | Ga0395898_0073271 | 3300037466 | Bacteria | 3308 |
| 446 | Ga0395898_0201687 | 3300037466 | Bacteria | 1899 |
| 447 | Ga0395898_0311010 | 3300037466 | Bacteria | 1503 |
| 448 | Ga0395898_0759827 | 3300037466 | Bacteria | 910 |
| 449 | Ga0395905_0044068 | 3300037471 | Bacteria | 4186 |
| 450 | Ga0395905_0079111 | 3300037471 | Bacteria | 3081 |
| 451 | Ga0395901_0000076 | 3300038443 | Bacteria | 138169 |
| 452 | Ga0395901_0106738 | 3300038443 | Bacteria | 2939 |
| 453 | Ga0395901_0141436 | 3300038443 | Bacteria | 2529 |
| 454 | Ga0395901_0152560 | 3300038443 | Bacteria | 2427 |
| 455 | Ga0395901_0175371 | 3300038443 | Bacteria | 2249 |
| 456 | Ga0395901_0713132 | 3300038443 | Bacteria | 999 |
| 457 | Ga0400489_75466 | 3300039093 | Bacteria | 3083 |
| 458 | Ga0436365_0914891 | 3300039437 | Bacteria | 6129 |
| 459 | Ga0436365_1251897 | 3300039437 | Bacteria | 24739 |
| 460 | Ga0439448_0024166 | 3300042005 | Bacteria | 1899 |
| 461 | Ga0439449_0004582 | 3300042007 | Bacteria | 5343 |
| 462 | Ga0439449_0124594 | 3300042007 | Bacteria | 957 |
| 463 | Ga0439450_023135 | 3300042008 | Bacteria | 1346 |
| 464 | Ga0450898_000822 | 3300042134 | Bacteria | 3845 |
| 465 | Ga0439446_0059122 | 3300042156 | Bacteria | 1157 |
| 466 | Ga0466969_0032078 | 3300044656 | Bacteria | 2672 |
| 467 | Ga0466969_0102706 | 3300044656 | Bacteria | 1344 |
| 468 | Ga0466972_0010933 | 3300044658 | Bacteria | 4555 |
| 469 | Ga0466972_0016536 | 3300044658 | Bacteria | 3688 |
| 470 | Ga0466972_0047289 | 3300044658 | Bacteria | 2081 |
| 471 | Ga0466972_0064704 | 3300044658 | Bacteria | 1750 |
| 472 | Ga0466966_0004496 | 3300044684 | Bacteria | 9200 |
| 473 | Ga0466966_0079420 | 3300044684 | Bacteria | 2045 |
| 474 | Ga0466966_0152009 | 3300044684 | Unclassified | 1411 |
| 475 | Ga0466961_0011577 | 3300044693 | Bacteria | 5639 |
| 476 | Ga0466961_0045589 | 3300044693 | Bacteria | 2805 |
| 477 | Ga0466961_0168574 | 3300044693 | Unclassified | 1362 |
| 478 | Ga0466961_0358031 | 3300044693 | Bacteria | 888 |
| 479 | Ga0466964_0013061 | 3300044706 | Bacteria | 3147 |
| 480 | Ga0466964_0112667 | 3300044706 | Bacteria | 1215 |
| 481 | Ga0453684_0136467 | 3300044712 | Bacteria | 2936 |
| 482 | Ga0453684_0414374 | 3300044712 | Bacteria | 1506 |
| 483 | Ga0466968_0017676 | 3300044735 | Bacteria | 2854 |
| 484 | Ga0466970_0012503 | 3300044765 | Bacteria | 4343 |
| 485 | Ga0466957_0087890 | 3300044842 | Bacteria | 1944 |
| 486 | Ga0466959_0003751 | 3300045049 | Bacteria | 10057 |
| 487 | Ga0466959_0005020 | 3300045049 | Bacteria | 8987 |
| 488 | Ga0466959_0304006 | 3300045049 | Bacteria | 1092 |
| 489 | Ga0466958_0026405 | 3300045836 | Bacteria | 3432 |
| 490 | Ga0466958_0367920 | 3300045836 | Bacteria | 926 |
| 491 | Ga0495627_007447 | 3300046453 | Bacteria | 4191 |
| 492 | Ga0495592_0122497 | 3300046454 | Bacteria | 1827 |
| 493 | Ga0495641_0102548 | 3300046461 | Unclassified | 1276 |
| 494 | Ga0495651_0130455 | 3300046462 | Bacteria | 1835 |
| 495 | Ga0495653_0071695 | 3300046463 | Bacteria | 2589 |
| 496 | Ga0495580_0507971 | 3300046472 | Bacteria | 804 |
| 497 | Ga0495664_0053179 | 3300046477 | Bacteria | 2408 |
| 498 | Ga0495606_0005801 | 3300046507 | Bacteria | 11655 |
| 499 | Ga0495610_0002219 | 3300046512 | Bacteria | 16439 |
| 500 | Ga0495610_0004850 | 3300046512 | Bacteria | 9786 |
| 501 | Ga0495618_0075273 | 3300046514 | Bacteria | 2150 |
| 502 | Ga0495618_0133221 | 3300046514 | Bacteria | 1590 |
| 503 | Ga0495628_0030393 | 3300046516 | Bacteria | 4373 |
| 504 | Ga0495630_0129445 | 3300046517 | Bacteria | 1916 |
| 505 | Ga0495648_0026544 | 3300046524 | Unclassified | 3896 |
| 506 | Ga0495666_0155570 | 3300046526 | Bacteria | 1062 |
| 507 | Ga0495587_0296568 | 3300046536 | Bacteria | 904 |
| 508 | Ga0495645_0001391 | 3300046543 | Bacteria | 16347 |
| 509 | Ga0495645_0028618 | 3300046543 | Bacteria | 4050 |
| 510 | Ga0495633_0000017 | 3300046558 | Bacteria | 249973 |
| 511 | Ga0495633_0012073 | 3300046558 | Bacteria | 4613 |
| 512 | Ga0495667_0177772 | 3300046559 | Bacteria | 1366 |
| 513 | Ga0495656_0182621 | 3300046615 | Bacteria | 1032 |
| 514 | Ga0495668_0001808 | 3300046616 | Bacteria | 19480 |
| 515 | Ga0495634_0021990 | 3300046642 | Bacteria | 4498 |
| 516 | Ga0495611_0000038 | 3300046648 | Bacteria | 100121 |
| 517 | Ga0495611_0099588 | 3300046648 | Unclassified | 1349 |
| 518 | Ga0495625_0084598 | 3300046660 | Bacteria | 2203 |
| 519 | Ga0495613_0005144 | 3300046689 | Bacteria | 9815 |
| 520 | Ga0495613_0032396 | 3300046689 | Bacteria | 3883 |
| 521 | Ga0495600_0046573 | 3300046809 | Bacteria | 2829 |
| 522 | Ga0495600_0150162 | 3300046809 | Bacteria | 1509 |
| 523 | Ga0495674_0016152 | 3300047319 | Bacteria | 6968 |
| 524 | Ga0495674_0142519 | 3300047319 | Bacteria | 2014 |
| 525 | Ga0495672_0004265 | 3300047320 | Bacteria | 11805 |
| 526 | Ga0495680_0165613 | 3300047322 | Bacteria | 1603 |
| 527 | Ga0495680_0270486 | 3300047322 | Bacteria | 1200 |
| 528 | Ga0495687_000243 | 3300047443 | Bacteria | 75026 |
| 529 | Ga0495675_0138570 | 3300047444 | Bacteria | 1509 |
| 530 | Ga0495679_004166 | 3300047446 | Bacteria | 6752 |
| 531 | Ga0495684_0021293 | 3300047471 | Bacteria | 4994 |
| 532 | Ga0495684_0025538 | 3300047471 | Bacteria | 4538 |
| 533 | Ga0495686_0000058 | 3300047472 | Bacteria | 240089 |
| 534 | Ga0495686_0017519 | 3300047472 | Bacteria | 4822 |
| 535 | Ga0496102_0795186 | 3300048905 | Bacteria | 868 |
| 536 | Ga0496103_0195150 | 3300048906 | Bacteria | 1302 |
| 537 | Ga0496104_0418645 | 3300048907 | Bacteria | 1252 |
| 538 | Ga0496105_0035928 | 3300048908 | Bacteria | 4081 |
| 539 | Ga0496106_0010094 | 3300048909 | Bacteria | 6976 |
| 540 | Ga0496112_0758954 | 3300048915 | Bacteria | 896 |
| 541 | Ga0496115_0492952 | 3300048918 | Bacteria | 985 |
| 542 | Ga0496116_0001204 | 3300048919 | Bacteria | 30298 |
| 543 | Ga0496117_0002757 | 3300048920 | Bacteria | 21518 |
| 544 | Ga0496118_0121451 | 3300048921 | Bacteria | 1702 |
| 545 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 546 | Ga0496122_0000561 | 3300048925 | Bacteria | 76046 |
| 547 | Ga0496122_0020542 | 3300048925 | Bacteria | 5958 |
| 548 | Ga0496123_0001189 | 3300048926 | Bacteria | 38315 |
| 549 | Ga0496123_0019831 | 3300048926 | Bacteria | 5280 |
| 550 | Ga0496124_0000508 | 3300048927 | Bacteria | 66913 |
| 551 | Ga0501031_0157671 | 3300049568 | Bacteria | 1484 |
| 552 | Ga0501032_0011617 | 3300049569 | Bacteria | 6316 |
| 553 | Ga0501032_0054008 | 3300049569 | Bacteria | 2705 |
| 554 | Ga0501033_0240003 | 3300049570 | Bacteria | 1286 |
| 555 | Ga0501034_0001100 | 3300049571 | Bacteria | 38025 |
| 556 | Ga0501034_0005663 | 3300049571 | Bacteria | 13592 |
| 557 | Ga0501034_0016302 | 3300049571 | Bacteria | 7628 |
| 558 | Ga0501034_0134743 | 3300049571 | Bacteria | 2451 |
| 559 | Ga0501034_0555672 | 3300049571 | Bacteria | 1057 |
| 560 | Ga0501036_0563249 | 3300049572 | Bacteria | 946 |
| 561 | Ga0501037_0021267 | 3300049573 | Bacteria | 4794 |
| 562 | Ga0501038_0000440 | 3300049574 | Bacteria | 36195 |
| 563 | Ga0501038_0209604 | 3300049574 | Bacteria | 1560 |
| 564 | Ga0501043_0003830 | 3300049579 | Bacteria | 12375 |
| 565 | Ga0501046_0006720 | 3300049580 | Bacteria | 10156 |
| 566 | Ga0501047_0010701 | 3300049581 | Bacteria | 8669 |
| 567 | Ga0501047_0030967 | 3300049581 | Bacteria | 5158 |
| 568 | Ga0501047_0083198 | 3300049581 | Bacteria | 3076 |
| 569 | Ga0501047_0515294 | 3300049581 | Unclassified | 1022 |
| 570 | Ga0501047_0570577 | 3300049581 | Bacteria | 955 |
| 571 | Ga0501048_0542056 | 3300049582 | Bacteria | 835 |
