F473925

General Info

Members Datasets Scaffolds Average Seq Length
668 366 630 251

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10023732|Ga0207695_100237323
Length 285
Sequence VYRGGVLFGTTRTRYTNFDFIVPDGGIKIANFMSDLFSLKGKIALVTGCNKGIGRGMALGLAEAGADIIGVSSSLAPGSSIEKEIKALGRSFSPYQADLTDRTSLYEFIGKVRQENDRIDILMNNAGMILRNPAAQHPDEYWDKVLSINLDAAFILAREFGRDMLTRRSGKIIFTCSLLTFQGGINVPSYAASKGALGSLVKALANEWASQGVNVNGIAPGYISTDNTEALRNDLVRSKSILDRIPAGRWGDPEDFAGPAVFLASKAADYIHGTILTVDGGWMGR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2710264753 Frankia sp. KB5 Isolate Nodule
5 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
13 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
14 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
15 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
16 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
17 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
18 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
19 2855683550 Micromonospora sp. RP3T Isolate Unclassified
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
22 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
23 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
24 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
25 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
26 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
27 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
28 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
29 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
30 2914759650 Rhizosphaericola mali Isolate Rhizosphere
31 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
32 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
33 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
34 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
35 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
36 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
39 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
40 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
111 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
222 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
223 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
224 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
257 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
258 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
259 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
334 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
352 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
353 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
366 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.31
Metatranscriptomes 0
Isolates 5.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 0.15
Rhizoplane 1.05
Rhizosphere 79.19
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002393 3300001979 Bacteria 8536
2 JGI24751J29686_10022049 3300002459 Bacteria 1321
3 JGI25154J39366_1000004 3300002738 Bacteria 346460
4 JGI25152J39213_1000173 3300002773 Bacteria 43619
5 JGI25150J39212_1000015 3300002774 Bacteria 170613
6 JGI25151J46595_10000043 3300003187 Bacteria 170613
7 JGI25153J46596_10000009 3300003215 Bacteria 340925
8 JGI25153J46596_10006198 3300003215 Bacteria 6117
9 JGI25153J46596_10009612 3300003215 Bacteria 4463
10 rootH1_10044602 3300003316 Bacteria 2470
11 rootH2_10004521 3300003320 Bacteria 39563
12 rootH2_10025566 3300003320 Bacteria 14348
13 rootH2_10028784 3300003320 Bacteria 31504
14 rootH2_10115381 3300003320 Bacteria 6434
15 rootH2_10145766 3300003320 Bacteria 3105
16 rootL2_10010741 3300003322 Bacteria 10957