| 572 | Ga0501067_0080868 | 3300049583 | Bacteria | 1801 |
| 573 | Ga0501072_0433818 | 3300049588 | Bacteria | 1041 |
| 574 | Ga0501073_0002013 | 3300049589 | Bacteria | 15173 |
| 575 | Ga0501073_0411181 | 3300049589 | Bacteria | 935 |
| 576 | Ga0501074_0002600 | 3300049590 | Bacteria | 12616 |
| 577 | Ga0501219_000271 | 3300049703 | Bacteria | 9199 |
| 578 | Ga0501225_0035699 | 3300049705 | Bacteria | 1369 |
| 579 | Ga0501079_0044871 | 3300049741 | Bacteria | 3412 |
| 580 | Ga0501080_0018745 | 3300049742 | Bacteria | 6404 |
| 581 | Ga0501080_0181426 | 3300049742 | Bacteria | 1937 |
| 582 | Ga0501080_0406615 | 3300049742 | Unclassified | 1224 |
| 583 | Ga0501083_0003280 | 3300049744 | Bacteria | 11303 |
| 584 | Ga0501083_0012750 | 3300049744 | Bacteria | 5878 |
| 585 | Ga0501241_000065 | 3300049758 | Bacteria | 26175 |
| 586 | Ga0501035_0002949 | 3300049822 | Bacteria | 16363 |
| 587 | Ga0501035_0079018 | 3300049822 | Bacteria | 2906 |
| 588 | Ga0501035_0336413 | 3300049822 | Bacteria | 1266 |
| 589 | Ga0501044_0028667 | 3300049823 | Bacteria | 5875 |
| 590 | Ga0501044_0045316 | 3300049823 | Bacteria | 4557 |
| 591 | Ga0501044_0124154 | 3300049823 | Bacteria | 2580 |
| 592 | Ga0501044_0164390 | 3300049823 | Bacteria | 2194 |
| 593 | Ga0501044_0224147 | 3300049823 | Bacteria | 1830 |
| 594 | Ga0501044_0330125 | 3300049823 | Bacteria | 1448 |
| 595 | Ga0501044_0474163 | 3300049823 | Bacteria | 1155 |
| 596 | nmdc:mga0k408_83018_c1 | 3300050493 | Bacteria | 1878 |
| 597 | nmdc:mga05p37_5997_c1 | 3300050507 | Bacteria | 14305 |
| 598 | nmdc:mga09592_13372_c1 | 3300050508 | Bacteria | 6702 |
| 599 | nmdc:mga0qj67_90651_c1 | 3300050509 | Bacteria | 2456 |
| 600 | nmdc:mga08y16_216972_c1 | 3300050511 | Bacteria | 1981 |
| 601 | nmdc:mga0n895_174419_c1 | 3300050512 | Bacteria | 2181 |
| 602 | nmdc:mga0n895_4449_c1 | 3300050512 | Bacteria | 11512 |
| 603 | nmdc:mga0n895_80619_c1 | 3300050512 | Bacteria | 3243 |
| 604 | Ga0500644_0002591 | 3300053088 | Bacteria | 4516 |
| 605 | Ga0500644_0071148 | 3300053088 | Bacteria | 1254 |
| 606 | Ga0500583_0015747 | 3300053092 | Unclassified | 3001 |
| 607 | Ga0500651_0051214 | 3300053093 | Bacteria | 2589 |
| 608 | Ga0500651_0183181 | 3300053093 | Bacteria | 1243 |
| 609 | Ga0500566_0168173 | 3300053094 | Bacteria | 1136 |
| 610 | Ga0500569_000396 | 3300053109 | Bacteria | 7076 |
| 611 | Ga0500618_017751 | 3300053125 | Bacteria | 1767 |
| 612 | Ga0500642_0010291 | 3300053130 | Unclassified | 3292 |
| 613 | Ga0500658_0000574 | 3300053134 | Bacteria | 15463 |
| 614 | Ga0500559_0033862 | 3300053136 | Bacteria | 2201 |
| 615 | Ga0500559_0144518 | 3300053136 | Bacteria | 1115 |
| 616 | Ga0500577_0001248 | 3300053142 | Bacteria | 6501 |
| 617 | Ga0500588_0002432 | 3300053146 | Bacteria | 3782 |
| 618 | Ga0500588_0127783 | 3300053146 | Unclassified | 902 |
| 619 | Ga0500590_087079 | 3300053148 | Bacteria | 1523 |
| 620 | Ga0500616_0003565 | 3300053153 | Bacteria | 11787 |
| 621 | Ga0500616_0009931 | 3300053153 | Bacteria | 5729 |
| 622 | Ga0500622_0000059 | 3300053156 | Bacteria | 134223 |
| 623 | Ga0500622_0012858 | 3300053156 | Bacteria | 4523 |
| 624 | Ga0500633_0000453 | 3300053160 | Bacteria | 6464 |
| 625 | Ga0500636_0120446 | 3300053177 | Bacteria | 1473 |
| 626 | Ga0501084_0169257 | 3300054114 | Bacteria | 1844 |
| 627 | Ga0501084_0471611 | 3300054114 | Bacteria | 1061 |
| 628 | Ga0501082_0108575 | 3300060353 | Bacteria | 2401 |
| 629 | Ga0501082_0369824 | 3300060353 | Bacteria | 1251 |
| 630 | Ga0501082_0503307 | 3300060353 | Bacteria | 1059 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005615 | Ga0070702_100071228 | Ga0070702_1000712282 | 199 |
| 2 | 3300006871 | Ga0075434_100227180 | Ga0075434_1002271802 | 199 |
| 3 | 3300050512 | nmdc:mga0n895_174419_c1 | nmdc:mga0n895_174419_c1_493_1185 | 199 |
| 4 | 3300005335 | Ga0070666_10006667 | Ga0070666_100066675 | 202 |
| 5 | 3300005329 | Ga0070683_100120125 | Ga0070683_1001201252 | 203 |
| 6 | 3300005330 | Ga0070690_100313143 | Ga0070690_1003131432 | 205 |
| 7 | 3300013308 | Ga0157375_10349206 | Ga0157375_103492062 | 205 |
| 8 | 3300060353 | Ga0501082_0503307 | Ga0501082_0503307_301_993 | 208 |
| 9 | 3300050511 | nmdc:mga08y16_216972_c1 | nmdc:mga08y16_216972_c1_1153_1935 | 210 |
| 10 | 3300005441 | Ga0070700_100000102 | Ga0070700_1000001022 | 215 |
| 11 | 3300026075 | Ga0207708_10000021 | Ga0207708_10000021134 | 215 |
| 12 | 3300005345 | Ga0070692_10416093 | Ga0070692_104160931 | 216 |
| 13 | 3300025915 | Ga0207693_10257495 | Ga0207693_102574952 | 216 |
| 14 | 3300025928 | Ga0207700_10425131 | Ga0207700_104251312 | 216 |
| 15 | 3300013296 | Ga0157374_11251229 | Ga0157374_112512291 | 218 |
| 16 | 3300025936 | Ga0207670_10080714 | Ga0207670_100807142 | 218 |
| 17 | 3300005337 | Ga0070682_100000015 | Ga0070682_100000015142 | 219 |
| 18 | 3300026089 | Ga0207648_10847054 | Ga0207648_108470541 | 219 |
| 19 | 3300005842 | Ga0068858_100169837 | Ga0068858_1001698371 | 220 |
| 20 | 3300038443 | Ga0395901_0175371 | Ga0395901_0175371_19_708 | 220 |
| 21 | 3300044693 | Ga0466961_0358031 | Ga0466961_0358031_11_700 | 220 |
| 22 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006114 | 221 |
| 23 | 3300013296 | Ga0157374_10182361 | Ga0157374_101823612 | 221 |
| 24 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010194 | 221 |
| 25 | 3300031616 | Ga0307508_10001227 | Ga0307508_1000122714 | 221 |
| 26 | 3300046472 | Ga0495580_0507971 | Ga0495580_0507971_76_768 | 221 |
| 27 | 3300048905 | Ga0496102_0795186 | Ga0496102_0795186_63_794 | 221 |
| 28 | 3300053146 | Ga0500588_0127783 | Ga0500588_0127783_170_862 | 221 |
| 29 | iso_pu_bacteria | 2710264753 | 2710605218 | 221 |
| 30 | 3300005347 | Ga0070668_100637107 | Ga0070668_1006371071 | 222 |
| 31 | 3300005365 | Ga0070688_100119306 | Ga0070688_1001193062 | 222 |
| 32 | 3300005466 | Ga0070685_10055087 | Ga0070685_100550872 | 222 |
| 33 | 3300025972 | Ga0207668_10592526 | Ga0207668_105925261 | 222 |
| 34 | 3300028379 | Ga0268266_10004453 | Ga0268266_1000445310 | 222 |
| 35 | 3300049744 | Ga0501083_0003280 | Ga0501083_0003280_673_1407 | 222 |
| 36 | 3300005353 | Ga0070669_100000011 | Ga0070669_10000001199 | 223 |
| 37 | 3300006871 | Ga0075434_100367612 | Ga0075434_1003676122 | 223 |
| 38 | 3300025923 | Ga0207681_10000012 | Ga0207681_10000012188 | 223 |
| 39 | 3300026078 | Ga0207702_10898410 | Ga0207702_108984101 | 223 |
| 40 | 3300050512 | nmdc:mga0n895_80619_c1 | nmdc:mga0n895_80619_c1_2184_2951 | 223 |
| 41 | 3300006881 | Ga0068865_100567849 | Ga0068865_1005678492 | 225 |
| 42 | 3300025938 | Ga0207704_10497020 | Ga0207704_104970201 | 225 |
| 43 | 3300005548 | Ga0070665_100000139 | Ga0070665_100000139130 | 227 |
| 44 | 3300031344 | Ga0265316_10024806 | Ga0265316_100248064 | 227 |
| 45 | 3300037466 | Ga0395898_0073271 | Ga0395898_0073271_2294_3049 | 227 |
| 46 | 3300031344 | Ga0265316_10011620 | Ga0265316_100116205 | 228 |
| 47 | 3300048907 | Ga0496104_0418645 | Ga0496104_0418645_414_1169 | 229 |
| 48 | 3300003354 | JGI25160J50197_1006688 | JGI25160J50197_10066884 | 230 |
| 49 | 3300005328 | Ga0070676_10216074 | Ga0070676_102160742 | 230 |
| 50 | 3300005549 | Ga0070704_100014221 | Ga0070704_1000142213 | 230 |
| 51 | 3300005617 | Ga0068859_100000011 | Ga0068859_10000001193 | 230 |
| 52 | 3300006931 | Ga0097620_100000011 | Ga0097620_100000011160 | 230 |
| 53 | 3300009174 | Ga0105241_10040937 | Ga0105241_100409372 | 230 |
| 54 | 3300025208 | Ga0209436_101120 | Ga0209436_1011202 | 230 |
| 55 | 3300025284 | Ga0209130_1002305 | Ga0209130_10023057 | 230 |
| 56 | 3300025302 | Ga0207426_1000057 | Ga0207426_1000057225 | 230 |