17 rootL2_10022160 3300003322 Bacteria 3286
18 rootL2_10022161 3300003322 Bacteria 3016
19 rootL2_10341458 3300003322 Bacteria 1719
20 rootH1_10002657 3300003323 Bacteria 5544
21 rootH1_10034646 3300003323 Bacteria 3121
22 rootH1_10088863 3300003323 Bacteria 1751
23 rootH1_10100195 3300003323 Bacteria 3903
24 JGI25160J50197_1002338 3300003354 Bacteria 8869
25 JGI25160J50197_1004863 3300003354 Bacteria 5721
26 JGI25160J50197_1006688 3300003354 Bacteria 4632
27 Ga0055535_1004467 3300003761 Bacteria 3390
28 Ga0055542_1002394 3300003762 Bacteria 6325
29 Ga0055529_1000421 3300003763 Bacteria 43457
30 Ga0055536_1000038 3300003781 Bacteria 133102
31 Ga0055528_1001027 3300003790 Bacteria 18451
32 Ga0055530_10000288 3300003791 Bacteria 45971
33 Ga0055530_10004665 3300003791 Bacteria 6950
34 Ga0055531_10000102 3300003794 Bacteria 92703
35 Ga0055531_10040389 3300003794 Bacteria 1368
36 Ga0065165_1000128 3300005262 Bacteria 129513
37 Ga0065714_10064423 3300005288 Bacteria 257266
38 Ga0065704_10095126 3300005289 Bacteria 2496
39 Ga0065704_10182599 3300005289 Bacteria 1220
40 Ga0070658_10039194 3300005327 Bacteria 3822
41 Ga0070676_10216074 3300005328 Bacteria 1264
42 Ga0070676_10271310 3300005328 Bacteria 1140
43 Ga0070683_100038066 3300005329 Bacteria 4407
44 Ga0070683_100120125 3300005329 Bacteria 2482
45 Ga0070683_100159176 3300005329 Bacteria 2142
46 Ga0070690_100313143 3300005330 Bacteria 1129
47 Ga0070670_100002522 3300005331 Bacteria 15098
48 Ga0070677_10018190 3300005333 Bacteria 2528
49 Ga0068869_100007354 3300005334 Bacteria 7029
50 Ga0068869_100099918 3300005334 Bacteria 2193
51 Ga0070666_10000042 3300005335 Bacteria 112296
52 Ga0070666_10006667 3300005335 Bacteria 7102
53 Ga0070666_10031488 3300005335 Bacteria 3501
54 Ga0070680_100000878 3300005336 Bacteria 21341
55 Ga0070682_100000015 3300005337 Bacteria 249390
56 Ga0070682_100001122 3300005337 Bacteria 15300
57 Ga0068868_100004734 3300005338 Bacteria 9556
58 Ga0068868_100158262 3300005338 Bacteria 1869
59 Ga0068868_100264975 3300005338 Bacteria 1450
60 Ga0068868_100269746 3300005338 Bacteria 1437
61 Ga0070660_100105936 3300005339 Unclassified 2232
62 Ga0070689_100465007 3300005340 Bacteria 1078
63 Ga0070691_10017297 3300005341 Bacteria 3317
64 Ga0070692_10416093 3300005345 Bacteria 852
65 Ga0070668_100061242 3300005347 Bacteria 2915
66 Ga0070668_100333339 3300005347 Bacteria 1280
67 Ga0070668_100637107 3300005347 Bacteria 935
68 Ga0070669_100000011 3300005353 Bacteria 216544
69 Ga0070669_100017262 3300005353 Bacteria 5148
70 Ga0070671_100102928 3300005355 Bacteria 2396
71 Ga0070671_100228278 3300005355 Bacteria 1580
72 Ga0070674_100198630 3300005356 Bacteria 1547
73 Ga0070673_100284812 3300005364 Bacteria 1450
74 Ga0070673_100304793 3300005364 Unclassified 1403
75 Ga0070688_100119306 3300005365 Bacteria 1764
76 Ga0070667_100013413 3300005367 Bacteria 6774
77 Ga0070667_100044613 3300005367 Bacteria 3724
78 Ga0070700_100000102 3300005441 Bacteria 53719
79 Ga0070694_100216474 3300005444 Bacteria 1435
80 Ga0070663_100005807 3300005455 Bacteria 7372
81 Ga0070678_100078718 3300005456 Bacteria 2491
82 Ga0070681_10028566 3300005458 Bacteria 5608
83 Ga0068867_100341318 3300005459 Bacteria 1247
84 Ga0070685_10055087 3300005466 Bacteria 2310
85 Ga0070685_10080154 3300005466 Bacteria 1955
86 Ga0070685_10286675 3300005466 Bacteria 1104
87 Ga0070706_100222188 3300005467 Bacteria 1763
88 Ga0070679_100000398 3300005530 Bacteria 37016
89 Ga0070679_100003316 3300005530 Bacteria 14753
90 Ga0070684_100109828 3300005535 Unclassified 2472
91 Ga0070684_100117227 3300005535 Bacteria 2393
92 Ga0070697_100020693 3300005536 Bacteria 5207