| 57 | 3300025942 | Ga0207689_10151400 | Ga0207689_101514002 | 230 |
| 58 | 3300025944 | Ga0207661_10157990 | Ga0207661_101579902 | 230 |
| 59 | 3300025949 | Ga0207667_10144494 | Ga0207667_101444941 | 230 |
| 60 | 3300048908 | Ga0496105_0035928 | Ga0496105_0035928_1844_2599 | 230 |
| 61 | 3300009177 | Ga0105248_10665272 | Ga0105248_106652722 | 231 |
| 62 | 3300047446 | Ga0495679_004166 | Ga0495679_004166_3378_4124 | 231 |
| 63 | 3300048925 | Ga0496122_0000561 | Ga0496122_0000561_47008_47781 | 232 |
| 64 | 3300048926 | Ga0496123_0001189 | Ga0496123_0001189_110_883 | 232 |
| 65 | 3300048927 | Ga0496124_0000508 | Ga0496124_0000508_28285_29058 | 232 |
| 66 | 3300053156 | Ga0500622_0000059 | Ga0500622_0000059_86712_87479 | 232 |
| 67 | 3300005327 | Ga0070658_10039194 | Ga0070658_100391943 | 233 |
| 68 | 3300006871 | Ga0075434_100005109 | Ga0075434_10000510912 | 233 |
| 69 | 3300013308 | Ga0157375_10000047 | Ga0157375_1000004740 | 233 |
| 70 | 3300050512 | nmdc:mga0n895_4449_c1 | nmdc:mga0n895_4449_c1_9302_10069 | 233 |
| 71 | 3300005985 | Ga0081539_10003256 | Ga0081539_100032566 | 234 |
| 72 | 3300013306 | Ga0163162_10079249 | Ga0163162_100792493 | 234 |
| 73 | 3300026067 | Ga0207678_10544187 | Ga0207678_105441871 | 234 |
| 74 | 3300003794 | Ga0055531_10000102 | Ga0055531_1000010274 | 235 |
| 75 | 3300010375 | Ga0105239_10081746 | Ga0105239_100817461 | 235 |
| 76 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041277 | 235 |
| 77 | 3300003323 | rootH1_10002657 | rootH1_100026574 | 236 |
| 78 | 3300003763 | Ga0055529_1000421 | Ga0055529_100042133 | 236 |
| 79 | 3300006847 | Ga0075431_100000720 | Ga0075431_1000007206 | 236 |
| 80 | 3300006880 | Ga0075429_100106113 | Ga0075429_1001061132 | 236 |
| 81 | 3300025272 | Ga0209455_1000026 | Ga0209455_1000026249 | 236 |
| 82 | 3300037312 | Ga0395899_0066596 | Ga0395899_0066596_1196_1951 | 236 |
| 83 | 3300037418 | Ga0395900_0014052 | Ga0395900_0014052_6225_6980 | 236 |
| 84 | 3300037471 | Ga0395905_0079111 | Ga0395905_0079111_301_1056 | 236 |
| 85 | 3300039437 | Ga0436365_0914891 | Ga0436365_0914891_331_1092 | 236 |
| 86 | 3300044706 | Ga0466964_0112667 | Ga0466964_0112667_162_917 | 236 |
| 87 | 3300045836 | Ga0466958_0367920 | Ga0466958_0367920_90_845 | 236 |
| 88 | 3300049823 | Ga0501044_0224147 | Ga0501044_0224147_797_1513 | 236 |
| 89 | 3300050508 | nmdc:mga09592_13372_c1 | nmdc:mga09592_13372_c1_783_1559 | 236 |
| 90 | 3300005329 | Ga0070683_100159176 | Ga0070683_1001591762 | 237 |
| 91 | 3300005444 | Ga0070694_100216474 | Ga0070694_1002164741 | 237 |
| 92 | 3300005536 | Ga0070697_100020693 | Ga0070697_1000206932 | 237 |
| 93 | 3300009093 | Ga0105240_10711610 | Ga0105240_107116101 | 237 |
| 94 | 3300009147 | Ga0114129_10021791 | Ga0114129_100217916 | 237 |
| 95 | 3300014326 | Ga0157380_10511169 | Ga0157380_105111692 | 237 |
| 96 | 3300038443 | Ga0395901_0000076 | Ga0395901_0000076_46569_47324 | 237 |
| 97 | 3300044684 | Ga0466966_0079420 | Ga0466966_0079420_1093_1875 | 237 |
| 98 | 3300046615 | Ga0495656_0182621 | Ga0495656_0182621_116_895 | 237 |
| 99 | 3300049822 | Ga0501035_0002949 | Ga0501035_0002949_14020_14775 | 237 |
| 100 | 3300050507 | nmdc:mga05p37_5997_c1 | nmdc:mga05p37_5997_c1_4072_4851 | 237 |
| 101 | iso_pu_bacteria | 2818991460 | 2819677872 | 237 |
| 102 | iso_pu_bacteria | 2855683550 | 2855686693 | 237 |
| 103 | iso_pu_bacteria | 2947224130 | 2947224259 | 237 |
| 104 | iso_pu_bacteria | 8003830390 | 8003834958 | 237 |
| 105 | 3300005334 | Ga0068869_100099918 | Ga0068869_1000999183 | 238 |
| 106 | 3300005843 | Ga0068860_100001923 | Ga0068860_1000019238 | 238 |
| 107 | 3300025942 | Ga0207689_10115395 | Ga0207689_101153953 | 238 |
| 108 | 3300032004 | Ga0307414_10281480 | Ga0307414_102814802 | 238 |
| 109 | iso_pu_bacteria | 2585427687 | 2586211134 | 238 |
| 110 | iso_pu_bacteria | 2738541302 | 2738856421 | 238 |
| 111 | iso_pu_bacteria | 2739367651 | 2739589257 | 238 |
| 112 | iso_pu_bacteria | 2739367663 | 2739647009 | 238 |
| 113 | iso_pu_bacteria | 2818991437 | 2819546831 | 238 |
| 114 | iso_pu_bacteria | 2842722452 | 2842725535 | 238 |
| 115 | iso_pu_bacteria | 2842909656 | 2842914682 | 238 |
| 116 | iso_pu_bacteria | 2849281842 | 2849283241 | 238 |
| 117 | iso_pu_bacteria | 2857627736 | 2857631426 | 238 |
| 118 | iso_pu_bacteria | 2904445276 | 2904447002 | 238 |
| 119 | iso_pu_bacteria | 2914759650 | 2914760425 | 238 |
| 120 | iso_pu_bacteria | 2945997725 | 2946002558 | 238 |
| 121 | iso_pu_bacteria | 2954016120 | 2954019396 | 238 |
| 122 | iso_pu_bacteria | 8003151029 | 8003151329 | 238 |
| 123 | 3300005289 | Ga0065704_10095126 | Ga0065704_100951261 | 239 |
| 124 | 3300005937 | Ga0081455_10003869 | Ga0081455_100038695 | 239 |
| 125 | 3300006847 | Ga0075431_100053263 | Ga0075431_1000532633 | 239 |
| 126 | 3300009093 | Ga0105240_10456337 | Ga0105240_104563372 | 239 |
| 127 | 3300009148 | Ga0105243_10000046 | Ga0105243_10000046101 | 239 |
| 128 | 3300009176 | Ga0105242_11085776 | Ga0105242_110857761 | 239 |
| 129 | 3300010375 | Ga0105239_10147561 | Ga0105239_101475613 | 239 |
| 130 | 3300013104 | Ga0157370_10003006 | Ga0157370_100030063 | 239 |
| 131 | 3300013104 | Ga0157370_10104991 | Ga0157370_101049913 | 239 |
| 132 | 3300015682 | Ga0183373_1001 | Ga0183373_1001116 | 239 |
| 133 | 3300025297 | Ga0209758_1073087 | Ga0209758_10730872 | 239 |
| 134 | 3300025932 | Ga0207690_10204777 | Ga0207690_102047772 | 239 |
| 135 | 3300025935 | Ga0207709_10000020 | Ga0207709_10000020241 | 239 |
| 136 | 3300031251 | Ga0265327_10000488 | Ga0265327_100004888 | 239 |
| 137 | 3300031548 | Ga0307408_100111614 | Ga0307408_1001116142 | 239 |
| 138 | 3300031731 | Ga0307405_10033941 | Ga0307405_100339412 | 239 |
| 139 | 3300032002 | Ga0307416_100011062 | Ga0307416_1000110626 | 239 |
| 140 | 3300032126 | Ga0307415_100127958 | Ga0307415_1001279582 | 239 |
| 141 | 3300037312 | Ga0395899_0336844 | Ga0395899_0336844_13_768 | 239 |
| 142 | 3300037466 | Ga0395898_0759827 | Ga0395898_0759827_24_779 | 239 |
| 143 | 3300037471 | Ga0395905_0044068 | Ga0395905_0044068_554_1309 | 239 |
| 144 | 3300038443 | Ga0395901_0152560 | Ga0395901_0152560_1628_2383 | 239 |
| 145 | 3300038443 | Ga0395901_0713132 | Ga0395901_0713132_14_769 | 239 |
| 146 | 3300042005 | Ga0439448_0024166 | Ga0439448_0024166_120_875 | 239 |
| 147 | 3300042008 | Ga0439450_023135 | Ga0439450_023135_98_853 | 239 |
| 148 | 3300044712 | Ga0453684_0136467 | Ga0453684_0136467_1435_2211 | 239 |
| 149 | 3300048906 | Ga0496103_0195150 | Ga0496103_0195150_433_1188 | 239 |
| 150 | 3300048909 | Ga0496106_0010094 | Ga0496106_0010094_999_1754 | 239 |
| 151 | 3300048915 | Ga0496112_0758954 | Ga0496112_0758954_16_771 | 239 |
| 152 | 3300048918 | Ga0496115_0492952 | Ga0496115_0492952_194_949 | 239 |
| 153 | 3300048919 | Ga0496116_0001204 | Ga0496116_0001204_20138_20908 | 239 |
| 154 | 3300048920 | Ga0496117_0002757 | Ga0496117_0002757_18444_19214 | 239 |
| 155 | 3300048921 | Ga0496118_0121451 | Ga0496118_0121451_901_1671 | 239 |
| 156 | 3300048925 | Ga0496122_0020542 | Ga0496122_0020542_481_1251 | 239 |
| 157 | 3300048926 | Ga0496123_0019831 | Ga0496123_0019831_2226_2996 | 239 |
| 158 | 3300049581 | Ga0501047_0515294 | Ga0501047_0515294_47_808 | 239 |
| 159 | 3300049582 | Ga0501048_0542056 | Ga0501048_0542056_58_813 | 239 |
| 160 | 3300050509 | nmdc:mga0qj67_90651_c1 | nmdc:mga0qj67_90651_c1_467_1237 | 239 |
| 161 | 3300053153 | Ga0500616_0009931 | Ga0500616_0009931_4132_4893 | 239 |
| 162 | 3300054114 | Ga0501084_0169257 | Ga0501084_0169257_1061_1816 | 239 |
| 163 | iso_pu_bacteria | 2739367656 | 2739614285 | 239 |