93 Ga0068853_100010927 3300005539 Bacteria 7359
94 Ga0068853_100017299 3300005539 Bacteria 5952
95 Ga0068853_100084456 3300005539 Unclassified 2782
96 Ga0068853_100130161 3300005539 Bacteria 2252
97 Ga0068853_100204968 3300005539 Bacteria 1796
98 Ga0068853_100252884 3300005539 Bacteria 1617
99 Ga0070693_100000650 3300005547 Bacteria 15328
100 Ga0070665_100000006 3300005548 Bacteria 718034
101 Ga0070665_100000139 3300005548 Bacteria 135881
102 Ga0070704_100014221 3300005549 Bacteria 4967
103 Ga0068855_100029707 3300005563 Bacteria 6535
104 Ga0068855_100077659 3300005563 Bacteria 3853
105 Ga0068855_100138670 3300005563 Unclassified 2774
106 Ga0068855_100224589 3300005563 Bacteria 2105
107 Ga0068855_100259037 3300005563 Bacteria 1938
108 Ga0068857_100001316 3300005577 Bacteria 19543
109 Ga0068857_100078482 3300005577 Bacteria 2947
110 Ga0068854_100381614 3300005578 Bacteria 1161
111 Ga0068856_100097121 3300005614 Bacteria 2935
112 Ga0070702_100071228 3300005615 Bacteria 2054
113 Ga0068852_100001166 3300005616 Bacteria 17391
114 Ga0068852_100002787 3300005616 Bacteria 12105
115 Ga0068852_100009916 3300005616 Bacteria 7093
116 Ga0068852_100026395 3300005616 Bacteria 4720
117 Ga0068852_100036902 3300005616 Bacteria 4095
118 Ga0068859_100000011 3300005617 Bacteria 309687
119 Ga0068859_100013654 3300005617 Bacteria 8143
120 Ga0068859_100039542 3300005617 Bacteria 4732
121 Ga0068859_100067304 3300005617 Bacteria 3616
122 Ga0068864_100009257 3300005618 Bacteria 8121
123 Ga0068864_100201391 3300005618 Bacteria 1829
124 Ga0068864_100480459 3300005618 Unclassified 1192
125 Ga0068866_10276168 3300005718 Bacteria 1039
126 Ga0068861_100379733 3300005719 Bacteria 1248
127 Ga0068851_10012661 3300005834 Bacteria 3982
128 Ga0068863_100005978 3300005841 Bacteria 11939
129 Ga0068863_100017784 3300005841 Bacteria 6803
130 Ga0068863_100052271 3300005841 Bacteria 3872
131 Ga0068858_100046101 3300005842 Bacteria 4041
132 Ga0068858_100169837 3300005842 Bacteria 2056
133 Ga0068858_100461936 3300005842 Bacteria 1224
134 Ga0068860_100000005 3300005843 Bacteria 472349
135 Ga0068860_100001923 3300005843 Bacteria 21994
136 Ga0068860_100002561 3300005843 Bacteria 19014
137 Ga0068860_100003920 3300005843 Bacteria 15287
138 Ga0068860_100488887 3300005843 Bacteria 1227
139 Ga0068860_100662269 3300005843 Bacteria 1052
140 Ga0081455_10003869 3300005937 Bacteria 17062
141 Ga0081540_1020082 3300005983 Bacteria 4032
142 Ga0081539_10003256 3300005985 Bacteria 20379
143 Ga0075366_10050396 3300006195 Bacteria 2472
144 Ga0075366_10106217 3300006195 Bacteria 1688
145 Ga0097621_100002185 3300006237 Bacteria 13386
146 Ga0097621_100637491 3300006237 Bacteria 977
147 Ga0068871_100019766 3300006358 Bacteria 5146
148 Ga0068871_100113091 3300006358 Bacteria 2286
149 Ga0068871_100368432 3300006358 Bacteria 1274
150 Ga0075431_100000720 3300006847 Bacteria 28520
151 Ga0075431_100053263 3300006847 Bacteria 4172
152 Ga0075434_100005109 3300006871 Bacteria 11916
153 Ga0075434_100227180 3300006871 Bacteria 1886
154 Ga0075434_100329091 3300006871 Bacteria 1548
155 Ga0075434_100367612 3300006871 Bacteria 1459
156 Ga0075429_100106113 3300006880 Bacteria 2454
157 Ga0068865_100567849 3300006881 Bacteria 955
158 Ga0097620_100000011 3300006931 Bacteria 309687
159 Ga0097620_100013654 3300006931 Bacteria 8143
160 Ga0097620_100039542 3300006931 Bacteria 4732
161 Ga0097620_100067307 3300006931 Bacteria 3616
162 Ga0105244_10012248 3300009036 Bacteria 5080
163 Ga0105240_10000140 3300009093 Bacteria 148591
164 Ga0105240_10000419 3300009093 Bacteria 78633
165 Ga0105240_10001671 3300009093 Bacteria 37660