| 164 | iso_pu_bacteria | 2816332139 | 2816503455 | 239 |
| 165 | iso_pu_bacteria | 2818991442 | 2819572115 | 239 |
| 166 | iso_pu_bacteria | 2821136567 | 2821141642 | 239 |
| 167 | iso_pu_bacteria | 2890737413 | 2890738699 | 239 |
| 168 | iso_pu_bacteria | 2904467357 | 2904469944 | 239 |
| 169 | iso_pu_bacteria | 2929239360 | 2929245250 | 239 |
| 170 | 3300002459 | JGI24751J29686_10022049 | JGI24751J29686_100220492 | 240 |
| 171 | 3300002773 | JGI25152J39213_1000173 | JGI25152J39213_100017310 | 240 |
| 172 | 3300002774 | JGI25150J39212_1000015 | JGI25150J39212_1000015122 | 240 |
| 173 | 3300003187 | JGI25151J46595_10000043 | JGI25151J46595_1000004310 | 240 |
| 174 | 3300003215 | JGI25153J46596_10000009 | JGI25153J46596_10000009263 | 240 |
| 175 | 3300003316 | rootH1_10044602 | rootH1_100446022 | 240 |
| 176 | 3300003320 | rootH2_10145766 | rootH2_101457662 | 240 |
| 177 | 3300003781 | Ga0055536_1000038 | Ga0055536_10000389 | 240 |
| 178 | 3300003791 | Ga0055530_10004665 | Ga0055530_100046652 | 240 |
| 179 | 3300005288 | Ga0065714_10064423 | Ga0065714_10064423185 | 240 |
| 180 | 3300005289 | Ga0065704_10182599 | Ga0065704_101825992 | 240 |
| 181 | 3300005331 | Ga0070670_100002522 | Ga0070670_10000252215 | 240 |
| 182 | 3300005539 | Ga0068853_100130161 | Ga0068853_1001301612 | 240 |
| 183 | 3300005539 | Ga0068853_100204968 | Ga0068853_1002049682 | 240 |
| 184 | 3300005539 | Ga0068853_100252884 | Ga0068853_1002528843 | 240 |
| 185 | 3300005563 | Ga0068855_100138670 | Ga0068855_1001386702 | 240 |
| 186 | 3300005577 | Ga0068857_100078482 | Ga0068857_1000784824 | 240 |
| 187 | 3300005578 | Ga0068854_100381614 | Ga0068854_1003816142 | 240 |
| 188 | 3300005718 | Ga0068866_10276168 | Ga0068866_102761682 | 240 |
| 189 | 3300005719 | Ga0068861_100379733 | Ga0068861_1003797331 | 240 |
| 190 | 3300005843 | Ga0068860_100488887 | Ga0068860_1004888872 | 240 |
| 191 | 3300009036 | Ga0105244_10012248 | Ga0105244_100122483 | 240 |
| 192 | 3300009553 | Ga0105249_10111323 | Ga0105249_101113233 | 240 |
| 193 | 3300011119 | Ga0105246_10022431 | Ga0105246_100224312 | 240 |
| 194 | 3300013102 | Ga0157371_10000076 | Ga0157371_100000769 | 240 |
| 195 | 3300013104 | Ga0157370_10003873 | Ga0157370_100038735 | 240 |
| 196 | 3300013104 | Ga0157370_10042959 | Ga0157370_100429591 | 240 |
| 197 | 3300013105 | Ga0157369_10000007 | Ga0157369_10000007234 | 240 |
| 198 | 3300013306 | Ga0163162_10000035 | Ga0163162_1000003596 | 240 |
| 199 | 3300013306 | Ga0163162_10251694 | Ga0163162_102516942 | 240 |
| 200 | 3300013307 | Ga0157372_10109475 | Ga0157372_101094753 | 240 |
| 201 | 3300013308 | Ga0157375_10245141 | Ga0157375_102451412 | 240 |
| 202 | 3300014497 | Ga0182008_10000222 | Ga0182008_1000022240 | 240 |
| 203 | 3300015261 | Ga0182006_1000220 | Ga0182006_100022015 | 240 |
| 204 | 3300015261 | Ga0182006_1000233 | Ga0182006_100023325 | 240 |
| 205 | 3300015261 | Ga0182006_1087055 | Ga0182006_10870551 | 240 |
| 206 | 3300015262 | Ga0182007_10000007 | Ga0182007_10000007102 | 240 |
| 207 | 3300017792 | Ga0163161_10000130 | Ga0163161_1000013032 | 240 |
| 208 | 3300017792 | Ga0163161_10002968 | Ga0163161_100029687 | 240 |
| 209 | 3300017792 | Ga0163161_10003393 | Ga0163161_100033935 | 240 |
| 210 | 3300025245 | Ga0207425_1000023 | Ga0207425_1000023261 | 240 |
| 211 | 3300025258 | Ga0209129_1000032 | Ga0209129_100003211 | 240 |
| 212 | 3300025292 | Ga0209676_1000201 | Ga0209676_100020192 | 240 |
| 213 | 3300025294 | Ga0209025_1000047 | Ga0209025_100004711 | 240 |
| 214 | 3300025297 | Ga0209758_1000144 | Ga0209758_1000144119 | 240 |
| 215 | 3300025298 | Ga0209050_1000203 | Ga0209050_100020392 | 240 |
| 216 | 3300025728 | Ga0207655_1056887 | Ga0207655_10568872 | 240 |
| 217 | 3300025949 | Ga0207667_10401637 | Ga0207667_104016371 | 240 |
| 218 | 3300025961 | Ga0207712_10016687 | Ga0207712_100166873 | 240 |
| 219 | 3300025981 | Ga0207640_10363459 | Ga0207640_103634591 | 240 |
| 220 | 3300026041 | Ga0207639_10034683 | Ga0207639_100346834 | 240 |
| 221 | 3300026041 | Ga0207639_10822897 | Ga0207639_108228971 | 240 |
| 222 | 3300026116 | Ga0207674_10070485 | Ga0207674_100704853 | 240 |
| 223 | 3300031731 | Ga0307405_10000037 | Ga0307405_1000003757 | 240 |
| 224 | 3300031903 | Ga0307407_10000025 | Ga0307407_1000002547 | 240 |
| 225 | 3300031995 | Ga0307409_100005817 | Ga0307409_1000058174 | 240 |
| 226 | 3300032002 | Ga0307416_100000068 | Ga0307416_10000006832 | 240 |
| 227 | 3300032004 | Ga0307414_10001935 | Ga0307414_100019355 | 240 |
| 228 | 3300032004 | Ga0307414_10018687 | Ga0307414_100186871 | 240 |
| 229 | 3300032004 | Ga0307414_10355908 | Ga0307414_103559082 | 240 |
| 230 | 3300044712 | Ga0453684_0414374 | Ga0453684_0414374_728_1492 | 240 |
| 231 | 3300046461 | Ga0495641_0102548 | Ga0495641_0102548_400_1161 | 240 |
| 232 | 3300046512 | Ga0495610_0002219 | Ga0495610_0002219_2262_3026 | 240 |
| 233 | 3300046512 | Ga0495610_0004850 | Ga0495610_0004850_5716_6480 | 240 |
| 234 | 3300046558 | Ga0495633_0012073 | Ga0495633_0012073_2308_3072 | 240 |
| 235 | 3300047322 | Ga0495680_0270486 | Ga0495680_0270486_14_775 | 240 |
| 236 | 3300049589 | Ga0501073_0411181 | Ga0501073_0411181_62_826 | 240 |
| 237 | 3300053153 | Ga0500616_0003565 | Ga0500616_0003565_1936_2736 | 240 |
| 238 | iso_pu_bacteria | 2522125168 | 2522548101 | 240 |
| 239 | iso_pu_bacteria | 2721755487 | 2722725638 | 240 |
| 240 | iso_pu_bacteria | 2842903701 | 2842907313 | 240 |
| 241 | iso_pu_bacteria | 2896317667 | 2896320331 | 240 |
| 242 | iso_pu_bacteria | 2896344016 | 2896344862 | 240 |
| 243 | iso_pu_bacteria | 2898713307 | 2898714615 | 240 |
| 244 | iso_pu_bacteria | 2904780799 | 2904782349 | 240 |
| 245 | iso_pu_bacteria | 2910245624 | 2910246140 | 240 |
| 246 | iso_pu_bacteria | 2919177583 | 2919178453 | 240 |
| 247 | iso_pu_bacteria | 3003233435 | 3003237014 | 240 |
| 248 | 3300002738 | JGI25154J39366_1000004 | JGI25154J39366_1000004134 | 241 |
| 249 | 3300003215 | JGI25153J46596_10006198 | JGI25153J46596_100061984 | 241 |
| 250 | 3300003322 | rootL2_10022160 | rootL2_100221603 | 241 |
| 251 | 3300003354 | JGI25160J50197_1002338 | JGI25160J50197_10023382 | 241 |
| 252 | 3300005328 | Ga0070676_10271310 | Ga0070676_102713102 | 241 |
| 253 | 3300005334 | Ga0068869_100007354 | Ga0068869_1000073542 | 241 |
| 254 | 3300005335 | Ga0070666_10000042 | Ga0070666_10000042104 | 241 |
| 255 | 3300005336 | Ga0070680_100000878 | Ga0070680_10000087813 | 241 |
| 256 | 3300005337 | Ga0070682_100001122 | Ga0070682_10000112210 | 241 |
| 257 | 3300005338 | Ga0068868_100004734 | Ga0068868_1000047343 | 241 |
| 258 | 3300005338 | Ga0068868_100158262 | Ga0068868_1001582622 | 241 |
| 259 | 3300005338 | Ga0068868_100269746 | Ga0068868_1002697461 | 241 |
| 260 | 3300005339 | Ga0070660_100105936 | Ga0070660_1001059363 | 241 |
| 261 | 3300005340 | Ga0070689_100465007 | Ga0070689_1004650072 | 241 |
| 262 | 3300005347 | Ga0070668_100061242 | Ga0070668_1000612423 | 241 |
| 263 | 3300005347 | Ga0070668_100333339 | Ga0070668_1003333392 | 241 |
| 264 | 3300005353 | Ga0070669_100017262 | Ga0070669_1000172622 | 241 |
| 265 | 3300005355 | Ga0070671_100102928 | Ga0070671_1001029281 | 241 |
| 266 | 3300005355 | Ga0070671_100228278 | Ga0070671_1002282782 | 241 |
| 267 | 3300005364 | Ga0070673_100284812 | Ga0070673_1002848122 | 241 |
| 268 | 3300005364 | Ga0070673_100304793 | Ga0070673_1003047931 | 241 |
| 269 | 3300005367 | Ga0070667_100013413 | Ga0070667_1000134132 | 241 |
| 270 | 3300005367 | Ga0070667_100044613 | Ga0070667_1000446133 | 241 |
| 271 | 3300005466 | Ga0070685_10080154 | Ga0070685_100801542 | 241 |