166 Ga0105240_10002364 3300009093 Bacteria 30415
167 Ga0105240_10026048 3300009093 Bacteria 7679
168 Ga0105240_10056829 3300009093 Bacteria 4895
169 Ga0105240_10070744 3300009093 Bacteria 4316
170 Ga0105240_10169808 3300009093 Bacteria 2584
171 Ga0105240_10186537 3300009093 Bacteria 2442
172 Ga0105240_10456337 3300009093 Bacteria 1429
173 Ga0105240_10711610 3300009093 Bacteria 1095
174 Ga0105245_10639164 3300009098 Bacteria 1093
175 Ga0105247_10022031 3300009101 Bacteria 3835
176 Ga0114129_10021791 3300009147 Bacteria 9096
177 Ga0105243_10000046 3300009148 Bacteria 155277
178 Ga0105241_10003484 3300009174 Bacteria 11705
179 Ga0105241_10006161 3300009174 Bacteria 8845
180 Ga0105241_10009180 3300009174 Bacteria 7279
181 Ga0105241_10040937 3300009174 Bacteria 3499
182 Ga0105241_10170247 3300009174 Bacteria 1798
183 Ga0105241_10429835 3300009174 Bacteria 1164
184 Ga0105242_10377038 3300009176 Bacteria 1318
185 Ga0105242_11085776 3300009176 Bacteria 813
186 Ga0105248_10665272 3300009177 Bacteria 1175
187 Ga0105237_10000390 3300009545 Bacteria 62424
188 Ga0105237_10002312 3300009545 Bacteria 23678
189 Ga0105237_10011376 3300009545 Bacteria 9413
190 Ga0105237_10022955 3300009545 Bacteria 6398
191 Ga0105237_10067355 3300009545 Bacteria 3574
192 Ga0105237_10103921 3300009545 Bacteria 2833
193 Ga0105238_10010129 3300009551 Bacteria 9453
194 Ga0105238_10029135 3300009551 Bacteria 5625
195 Ga0105238_10070744 3300009551 Bacteria 3487
196 Ga0105238_10083693 3300009551 Bacteria 3179
197 Ga0105249_10084947 3300009553 Bacteria 2948
198 Ga0105249_10111323 3300009553 Unclassified 2589
199 Ga0105239_10000093 3300010375 Bacteria 125821
200 Ga0105239_10002826 3300010375 Bacteria 21717
201 Ga0105239_10006736 3300010375 Bacteria 13273
202 Ga0105239_10061586 3300010375 Bacteria 4119
203 Ga0105239_10081746 3300010375 Bacteria 3556
204 Ga0105239_10119469 3300010375 Unclassified 2925
205 Ga0105239_10145959 3300010375 Bacteria 2638
206 Ga0105239_10147561 3300010375 Bacteria 2624
207 Ga0105246_10022431 3300011119 Bacteria 4073
208 Ga0157371_10000076 3300013102 Bacteria 161805
209 Ga0157371_10003455 3300013102 Bacteria 14322
210 Ga0157370_10003006 3300013104 Bacteria 20011
211 Ga0157370_10003873 3300013104 Bacteria 17430
212 Ga0157370_10007415 3300013104 Bacteria 11943
213 Ga0157370_10034523 3300013104 Bacteria 4923
214 Ga0157370_10042959 3300013104 Bacteria 4352
215 Ga0157370_10083964 3300013104 Bacteria 2994
216 Ga0157370_10104991 3300013104 Bacteria 2645
217 Ga0157370_10170202 3300013104 Unclassified 2025
218 Ga0157370_10194856 3300013104 Bacteria 1881
219 Ga0157370_10307374 3300013104 Bacteria 1463
220 Ga0157369_10000007 3300013105 Bacteria 402562
221 Ga0157369_10000461 3300013105 Bacteria 54029
222 Ga0157369_10061089 3300013105 Bacteria 4063
223 Ga0157369_10124911 3300013105 Bacteria 2729
224 Ga0157369_10167491 3300013105 Bacteria 2316
225 Ga0157374_10000004 3300013296 Bacteria 759774
226 Ga0157374_10182361 3300013296 Bacteria 2051
227 Ga0157374_11251229 3300013296 Bacteria 764
228 Ga0157378_10045074 3300013297 Bacteria 3918
229 Ga0157378_10055052 3300013297 Bacteria 3543
230 Ga0157378_10182995 3300013297 Bacteria 1972
231 Ga0163162_10000035 3300013306 Bacteria 147102
232 Ga0163162_10005547 3300013306 Bacteria 12200
233 Ga0163162_10031627 3300013306 Bacteria 5250
234 Ga0163162_10079249 3300013306 Bacteria 3351
235 Ga0163162_10096379 3300013306 Bacteria 3046
236 Ga0163162_10251694 3300013306 Bacteria 1898
237 Ga0163162_10540197 3300013306 Unclassified 1294
238 Ga0157372_10000001 3300013307 Bacteria 791349
239 Ga0157372_10000052 3300013307 Bacteria 135497
240 Ga0157372_10008256 3300013307 Bacteria 11071
241 Ga0157372_10055789 3300013307 Unclassified 4413
242 Ga0157372_10109475 3300013307 Bacteria 3164
243 Ga0157372_10121203 3300013307 Bacteria 3004
244 Ga0157372_10155631 3300013307 Bacteria 2640
245 Ga0157372_11158708 3300013307 Bacteria 894
246 Ga0157375_10000047 3300013308 Bacteria 141526
247 Ga0157375_10192383 3300013308 Bacteria 2195
248 Ga0157375_10245141 3300013308 Bacteria 1952
249 Ga0157375_10268339 3300013308 Bacteria 1868
250 Ga0157375_10349206 3300013308 Bacteria 1645
251 Ga0163163_10189424 3300014325 Bacteria 2105
252 Ga0157380_10511169 3300014326 Bacteria 1169
253 Ga0182008_10000222 3300014497 Bacteria 44722
254 Ga0157376_10001819 3300014969 Bacteria 14199
255 Ga0157376_10002899 3300014969 Bacteria 11760
256 Ga0182006_1000220 3300015261 Bacteria 55777
257 Ga0182006_1000233 3300015261 Bacteria 52709
258 Ga0182006_1087055 3300015261 Bacteria 1129
259 Ga0182007_10000007 3300015262 Bacteria 376596
260 Ga0182005_1000040 3300015265 Bacteria 151222
261 Ga0183373_1001 3300015682 Bacteria 1410374
262 Ga0163161_10000130 3300017792 Bacteria 70533
263 Ga0163161_10002968 3300017792 Bacteria 12021
264 Ga0163161_10003393 3300017792 Bacteria 11184
265 Ga0213876_10005187 3300021384 Bacteria 7187
266 Ga0209436_101120 3300025208 Bacteria 9942
267 Ga0209258_100356 3300025242 Bacteria 62716
268 Ga0207425_1000023 3300025245 Bacteria 341339
269 Ga0209646_1000025 3300025246 Bacteria 406493
270 Ga0209026_1000380 3300025250 Bacteria 40692
271 Ga0209148_1000129 3300025254 Bacteria 175720
272 Ga0209129_1000032 3300025258 Bacteria 341150
273 Ga0209455_1000026 3300025272 Bacteria 653778
274 Ga0209673_1000085 3300025273 Bacteria 215647
275 Ga0209130_1002305 3300025284 Bacteria 9768
276 Ga0209675_1022540 3300025291 Bacteria 1652
277 Ga0209676_1000201 3300025292 Bacteria 133195
278 Ga0209025_1000047 3300025294 Bacteria 341150
279 Ga0209564_1003860 3300025295 Bacteria 9659
280 Ga0209758_1000144 3300025297 Bacteria 170724
281 Ga0209758_1012637 3300025297 Bacteria 4703
282 Ga0209758_1014696 3300025297 Bacteria 4138
283 Ga0209758_1025035 3300025297 Bacteria 2634
284 Ga0209758_1073087 3300025297 Unclassified 1070
285 Ga0209050_1000203 3300025298 Bacteria 133156
286 Ga0209050_1000524 3300025298 Bacteria 63793
287 Ga0207426_1000057 3300025302 Bacteria 369548
288 Ga0207426_1000261 3300025302 Bacteria 112697
289 Ga0207426_1004611 3300025302 Bacteria 6638
290 Ga0207426_1006919 3300025302 Bacteria 4822
291 Ga0209257_1000004 3300025304 Bacteria 1678347
292 Ga0209257_1005255 3300025304 Bacteria 9237
293 Ga0207655_1056887 3300025728 Bacteria 1539
294 Ga0207682_10015472 3300025893 Unclassified 2969
295 Ga0207710_10008199 3300025900 Bacteria 4410
296 Ga0207680_10000228 3300025903 Bacteria 27141
297 Ga0207647_10065536 3300025904 Bacteria 2204
298 Ga0207705_10482521 3300025909 Bacteria 962
299 Ga0207654_10004675 3300025911 Bacteria 6924
300 Ga0207654_10013126 3300025911 Unclassified 4257
301 Ga0207654_10017743 3300025911 Bacteria 3726
302 Ga0207654_10108666 3300025911 Bacteria 1721
303 Ga0207707_10000722 3300025912 Bacteria 32676
304 Ga0207707_10036114 3300025912 Bacteria 4321
305 Ga0207695_10000027 3300025913 Bacteria 612456
306 Ga0207695_10000164 3300025913 Bacteria 196777
307 Ga0207695_10003547 3300025913 Bacteria 21861
308 Ga0207695_10023732 3300025913 Bacteria 6921
309 Ga0207695_10034360 3300025913 Bacteria 5515
310 Ga0207695_10038685 3300025913 Bacteria 5133
311 Ga0207695_10186053 3300025913 Bacteria 1996
312 Ga0207695_10221885 3300025913 Bacteria 1797
313 Ga0207671_10001247 3300025914 Bacteria 29996
314 Ga0207671_10001635 3300025914 Bacteria 25501