| 272 | 3300005466 | Ga0070685_10286675 | Ga0070685_102866751 | 241 |
| 273 | 3300005467 | Ga0070706_100222188 | Ga0070706_1002221881 | 241 |
| 274 | 3300005530 | Ga0070679_100000398 | Ga0070679_1000003989 | 241 |
| 275 | 3300005530 | Ga0070679_100003316 | Ga0070679_1000033166 | 241 |
| 276 | 3300005535 | Ga0070684_100109828 | Ga0070684_1001098282 | 241 |
| 277 | 3300005539 | Ga0068853_100017299 | Ga0068853_1000172995 | 241 |
| 278 | 3300005547 | Ga0070693_100000650 | Ga0070693_10000065011 | 241 |
| 279 | 3300005563 | Ga0068855_100029707 | Ga0068855_1000297076 | 241 |
| 280 | 3300005563 | Ga0068855_100224589 | Ga0068855_1002245892 | 241 |
| 281 | 3300005577 | Ga0068857_100001316 | Ga0068857_10000131613 | 241 |
| 282 | 3300005614 | Ga0068856_100097121 | Ga0068856_1000971212 | 241 |
| 283 | 3300005616 | Ga0068852_100001166 | Ga0068852_1000011667 | 241 |
| 284 | 3300005616 | Ga0068852_100002787 | Ga0068852_1000027875 | 241 |
| 285 | 3300005616 | Ga0068852_100009916 | Ga0068852_1000099166 | 241 |
| 286 | 3300005617 | Ga0068859_100013654 | Ga0068859_1000136543 | 241 |
| 287 | 3300005617 | Ga0068859_100067304 | Ga0068859_1000673042 | 241 |
| 288 | 3300005618 | Ga0068864_100009257 | Ga0068864_1000092573 | 241 |
| 289 | 3300005618 | Ga0068864_100201391 | Ga0068864_1002013912 | 241 |
| 290 | 3300005618 | Ga0068864_100480459 | Ga0068864_1004804592 | 241 |
| 291 | 3300005834 | Ga0068851_10012661 | Ga0068851_100126612 | 241 |
| 292 | 3300005841 | Ga0068863_100005978 | Ga0068863_1000059783 | 241 |
| 293 | 3300005841 | Ga0068863_100017784 | Ga0068863_1000177842 | 241 |
| 294 | 3300005842 | Ga0068858_100046101 | Ga0068858_1000461013 | 241 |
| 295 | 3300005843 | Ga0068860_100002561 | Ga0068860_1000025616 | 241 |
| 296 | 3300005843 | Ga0068860_100003920 | Ga0068860_1000039209 | 241 |
| 297 | 3300006195 | Ga0075366_10050396 | Ga0075366_100503964 | 241 |
| 298 | 3300006237 | Ga0097621_100002185 | Ga0097621_1000021852 | 241 |
| 299 | 3300006237 | Ga0097621_100637491 | Ga0097621_1006374912 | 241 |
| 300 | 3300006358 | Ga0068871_100019766 | Ga0068871_1000197664 | 241 |
| 301 | 3300006358 | Ga0068871_100113091 | Ga0068871_1001130912 | 241 |
| 302 | 3300006358 | Ga0068871_100368432 | Ga0068871_1003684322 | 241 |
| 303 | 3300006931 | Ga0097620_100013654 | Ga0097620_1000136543 | 241 |
| 304 | 3300006931 | Ga0097620_100067307 | Ga0097620_1000673072 | 241 |
| 305 | 3300009093 | Ga0105240_10002364 | Ga0105240_1000236416 | 241 |
| 306 | 3300009093 | Ga0105240_10186537 | Ga0105240_101865372 | 241 |
| 307 | 3300009098 | Ga0105245_10639164 | Ga0105245_106391642 | 241 |
| 308 | 3300009101 | Ga0105247_10022031 | Ga0105247_100220312 | 241 |
| 309 | 3300009174 | Ga0105241_10006161 | Ga0105241_100061612 | 241 |
| 310 | 3300009174 | Ga0105241_10009180 | Ga0105241_100091802 | 241 |
| 311 | 3300009174 | Ga0105241_10170247 | Ga0105241_101702472 | 241 |
| 312 | 3300009174 | Ga0105241_10429835 | Ga0105241_104298352 | 241 |
| 313 | 3300009176 | Ga0105242_10377038 | Ga0105242_103770381 | 241 |
| 314 | 3300009545 | Ga0105237_10002312 | Ga0105237_1000231216 | 241 |
| 315 | 3300009545 | Ga0105237_10011376 | Ga0105237_100113764 | 241 |
| 316 | 3300009545 | Ga0105237_10067355 | Ga0105237_100673551 | 241 |
| 317 | 3300009545 | Ga0105237_10103921 | Ga0105237_101039213 | 241 |
| 318 | 3300009551 | Ga0105238_10029135 | Ga0105238_100291352 | 241 |
| 319 | 3300009553 | Ga0105249_10084947 | Ga0105249_100849472 | 241 |
| 320 | 3300010375 | Ga0105239_10006736 | Ga0105239_100067365 | 241 |
| 321 | 3300013104 | Ga0157370_10007415 | Ga0157370_100074153 | 241 |
| 322 | 3300013104 | Ga0157370_10083964 | Ga0157370_100839642 | 241 |
| 323 | 3300013105 | Ga0157369_10061089 | Ga0157369_100610891 | 241 |
| 324 | 3300013105 | Ga0157369_10167491 | Ga0157369_101674912 | 241 |
| 325 | 3300013297 | Ga0157378_10045074 | Ga0157378_100450742 | 241 |
| 326 | 3300013297 | Ga0157378_10055052 | Ga0157378_100550522 | 241 |
| 327 | 3300013297 | Ga0157378_10182995 | Ga0157378_101829952 | 241 |
| 328 | 3300013306 | Ga0163162_10031627 | Ga0163162_100316273 | 241 |
| 329 | 3300013306 | Ga0163162_10096379 | Ga0163162_100963793 | 241 |
| 330 | 3300013306 | Ga0163162_10540197 | Ga0163162_105401972 | 241 |
| 331 | 3300013307 | Ga0157372_10000052 | Ga0157372_1000005242 | 241 |
| 332 | 3300013307 | Ga0157372_10155631 | Ga0157372_101556312 | 241 |
| 333 | 3300013307 | Ga0157372_11158708 | Ga0157372_111587081 | 241 |
| 334 | 3300013308 | Ga0157375_10192383 | Ga0157375_101923833 | 241 |
| 335 | 3300013308 | Ga0157375_10268339 | Ga0157375_102683392 | 241 |
| 336 | 3300014969 | Ga0157376_10002899 | Ga0157376_100028992 | 241 |
| 337 | 3300025246 | Ga0209646_1000025 | Ga0209646_1000025203 | 241 |
| 338 | 3300025250 | Ga0209026_1000380 | Ga0209026_100038012 | 241 |
| 339 | 3300025297 | Ga0209758_1012637 | Ga0209758_10126373 | 241 |
| 340 | 3300025302 | Ga0207426_1000261 | Ga0207426_100026183 | 241 |
| 341 | 3300025900 | Ga0207710_10008199 | Ga0207710_100081993 | 241 |
| 342 | 3300025903 | Ga0207680_10000228 | Ga0207680_1000022826 | 241 |
| 343 | 3300025904 | Ga0207647_10065536 | Ga0207647_100655362 | 241 |
| 344 | 3300025909 | Ga0207705_10482521 | Ga0207705_104825211 | 241 |
| 345 | 3300025911 | Ga0207654_10004675 | Ga0207654_100046756 | 241 |
| 346 | 3300025911 | Ga0207654_10017743 | Ga0207654_100177432 | 241 |
| 347 | 3300025911 | Ga0207654_10108666 | Ga0207654_101086662 | 241 |
| 348 | 3300025912 | Ga0207707_10000722 | Ga0207707_1000072215 | 241 |
| 349 | 3300025913 | Ga0207695_10023732 | Ga0207695_100237323 | 241 |
| 350 | 3300025913 | Ga0207695_10034360 | Ga0207695_100343602 | 241 |
| 351 | 3300025913 | Ga0207695_10186053 | Ga0207695_101860532 | 241 |
| 352 | 3300025914 | Ga0207671_10001247 | Ga0207671_1000124715 | 241 |
| 353 | 3300025914 | Ga0207671_10242774 | Ga0207671_102427742 | 241 |
| 354 | 3300025914 | Ga0207671_10341463 | Ga0207671_103414632 | 241 |
| 355 | 3300025917 | Ga0207660_10004797 | Ga0207660_100047974 | 241 |
| 356 | 3300025919 | Ga0207657_10025764 | Ga0207657_100257642 | 241 |
| 357 | 3300025921 | Ga0207652_10006617 | Ga0207652_100066176 | 241 |
| 358 | 3300025921 | Ga0207652_10069673 | Ga0207652_100696732 | 241 |
| 359 | 3300025923 | Ga0207681_10053814 | Ga0207681_100538142 | 241 |
| 360 | 3300025924 | Ga0207694_10019125 | Ga0207694_100191256 | 241 |
| 361 | 3300025931 | Ga0207644_10206585 | Ga0207644_102065852 | 241 |
| 362 | 3300025931 | Ga0207644_10345614 | Ga0207644_103456141 | 241 |
| 363 | 3300025934 | Ga0207686_10200092 | Ga0207686_102000921 | 241 |
| 364 | 3300025940 | Ga0207691_10137081 | Ga0207691_101370812 | 241 |
| 365 | 3300025940 | Ga0207691_10461343 | Ga0207691_104613432 | 241 |
| 366 | 3300025942 | Ga0207689_10009695 | Ga0207689_100096952 | 241 |
| 367 | 3300025949 | Ga0207667_10002024 | Ga0207667_1000202416 | 241 |
| 368 | 3300025949 | Ga0207667_10177371 | Ga0207667_101773713 | 241 |
| 369 | 3300025960 | Ga0207651_10063857 | Ga0207651_100638571 | 241 |
| 370 | 3300025960 | Ga0207651_10297158 | Ga0207651_102971581 | 241 |
| 371 | 3300025961 | Ga0207712_10009009 | Ga0207712_100090093 | 241 |
| 372 | 3300025972 | Ga0207668_10043711 | Ga0207668_100437113 | 241 |
| 373 | 3300025981 | Ga0207640_10071765 | Ga0207640_100717652 | 241 |
| 374 | 3300025986 | Ga0207658_10497426 | Ga0207658_104974262 | 241 |
| 375 | 3300026023 | Ga0207677_10049146 | Ga0207677_100491462 | 241 |
| 376 | 3300026035 | Ga0207703_10004767 | Ga0207703_100047672 | 241 |
| 377 | 3300026041 | Ga0207639_10032202 | Ga0207639_100322022 | 241 |
| 378 | 3300026078 | Ga0207702_10058064 | Ga0207702_100580643 | 241 |
| 379 | 3300026088 | Ga0207641_10000158 | Ga0207641_100001582 | 241 |
| 380 | 3300026088 | Ga0207641_10006686 | Ga0207641_100066868 | 241 |
| 381 | 3300026095 | Ga0207676_10004127 | Ga0207676_100041276 | 241 |
| 382 | 3300026095 | Ga0207676_10180655 | Ga0207676_101806552 | 241 |
| 383 | 3300026116 | Ga0207674_10016794 | Ga0207674_100167946 | 241 |
| 384 | 3300026142 | Ga0207698_10001210 | Ga0207698_100012107 | 241 |
| 385 | 3300026142 | Ga0207698_10008221 | Ga0207698_100082212 | 241 |
| 386 | 3300026142 | Ga0207698_10014430 | Ga0207698_100144302 | 241 |
| 387 | 3300028381 | Ga0268264_10009194 | Ga0268264_100091945 | 241 |
| 388 | 3300028381 | Ga0268264_10031602 | Ga0268264_100316023 | 241 |
| 389 | 3300031456 | Ga0307513_10128438 | Ga0307513_101284382 | 241 |
| 390 | 3300031507 | Ga0307509_10290943 | Ga0307509_102909432 | 241 |
| 391 | 3300031616 | Ga0307508_10229940 | Ga0307508_102299402 | 241 |
| 392 | 3300031824 | Ga0307413_10008102 | Ga0307413_100081027 | 241 |
| 393 | 3300031838 | Ga0307518_10045018 | Ga0307518_100450182 | 241 |
| 394 | 3300031903 | Ga0307407_10262336 | Ga0307407_102623362 | 241 |
| 395 | 3300031911 | Ga0307412_10329066 | Ga0307412_103290662 | 241 |
| 396 | 3300032004 | Ga0307414_10236412 | Ga0307414_102364122 | 241 |
| 397 | 3300032126 | Ga0307415_100555413 | Ga0307415_1005554132 | 241 |
| 398 | 3300037418 | Ga0395900_0009771 | Ga0395900_0009771_3834_4595 | 241 |
| 399 | 3300037418 | Ga0395900_0113365 | Ga0395900_0113365_288_1061 | 241 |
| 400 | 3300037418 | Ga0395900_0148325 | Ga0395900_0148325_1587_2348 | 241 |
| 401 | 3300037466 | Ga0395898_0019394 | Ga0395898_0019394_3779_4540 | 241 |
| 402 | 3300037466 | Ga0395898_0201687 | Ga0395898_0201687_955_1722 | 241 |
| 403 | 3300037466 | Ga0395898_0311010 | Ga0395898_0311010_557_1318 | 241 |
| 404 | 3300038443 | Ga0395901_0106738 | Ga0395901_0106738_1169_1930 | 241 |
| 405 | 3300038443 | Ga0395901_0141436 | Ga0395901_0141436_206_967 | 241 |
| 406 | 3300044656 | Ga0466969_0102706 | Ga0466969_0102706_182_943 | 241 |
| 407 | 3300044658 | Ga0466972_0010933 | Ga0466972_0010933_17_778 | 241 |
| 408 | 3300044684 | Ga0466966_0004496 | Ga0466966_0004496_8355_9116 | 241 |
| 409 | 3300044693 | Ga0466961_0011577 | Ga0466961_0011577_1243_2004 | 241 |
| 410 | 3300044735 | Ga0466968_0017676 | Ga0466968_0017676_458_1219 | 241 |
| 411 | 3300046453 | Ga0495627_007447 | Ga0495627_007447_3194_3961 | 241 |
| 412 | 3300046558 | Ga0495633_0000017 | Ga0495633_0000017_80500_81267 | 241 |
| 413 | 3300046660 | Ga0495625_0084598 | Ga0495625_0084598_104_865 | 241 |
| 414 | 3300047320 | Ga0495672_0004265 | Ga0495672_0004265_9896_10657 | 241 |
| 415 | 3300047472 | Ga0495686_0017519 | Ga0495686_0017519_129_890 | 241 |
| 416 | 3300049569 | Ga0501032_0054008 | Ga0501032_0054008_483_1247 | 241 |
| 417 | 3300049571 | Ga0501034_0001100 | Ga0501034_0001100_4247_5011 | 241 |
| 418 | 3300049571 | Ga0501034_0555672 | Ga0501034_0555672_109_876 | 241 |
| 419 | 3300049572 | Ga0501036_0563249 | Ga0501036_0563249_128_892 | 241 |
| 420 | 3300049574 | Ga0501038_0000440 | Ga0501038_0000440_14427_15245 | 241 |
| 421 | 3300049574 | Ga0501038_0209604 | Ga0501038_0209604_183_950 | 241 |
| 422 | 3300049581 | Ga0501047_0083198 | Ga0501047_0083198_1997_2764 | 241 |
| 423 | 3300049583 | Ga0501067_0080868 | Ga0501067_0080868_334_1101 | 241 |
| 424 | 3300049588 | Ga0501072_0433818 | Ga0501072_0433818_142_909 | 241 |
| 425 | 3300049703 | Ga0501219_000271 | Ga0501219_000271_6044_6805 | 241 |
| 426 | 3300049705 | Ga0501225_0035699 | Ga0501225_0035699_240_1001 | 241 |
| 427 | 3300049741 | Ga0501079_0044871 | Ga0501079_0044871_2250_3017 | 241 |
| 428 | 3300049758 | Ga0501241_000065 | Ga0501241_000065_864_1631 | 241 |
| 429 | 3300049823 | Ga0501044_0124154 | Ga0501044_0124154_1668_2429 | 241 |
| 430 | 3300050493 | nmdc:mga0k408_83018_c1 | nmdc:mga0k408_83018_c1_487_1248 | 241 |
| 431 | 3300053093 | Ga0500651_0183181 | Ga0500651_0183181_243_1010 | 241 |
| 432 | 3300053094 | Ga0500566_0168173 | Ga0500566_0168173_236_997 | 241 |
| 433 | 3300053136 | Ga0500559_0033862 | Ga0500559_0033862_953_1723 | 241 |
| 434 | 3300053136 | Ga0500559_0144518 | Ga0500559_0144518_331_1092 | 241 |
| 435 | 3300053146 | Ga0500588_0002432 | Ga0500588_0002432_2087_2848 | 241 |
| 436 | 3300060353 | Ga0501082_0108575 | Ga0501082_0108575_1609_2376 | 241 |
| 437 | iso_pu_bacteria | 2911138879 | 2911141548 | 241 |
| 438 | 3300001979 | JGI24740J21852_10002393 | JGI24740J21852_100023938 | 242 |
| 439 | 3300003215 | JGI25153J46596_10009612 | JGI25153J46596_100096124 | 242 |
| 440 | 3300003320 | rootH2_10004521 | rootH2_100045214 | 242 |
| 441 | 3300003320 | rootH2_10025566 | rootH2_100255665 | 242 |
| 442 | 3300003320 | rootH2_10028784 | rootH2_1002878418 | 242 |
| 443 | 3300003320 | rootH2_10115381 | rootH2_101153815 | 242 |
| 444 | 3300003322 | rootL2_10010741 | rootL2_100107413 | 242 |
| 445 | 3300003322 | rootL2_10022161 | rootL2_100221613 | 242 |
| 446 | 3300003322 | rootL2_10341458 | rootL2_103414582 | 242 |
| 447 | 3300003323 | rootH1_10034646 | rootH1_100346462 | 242 |
| 448 | 3300003323 | rootH1_10088863 | rootH1_100888632 | 242 |
| 449 | 3300003323 | rootH1_10100195 | rootH1_101001953 | 242 |
| 450 | 3300003354 | JGI25160J50197_1004863 | JGI25160J50197_10048634 | 242 |
| 451 | 3300003761 | Ga0055535_1004467 | Ga0055535_10044673 | 242 |
| 452 | 3300003762 | Ga0055542_1002394 | Ga0055542_10023944 | 242 |
| 453 | 3300003790 | Ga0055528_1001027 | Ga0055528_10010278 | 242 |
| 454 | 3300003791 | Ga0055530_10000288 | Ga0055530_100002883 | 242 |
| 455 | 3300003794 | Ga0055531_10040389 | Ga0055531_100403891 | 242 |
| 456 | 3300005262 | Ga0065165_1000128 | Ga0065165_10001283 | 242 |
| 457 | 3300005329 | Ga0070683_100038066 | Ga0070683_1000380664 | 242 |
| 458 | 3300005333 | Ga0070677_10018190 | Ga0070677_100181903 | 242 |
| 459 | 3300005335 | Ga0070666_10031488 | Ga0070666_100314882 | 242 |
| 460 | 3300005338 | Ga0068868_100264975 | Ga0068868_1002649751 | 242 |
| 461 | 3300005341 | Ga0070691_10017297 | Ga0070691_100172973 | 242 |
| 462 | 3300005356 | Ga0070674_100198630 | Ga0070674_1001986302 | 242 |
| 463 | 3300005455 | Ga0070663_100005807 | Ga0070663_1000058072 | 242 |
| 464 | 3300005456 | Ga0070678_100078718 | Ga0070678_1000787183 | 242 |
| 465 | 3300005458 | Ga0070681_10028566 | Ga0070681_100285664 | 242 |
| 466 | 3300005459 | Ga0068867_100341318 | Ga0068867_1003413181 | 242 |
| 467 | 3300005535 | Ga0070684_100117227 | Ga0070684_1001172271 | 242 |
| 468 | 3300005539 | Ga0068853_100010927 | Ga0068853_1000109276 | 242 |
| 469 | 3300005539 | Ga0068853_100084456 | Ga0068853_1000844562 | 242 |
| 470 | 3300005563 | Ga0068855_100077659 | Ga0068855_1000776592 | 242 |
| 471 | 3300005563 | Ga0068855_100259037 | Ga0068855_1002590371 | 242 |
| 472 | 3300005616 | Ga0068852_100026395 | Ga0068852_1000263953 | 242 |
| 473 | 3300005616 | Ga0068852_100036902 | Ga0068852_1000369022 | 242 |
| 474 | 3300005617 | Ga0068859_100039542 | Ga0068859_1000395424 | 242 |
| 475 | 3300005841 | Ga0068863_100052271 | Ga0068863_1000522714 | 242 |
| 476 | 3300005842 | Ga0068858_100461936 | Ga0068858_1004619361 | 242 |
| 477 | 3300005843 | Ga0068860_100000005 | Ga0068860_10000000556 | 242 |
| 478 | 3300005843 | Ga0068860_100662269 | Ga0068860_1006622692 | 242 |
| 479 | 3300005983 | Ga0081540_1020082 | Ga0081540_10200823 | 242 |
| 480 | 3300006195 | Ga0075366_10106217 | Ga0075366_101062172 | 242 |
| 481 | 3300006871 | Ga0075434_100329091 | Ga0075434_1003290912 | 242 |
| 482 | 3300006931 | Ga0097620_100039542 | Ga0097620_1000395424 | 242 |