315 Ga0207671_10004939 3300025914 Bacteria 12506
316 Ga0207671_10242774 3300025914 Unclassified 1415
317 Ga0207671_10341463 3300025914 Bacteria 1186
318 Ga0207671_10667057 3300025914 Bacteria 828
319 Ga0207693_10257495 3300025915 Bacteria 1369
320 Ga0207660_10004797 3300025917 Bacteria 8795
321 Ga0207657_10025764 3300025919 Bacteria 5417
322 Ga0207652_10006617 3300025921 Bacteria 9340
323 Ga0207652_10069673 3300025921 Bacteria 3054
324 Ga0207681_10000012 3300025923 Bacteria 361565
325 Ga0207681_10053814 3300025923 Bacteria 2734
326 Ga0207694_10019125 3300025924 Bacteria 5178
327 Ga0207694_10023285 3300025924 Unclassified 4702
328 Ga0207694_10050498 3300025924 Bacteria 3221
329 Ga0207694_10056158 3300025924 Bacteria 3058
330 Ga0207700_10425131 3300025928 Bacteria 1167
331 Ga0207644_10206585 3300025931 Bacteria 1551
332 Ga0207644_10345614 3300025931 Bacteria 1207
333 Ga0207690_10204777 3300025932 Bacteria 1501
334 Ga0207686_10200092 3300025934 Bacteria 1430
335 Ga0207709_10000020 3300025935 Bacteria 392366
336 Ga0207670_10080714 3300025936 Bacteria 2274
337 Ga0207670_10142134 3300025936 Bacteria 1771
338 Ga0207669_10263127 3300025937 Bacteria 1291
339 Ga0207704_10497020 3300025938 Bacteria 982
340 Ga0207691_10137081 3300025940 Bacteria 2158
341 Ga0207691_10461343 3300025940 Unclassified 1081
342 Ga0207689_10009695 3300025942 Bacteria 8295
343 Ga0207689_10115395 3300025942 Bacteria 2207
344 Ga0207689_10151400 3300025942 Bacteria 1912
345 Ga0207661_10157990 3300025944 Bacteria 1965
346 Ga0207667_10002024 3300025949 Bacteria 25418
347 Ga0207667_10063189 3300025949 Bacteria 3869
348 Ga0207667_10144494 3300025949 Bacteria 2449
349 Ga0207667_10177371 3300025949 Bacteria 2189
350 Ga0207667_10401637 3300025949 Bacteria 1395
351 Ga0207651_10063857 3300025960 Bacteria 2574
352 Ga0207651_10297158 3300025960 Bacteria 1341
353 Ga0207712_10009009 3300025961 Bacteria 6313
354 Ga0207712_10016687 3300025961 Bacteria 4759
355 Ga0207668_10043711 3300025972 Bacteria 3043
356 Ga0207668_10592526 3300025972 Bacteria 965
357 Ga0207640_10071765 3300025981 Bacteria 2333
358 Ga0207640_10363459 3300025981 Bacteria 1167
359 Ga0207658_10497426 3300025986 Bacteria 1085
360 Ga0207677_10049146 3300026023 Bacteria 2844
361 Ga0207677_10417611 3300026023 Bacteria 1142
362 Ga0207703_10004767 3300026035 Bacteria 11059
363 Ga0207639_10016287 3300026041 Bacteria 5255
364 Ga0207639_10032202 3300026041 Bacteria 3858
365 Ga0207639_10034683 3300026041 Bacteria 3731
366 Ga0207639_10082848 3300026041 Bacteria 2544
367 Ga0207639_10599231 3300026041 Bacteria 1016
368 Ga0207639_10822897 3300026041 Bacteria 866
369 Ga0207678_10012680 3300026067 Bacteria 7406
370 Ga0207678_10544187 3300026067 Bacteria 1015
371 Ga0207708_10000021 3300026075 Bacteria 186005
372 Ga0207702_10058064 3300026078 Bacteria 3292
373 Ga0207702_10898410 3300026078 Bacteria 878
374 Ga0207641_10000158 3300026088 Bacteria 96378
375 Ga0207641_10006686 3300026088 Bacteria 9667
376 Ga0207648_10847054 3300026089 Bacteria 853
377 Ga0207676_10004127 3300026095 Bacteria 10254
378 Ga0207676_10180655 3300026095 Bacteria 1847
379 Ga0207674_10016794 3300026116 Bacteria 8002
380 Ga0207674_10070485 3300026116 Bacteria 3515
381 Ga0207698_10001210 3300026142 Bacteria 15065
382 Ga0207698_10008221 3300026142 Bacteria 6582
383 Ga0207698_10014430 3300026142 Bacteria 5251
384 Ga0207698_10049231 3300026142 Bacteria 3206
385 Ga0268266_10000010 3300028379 Bacteria 1030233
386 Ga0268266_10004453 3300028379 Bacteria 13399
387 Ga0268265_10472501 3300028380 Bacteria 1176
388 Ga0268264_10000012 3300028381 Bacteria 521740
389 Ga0268264_10009194 3300028381 Bacteria 8187
390 Ga0268264_10031602 3300028381 Bacteria 4340
391 Ga0307517_10157592 3300028786 Bacteria 1535
392 Ga0307517_10196962 3300028786 Bacteria 1267
393 Ga0307515_10000002 3300028794 Bacteria 1231751
394 Ga0265338_10074654 3300028800 Unclassified 2882
395 Ga0307511_10000850 3300030521 Bacteria 32503
396 Ga0316177_1035139 3300030731 Bacteria 21564
397 Ga0316176_1042321 3300030732 Bacteria 10512
398 Ga0316183_1134560 3300030742 Bacteria 13366
399 Ga0316181_1167506 3300030744 Bacteria 16152
400 Ga0316182_1005945 3300030745 Bacteria 2146
401 Ga0265340_10157090 3300031247 Eukaryota 1035
402 Ga0265327_10000488 3300031251 Bacteria 69809
403 Ga0265316_10011620 3300031344 Bacteria 7928
404 Ga0265316_10024806 3300031344 Bacteria 5013
405 Ga0307513_10095002 3300031456 Bacteria 3024
406 Ga0307513_10128438 3300031456 Bacteria 2485
407 Ga0307509_10264318 3300031507 Bacteria 1493
408 Ga0307509_10290943 3300031507 Bacteria 1388
409 Ga0307408_100111614 3300031548 Bacteria 2101
410 Ga0307508_10001227 3300031616 Bacteria 29288
411 Ga0307508_10229940 3300031616 Bacteria 1453
412 Ga0307516_10002277 3300031730 Bacteria 25890
413 Ga0307405_10000037 3300031731 Bacteria 91045
414 Ga0307405_10033941 3300031731 Bacteria 3032
415 Ga0307413_10008102 3300031824 Bacteria 4935
416 Ga0307518_10045018 3300031838 Bacteria 3210
417 Ga0307407_10000025 3300031903 Bacteria 112811
418 Ga0307407_10262336 3300031903 Bacteria 1189
419 Ga0307412_10097081 3300031911 Bacteria 2076
420 Ga0307412_10329066 3300031911 Bacteria 1219
421 Ga0307409_100005817 3300031995 Bacteria 7154
422 Ga0307416_100000068 3300032002 Bacteria 86974
423 Ga0307416_100011062 3300032002 Bacteria 5998
424 Ga0307414_10001935 3300032004 Bacteria 10717
425 Ga0307414_10018687 3300032004 Bacteria 4275
426 Ga0307414_10220546 3300032004 Bacteria 1557
427 Ga0307414_10236412 3300032004 Bacteria 1510
428 Ga0307414_10281480 3300032004 Bacteria 1398
429 Ga0307414_10355908 3300032004 Bacteria 1258
430 Ga0307415_100127958 3300032126 Bacteria 1917
431 Ga0307415_100555413 3300032126 Bacteria 1014
432 Ga0307510_10007660 3300033180 Bacteria 12874
433 Ga0307510_10303575 3300033180 Bacteria 1058
434 Ga0316574_0108115 3300035398 Bacteria 1782
435 Ga0373935_0325288 3300035692 Bacteria 1092
436 Ga0316584_0166051 3300036712 Bacteria 1639
437 Ga0395899_0000844 3300037312 Bacteria 29507
438 Ga0395899_0066596 3300037312 Bacteria 2644
439 Ga0395899_0336844 3300037312 Bacteria 1012
440 Ga0395900_0009771 3300037418 Bacteria 9831
441 Ga0395900_0014052 3300037418 Bacteria 8175
442 Ga0395900_0113365 3300037418 Bacteria 2783
443 Ga0395900_0148325 3300037418 Bacteria 2398
444 Ga0395898_0019394 3300037466 Bacteria 6922
445 Ga0395898_0073271 3300037466 Bacteria 3308
446 Ga0395898_0201687 3300037466 Bacteria 1899
447 Ga0395898_0311010 3300037466 Bacteria 1503
448 Ga0395898_0759827 3300037466 Bacteria 910
449 Ga0395905_0044068 3300037471 Bacteria 4186
450 Ga0395905_0079111 3300037471 Bacteria 3081
451 Ga0395901_0000076 3300038443 Bacteria 138169
452 Ga0395901_0106738 3300038443 Bacteria 2939
453 Ga0395901_0141436 3300038443 Bacteria 2529
454 Ga0395901_0152560 3300038443 Bacteria 2427
455 Ga0395901_0175371 3300038443 Bacteria 2249
456 Ga0395901_0713132 3300038443 Bacteria 999
457 Ga0400489_75466 3300039093 Bacteria 3083
458 Ga0436365_0914891 3300039437 Bacteria 6129
459 Ga0436365_1251897 3300039437 Bacteria 24739
460 Ga0439448_0024166 3300042005 Bacteria 1899
461 Ga0439449_0004582 3300042007 Bacteria 5343
462 Ga0439449_0124594 3300042007 Bacteria 957
463 Ga0439450_023135 3300042008 Bacteria 1346
464 Ga0450898_000822 3300042134 Bacteria 3845
465 Ga0439446_0059122 3300042156 Bacteria 1157