| 483 | 3300009093 | Ga0105240_10000140 | Ga0105240_100001404 | 242 |
| 484 | 3300009093 | Ga0105240_10000419 | Ga0105240_1000041958 | 242 |
| 485 | 3300009093 | Ga0105240_10001671 | Ga0105240_1000167124 | 242 |
| 486 | 3300009093 | Ga0105240_10026048 | Ga0105240_100260487 | 242 |
| 487 | 3300009093 | Ga0105240_10056829 | Ga0105240_100568294 | 242 |
| 488 | 3300009093 | Ga0105240_10070744 | Ga0105240_100707444 | 242 |
| 489 | 3300009093 | Ga0105240_10169808 | Ga0105240_101698083 | 242 |
| 490 | 3300009174 | Ga0105241_10003484 | Ga0105241_100034844 | 242 |
| 491 | 3300009545 | Ga0105237_10000390 | Ga0105237_1000039031 | 242 |
| 492 | 3300009545 | Ga0105237_10022955 | Ga0105237_100229554 | 242 |
| 493 | 3300009551 | Ga0105238_10010129 | Ga0105238_100101296 | 242 |
| 494 | 3300009551 | Ga0105238_10070744 | Ga0105238_100707442 | 242 |
| 495 | 3300009551 | Ga0105238_10083693 | Ga0105238_100836933 | 242 |
| 496 | 3300010375 | Ga0105239_10000093 | Ga0105239_1000009366 | 242 |
| 497 | 3300010375 | Ga0105239_10002826 | Ga0105239_100028267 | 242 |
| 498 | 3300010375 | Ga0105239_10061586 | Ga0105239_100615862 | 242 |
| 499 | 3300010375 | Ga0105239_10119469 | Ga0105239_101194692 | 242 |
| 500 | 3300010375 | Ga0105239_10145959 | Ga0105239_101459593 | 242 |
| 501 | 3300013102 | Ga0157371_10003455 | Ga0157371_100034552 | 242 |
| 502 | 3300013104 | Ga0157370_10034523 | Ga0157370_100345232 | 242 |
| 503 | 3300013104 | Ga0157370_10170202 | Ga0157370_101702023 | 242 |
| 504 | 3300013104 | Ga0157370_10194856 | Ga0157370_101948561 | 242 |
| 505 | 3300013104 | Ga0157370_10307374 | Ga0157370_103073741 | 242 |
| 506 | 3300013105 | Ga0157369_10000461 | Ga0157369_1000046139 | 242 |
| 507 | 3300013105 | Ga0157369_10124911 | Ga0157369_101249112 | 242 |
| 508 | 3300013296 | Ga0157374_10000004 | Ga0157374_10000004328 | 242 |
| 509 | 3300013306 | Ga0163162_10005547 | Ga0163162_100055473 | 242 |
| 510 | 3300013307 | Ga0157372_10000001 | Ga0157372_1000000184 | 242 |
| 511 | 3300013307 | Ga0157372_10008256 | Ga0157372_100082569 | 242 |
| 512 | 3300013307 | Ga0157372_10055789 | Ga0157372_100557893 | 242 |
| 513 | 3300013307 | Ga0157372_10121203 | Ga0157372_101212034 | 242 |
| 514 | 3300014325 | Ga0163163_10189424 | Ga0163163_101894241 | 242 |
| 515 | 3300014969 | Ga0157376_10001819 | Ga0157376_100018195 | 242 |
| 516 | 3300015265 | Ga0182005_1000040 | Ga0182005_1000040112 | 242 |
| 517 | 3300021384 | Ga0213876_10005187 | Ga0213876_100051872 | 242 |
| 518 | 3300025242 | Ga0209258_100356 | Ga0209258_10035630 | 242 |
| 519 | 3300025254 | Ga0209148_1000129 | Ga0209148_100012962 | 242 |
| 520 | 3300025273 | Ga0209673_1000085 | Ga0209673_1000085130 | 242 |
| 521 | 3300025291 | Ga0209675_1022540 | Ga0209675_10225402 | 242 |
| 522 | 3300025295 | Ga0209564_1003860 | Ga0209564_10038603 | 242 |
| 523 | 3300025297 | Ga0209758_1014696 | Ga0209758_10146962 | 242 |
| 524 | 3300025297 | Ga0209758_1025035 | Ga0209758_10250352 | 242 |
| 525 | 3300025298 | Ga0209050_1000524 | Ga0209050_10005246 | 242 |
| 526 | 3300025302 | Ga0207426_1004611 | Ga0207426_10046112 | 242 |
| 527 | 3300025302 | Ga0207426_1006919 | Ga0207426_10069193 | 242 |
| 528 | 3300025304 | Ga0209257_1005255 | Ga0209257_10052557 | 242 |
| 529 | 3300025893 | Ga0207682_10015472 | Ga0207682_100154723 | 242 |
| 530 | 3300025911 | Ga0207654_10013126 | Ga0207654_100131262 | 242 |
| 531 | 3300025912 | Ga0207707_10036114 | Ga0207707_100361144 | 242 |
| 532 | 3300025913 | Ga0207695_10000027 | Ga0207695_10000027335 | 242 |
| 533 | 3300025913 | Ga0207695_10000164 | Ga0207695_10000164135 | 242 |
| 534 | 3300025913 | Ga0207695_10003547 | Ga0207695_100035478 | 242 |
| 535 | 3300025913 | Ga0207695_10038685 | Ga0207695_100386855 | 242 |
| 536 | 3300025913 | Ga0207695_10221885 | Ga0207695_102218851 | 242 |
| 537 | 3300025914 | Ga0207671_10001635 | Ga0207671_100016354 | 242 |
| 538 | 3300025914 | Ga0207671_10004939 | Ga0207671_100049395 | 242 |
| 539 | 3300025914 | Ga0207671_10667057 | Ga0207671_106670571 | 242 |
| 540 | 3300025924 | Ga0207694_10023285 | Ga0207694_100232853 | 242 |
| 541 | 3300025924 | Ga0207694_10050498 | Ga0207694_100504982 | 242 |
| 542 | 3300025924 | Ga0207694_10056158 | Ga0207694_100561584 | 242 |
| 543 | 3300025936 | Ga0207670_10142134 | Ga0207670_101421343 | 242 |
| 544 | 3300025937 | Ga0207669_10263127 | Ga0207669_102631272 | 242 |
| 545 | 3300025949 | Ga0207667_10063189 | Ga0207667_100631892 | 242 |
| 546 | 3300026023 | Ga0207677_10417611 | Ga0207677_104176111 | 242 |
| 547 | 3300026041 | Ga0207639_10016287 | Ga0207639_100162874 | 242 |
| 548 | 3300026041 | Ga0207639_10082848 | Ga0207639_100828482 | 242 |
| 549 | 3300026041 | Ga0207639_10599231 | Ga0207639_105992311 | 242 |
| 550 | 3300026067 | Ga0207678_10012680 | Ga0207678_100126802 | 242 |
| 551 | 3300026142 | Ga0207698_10049231 | Ga0207698_100492313 | 242 |
| 552 | 3300028380 | Ga0268265_10472501 | Ga0268265_104725012 | 242 |
| 553 | 3300028381 | Ga0268264_10000012 | Ga0268264_1000001238 | 242 |
| 554 | 3300028786 | Ga0307517_10157592 | Ga0307517_101575921 | 242 |
| 555 | 3300028786 | Ga0307517_10196962 | Ga0307517_101969621 | 242 |
| 556 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002712 | 242 |
| 557 | 3300028800 | Ga0265338_10074654 | Ga0265338_100746543 | 242 |
| 558 | 3300030521 | Ga0307511_10000850 | Ga0307511_1000085016 | 242 |
| 559 | 3300030731 | Ga0316177_1035139 | Ga0316177_10351393 | 242 |
| 560 | 3300030732 | Ga0316176_1042321 | Ga0316176_10423214 | 242 |
| 561 | 3300030742 | Ga0316183_1134560 | Ga0316183_11345607 | 242 |
| 562 | 3300030744 | Ga0316181_1167506 | Ga0316181_116750613 | 242 |
| 563 | 3300030745 | Ga0316182_1005945 | Ga0316182_10059452 | 242 |
| 564 | 3300031247 | Ga0265340_10157090 | Ga0265340_101570902 | 242 |
| 565 | 3300031456 | Ga0307513_10095002 | Ga0307513_100950022 | 242 |
| 566 | 3300031507 | Ga0307509_10264318 | Ga0307509_102643181 | 242 |
| 567 | 3300031730 | Ga0307516_10002277 | Ga0307516_100022777 | 242 |
| 568 | 3300031911 | Ga0307412_10097081 | Ga0307412_100970812 | 242 |
| 569 | 3300032004 | Ga0307414_10220546 | Ga0307414_102205462 | 242 |
| 570 | 3300033180 | Ga0307510_10007660 | Ga0307510_100076608 | 242 |
| 571 | 3300033180 | Ga0307510_10303575 | Ga0307510_103035752 | 242 |
| 572 | 3300035398 | Ga0316574_0108115 | Ga0316574_0108115_889_1662 | 242 |
| 573 | 3300035692 | Ga0373935_0325288 | Ga0373935_0325288_148_912 | 242 |
| 574 | 3300036712 | Ga0316584_0166051 | Ga0316584_0166051_69_842 | 242 |
| 575 | 3300037312 | Ga0395899_0000844 | Ga0395899_0000844_26240_27010 | 242 |
| 576 | 3300039093 | Ga0400489_75466 | Ga0400489_75466_1878_2648 | 242 |
| 577 | 3300039437 | Ga0436365_1251897 | Ga0436365_1251897_19217_19981 | 242 |
| 578 | 3300042007 | Ga0439449_0004582 | Ga0439449_0004582_3835_4605 | 242 |
| 579 | 3300042007 | Ga0439449_0124594 | Ga0439449_0124594_166_936 | 242 |
| 580 | 3300042134 | Ga0450898_000822 | Ga0450898_000822_1565_2335 | 242 |
| 581 | 3300042156 | Ga0439446_0059122 | Ga0439446_0059122_362_1132 | 242 |
| 582 | 3300044656 | Ga0466969_0032078 | Ga0466969_0032078_982_1746 | 242 |
| 583 | 3300044658 | Ga0466972_0016536 | Ga0466972_0016536_617_1381 | 242 |
| 584 | 3300044658 | Ga0466972_0047289 | Ga0466972_0047289_896_1660 | 242 |
| 585 | 3300044658 | Ga0466972_0064704 | Ga0466972_0064704_646_1413 | 242 |
| 586 | 3300044684 | Ga0466966_0152009 | Ga0466966_0152009_261_1031 | 242 |
| 587 | 3300044693 | Ga0466961_0045589 | Ga0466961_0045589_1381_2145 | 242 |
| 588 | 3300044693 | Ga0466961_0168574 | Ga0466961_0168574_404_1174 | 242 |
| 589 | 3300044706 | Ga0466964_0013061 | Ga0466964_0013061_1563_2327 | 242 |