466 Ga0466969_0032078 3300044656 Bacteria 2672
467 Ga0466969_0102706 3300044656 Bacteria 1344
468 Ga0466972_0010933 3300044658 Bacteria 4555
469 Ga0466972_0016536 3300044658 Bacteria 3688
470 Ga0466972_0047289 3300044658 Bacteria 2081
471 Ga0466972_0064704 3300044658 Bacteria 1750
472 Ga0466966_0004496 3300044684 Bacteria 9200
473 Ga0466966_0079420 3300044684 Bacteria 2045
474 Ga0466966_0152009 3300044684 Unclassified 1411
475 Ga0466961_0011577 3300044693 Bacteria 5639
476 Ga0466961_0045589 3300044693 Bacteria 2805
477 Ga0466961_0168574 3300044693 Unclassified 1362
478 Ga0466961_0358031 3300044693 Bacteria 888
479 Ga0466964_0013061 3300044706 Bacteria 3147
480 Ga0466964_0112667 3300044706 Bacteria 1215
481 Ga0453684_0136467 3300044712 Bacteria 2936
482 Ga0453684_0414374 3300044712 Bacteria 1506
483 Ga0466968_0017676 3300044735 Bacteria 2854
484 Ga0466970_0012503 3300044765 Bacteria 4343
485 Ga0466957_0087890 3300044842 Bacteria 1944
486 Ga0466959_0003751 3300045049 Bacteria 10057
487 Ga0466959_0005020 3300045049 Bacteria 8987
488 Ga0466959_0304006 3300045049 Bacteria 1092
489 Ga0466958_0026405 3300045836 Bacteria 3432
490 Ga0466958_0367920 3300045836 Bacteria 926
491 Ga0495627_007447 3300046453 Bacteria 4191
492 Ga0495592_0122497 3300046454 Bacteria 1827
493 Ga0495641_0102548 3300046461 Unclassified 1276
494 Ga0495651_0130455 3300046462 Bacteria 1835
495 Ga0495653_0071695 3300046463 Bacteria 2589
496 Ga0495580_0507971 3300046472 Bacteria 804
497 Ga0495664_0053179 3300046477 Bacteria 2408
498 Ga0495606_0005801 3300046507 Bacteria 11655
499 Ga0495610_0002219 3300046512 Bacteria 16439
500 Ga0495610_0004850 3300046512 Bacteria 9786
501 Ga0495618_0075273 3300046514 Bacteria 2150
502 Ga0495618_0133221 3300046514 Bacteria 1590
503 Ga0495628_0030393 3300046516 Bacteria 4373
504 Ga0495630_0129445 3300046517 Bacteria 1916
505 Ga0495648_0026544 3300046524 Unclassified 3896
506 Ga0495666_0155570 3300046526 Bacteria 1062
507 Ga0495587_0296568 3300046536 Bacteria 904
508 Ga0495645_0001391 3300046543 Bacteria 16347
509 Ga0495645_0028618 3300046543 Bacteria 4050
510 Ga0495633_0000017 3300046558 Bacteria 249973
511 Ga0495633_0012073 3300046558 Bacteria 4613
512 Ga0495667_0177772 3300046559 Bacteria 1366
513 Ga0495656_0182621 3300046615 Bacteria 1032
514 Ga0495668_0001808 3300046616 Bacteria 19480
515 Ga0495634_0021990 3300046642 Bacteria 4498
516 Ga0495611_0000038 3300046648 Bacteria 100121
517 Ga0495611_0099588 3300046648 Unclassified 1349
518 Ga0495625_0084598 3300046660 Bacteria 2203
519 Ga0495613_0005144 3300046689 Bacteria 9815
520 Ga0495613_0032396 3300046689 Bacteria 3883
521 Ga0495600_0046573 3300046809 Bacteria 2829
522 Ga0495600_0150162 3300046809 Bacteria 1509
523 Ga0495674_0016152 3300047319 Bacteria 6968
524 Ga0495674_0142519 3300047319 Bacteria 2014
525 Ga0495672_0004265 3300047320 Bacteria 11805
526 Ga0495680_0165613 3300047322 Bacteria 1603
527 Ga0495680_0270486 3300047322 Bacteria 1200
528 Ga0495687_000243 3300047443 Bacteria 75026
529 Ga0495675_0138570 3300047444 Bacteria 1509
530 Ga0495679_004166 3300047446 Bacteria 6752
531 Ga0495684_0021293 3300047471 Bacteria 4994
532 Ga0495684_0025538 3300047471 Bacteria 4538
533 Ga0495686_0000058 3300047472 Bacteria 240089
534 Ga0495686_0017519 3300047472 Bacteria 4822
535 Ga0496102_0795186 3300048905 Bacteria 868
536 Ga0496103_0195150 3300048906 Bacteria 1302
537 Ga0496104_0418645 3300048907 Bacteria 1252
538 Ga0496105_0035928 3300048908 Bacteria 4081
539 Ga0496106_0010094 3300048909 Bacteria 6976
540 Ga0496112_0758954 3300048915 Bacteria 896
541 Ga0496115_0492952 3300048918 Bacteria 985