| 590 | 3300044765 | Ga0466970_0012503 | Ga0466970_0012503_223_987 | 242 |
| 591 | 3300044842 | Ga0466957_0087890 | Ga0466957_0087890_808_1578 | 242 |
| 592 | 3300045049 | Ga0466959_0003751 | Ga0466959_0003751_328_1092 | 242 |
| 593 | 3300045049 | Ga0466959_0005020 | Ga0466959_0005020_4421_5185 | 242 |
| 594 | 3300045049 | Ga0466959_0304006 | Ga0466959_0304006_164_928 | 242 |
| 595 | 3300045836 | Ga0466958_0026405 | Ga0466958_0026405_2147_2911 | 242 |
| 596 | 3300046454 | Ga0495592_0122497 | Ga0495592_0122497_863_1633 | 242 |
| 597 | 3300046462 | Ga0495651_0130455 | Ga0495651_0130455_544_1314 | 242 |
| 598 | 3300046463 | Ga0495653_0071695 | Ga0495653_0071695_496_1266 | 242 |
| 599 | 3300046477 | Ga0495664_0053179 | Ga0495664_0053179_1432_2202 | 242 |
| 600 | 3300046507 | Ga0495606_0005801 | Ga0495606_0005801_422_1186 | 242 |
| 601 | 3300046514 | Ga0495618_0075273 | Ga0495618_0075273_249_1019 | 242 |
| 602 | 3300046514 | Ga0495618_0133221 | Ga0495618_0133221_555_1391 | 242 |
| 603 | 3300046516 | Ga0495628_0030393 | Ga0495628_0030393_3377_4147 | 242 |
| 604 | 3300046517 | Ga0495630_0129445 | Ga0495630_0129445_323_1093 | 242 |
| 605 | 3300046524 | Ga0495648_0026544 | Ga0495648_0026544_908_1672 | 242 |
| 606 | 3300046526 | Ga0495666_0155570 | Ga0495666_0155570_64_834 | 242 |
| 607 | 3300046536 | Ga0495587_0296568 | Ga0495587_0296568_32_802 | 242 |
| 608 | 3300046543 | Ga0495645_0001391 | Ga0495645_0001391_891_1661 | 242 |
| 609 | 3300046543 | Ga0495645_0028618 | Ga0495645_0028618_1854_2624 | 242 |
| 610 | 3300046559 | Ga0495667_0177772 | Ga0495667_0177772_232_1002 | 242 |
| 611 | 3300046616 | Ga0495668_0001808 | Ga0495668_0001808_1277_2047 | 242 |
| 612 | 3300046642 | Ga0495634_0021990 | Ga0495634_0021990_1933_2703 | 242 |
| 613 | 3300046648 | Ga0495611_0000038 | Ga0495611_0000038_33077_33841 | 242 |
| 614 | 3300046648 | Ga0495611_0099588 | Ga0495611_0099588_170_934 | 242 |
| 615 | 3300046689 | Ga0495613_0005144 | Ga0495613_0005144_6721_7557 | 242 |
| 616 | 3300046689 | Ga0495613_0032396 | Ga0495613_0032396_2909_3679 | 242 |
| 617 | 3300046809 | Ga0495600_0046573 | Ga0495600_0046573_1355_2125 | 242 |
| 618 | 3300046809 | Ga0495600_0150162 | Ga0495600_0150162_362_1198 | 242 |
| 619 | 3300047319 | Ga0495674_0016152 | Ga0495674_0016152_2213_2983 | 242 |
| 620 | 3300047319 | Ga0495674_0142519 | Ga0495674_0142519_1134_1898 | 242 |
| 621 | 3300047322 | Ga0495680_0165613 | Ga0495680_0165613_630_1400 | 242 |
| 622 | 3300047443 | Ga0495687_000243 | Ga0495687_000243_57511_58275 | 242 |
| 623 | 3300047444 | Ga0495675_0138570 | Ga0495675_0138570_47_817 | 242 |
| 624 | 3300047471 | Ga0495684_0021293 | Ga0495684_0021293_2617_3453 | 242 |
| 625 | 3300047471 | Ga0495684_0025538 | Ga0495684_0025538_1510_2280 | 242 |
| 626 | 3300047472 | Ga0495686_0000058 | Ga0495686_0000058_51700_52464 | 242 |
| 627 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_396434_397201 | 242 |
| 628 | 3300049568 | Ga0501031_0157671 | Ga0501031_0157671_532_1302 | 242 |
| 629 | 3300049569 | Ga0501032_0011617 | Ga0501032_0011617_3906_4676 | 242 |
| 630 | 3300049570 | Ga0501033_0240003 | Ga0501033_0240003_477_1247 | 242 |
| 631 | 3300049571 | Ga0501034_0005663 | Ga0501034_0005663_11027_11797 | 242 |
| 632 | 3300049571 | Ga0501034_0016302 | Ga0501034_0016302_2437_3201 | 242 |
| 633 | 3300049571 | Ga0501034_0134743 | Ga0501034_0134743_131_901 | 242 |
| 634 | 3300049573 | Ga0501037_0021267 | Ga0501037_0021267_395_1165 | 242 |
| 635 | 3300049579 | Ga0501043_0003830 | Ga0501043_0003830_1812_2582 | 242 |
| 636 | 3300049580 | Ga0501046_0006720 | Ga0501046_0006720_4658_5428 | 242 |
| 637 | 3300049581 | Ga0501047_0010701 | Ga0501047_0010701_5221_5991 | 242 |
| 638 | 3300049581 | Ga0501047_0030967 | Ga0501047_0030967_2788_3552 | 242 |
| 639 | 3300049581 | Ga0501047_0570577 | Ga0501047_0570577_177_941 | 242 |
| 640 | 3300049589 | Ga0501073_0002013 | Ga0501073_0002013_9930_10700 | 242 |
| 641 | 3300049590 | Ga0501074_0002600 | Ga0501074_0002600_6953_7723 | 242 |
| 642 | 3300049742 | Ga0501080_0018745 | Ga0501080_0018745_2966_3736 | 242 |
| 643 | 3300049742 | Ga0501080_0181426 | Ga0501080_0181426_948_1712 | 242 |
| 644 | 3300049742 | Ga0501080_0406615 | Ga0501080_0406615_57_827 | 242 |
| 645 | 3300049744 | Ga0501083_0012750 | Ga0501083_0012750_1811_2581 | 242 |
| 646 | 3300049822 | Ga0501035_0079018 | Ga0501035_0079018_1218_1982 | 242 |
| 647 | 3300049822 | Ga0501035_0336413 | Ga0501035_0336413_460_1230 | 242 |
| 648 | 3300049823 | Ga0501044_0028667 | Ga0501044_0028667_2643_3407 | 242 |
| 649 | 3300049823 | Ga0501044_0045316 | Ga0501044_0045316_210_980 | 242 |
| 650 | 3300049823 | Ga0501044_0164390 | Ga0501044_0164390_1018_1782 | 242 |
| 651 | 3300049823 | Ga0501044_0330125 | Ga0501044_0330125_645_1409 | 242 |
| 652 | 3300049823 | Ga0501044_0474163 | Ga0501044_0474163_179_949 | 242 |
| 653 | 3300053088 | Ga0500644_0002591 | Ga0500644_0002591_927_1694 | 242 |
| 654 | 3300053088 | Ga0500644_0071148 | Ga0500644_0071148_67_831 | 242 |
| 655 | 3300053092 | Ga0500583_0015747 | Ga0500583_0015747_1239_2003 | 242 |
| 656 | 3300053093 | Ga0500651_0051214 | Ga0500651_0051214_384_1190 | 242 |
| 657 | 3300053109 | Ga0500569_000396 | Ga0500569_000396_2818_3624 | 242 |
| 658 | 3300053125 | Ga0500618_017751 | Ga0500618_017751_948_1718 | 242 |
| 659 | 3300053130 | Ga0500642_0010291 | Ga0500642_0010291_942_1706 | 242 |
| 660 | 3300053134 | Ga0500658_0000574 | Ga0500658_0000574_6363_7169 | 242 |
| 661 | 3300053142 | Ga0500577_0001248 | Ga0500577_0001248_4410_5216 | 242 |
| 662 | 3300053148 | Ga0500590_087079 | Ga0500590_087079_105_872 | 242 |
| 663 | 3300053156 | Ga0500622_0012858 | Ga0500622_0012858_3092_3856 | 242 |
| 664 | 3300053160 | Ga0500633_0000453 | Ga0500633_0000453_55_822 | 242 |
| 665 | 3300053177 | Ga0500636_0120446 | Ga0500636_0120446_164_931 | 242 |
| 666 | 3300054114 | Ga0501084_0471611 | Ga0501084_0471611_179_949 | 242 |
| 667 | 3300060353 | Ga0501082_0369824 | Ga0501082_0369824_93_863 | 242 |
| 668 | iso_pu_bacteria | 2515154155 | 2515855930 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z9y-assembly1.cif.gz_B | crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum | 0.9425 | 2 | 242 |
| 1vl8-assembly1.cif.gz_B | crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution | 0.9399 | 5 | 242 |
| 3uf0-assembly1.cif.gz_A | crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy) | 0.9377 | 4 | 242 |
| 4jro-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9375 | 7 | 239 |
| 4z9y-assembly1.cif.gz_B | crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum | 0.9349 | 2 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9695 | 75 | 239 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 83 | 184 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9414 | 75 | 239 | 3.40.50.720 |
| 1vl8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9399 | 5 | 242 | 3.40.50.720 |
| af_P76633_10_261_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9341 | 1 | 242 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I0K8G6-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125) | 0.9974 | 22 | 242 |
GO:0008678
|
| AF-A0A848WJQ7-F1-model_v4 | SDR family oxidoreductase | 0.9964 | 81 | 242 |
GO:0016616
|
| AF-A0A3M0Z361-F1-model_v4 | SDR family oxidoreductase | 0.9951 | 40 | 242 |
GO:0016616
|
| AF-A0A0F9L5W3-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9947 | 35 | 242 |
GO:0016616
|
| AF-A0A7Z9G2D4-F1-model_v4 | SDR family oxidoreductase | 0.9914 | 68 | 242 |
GO:0016616
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar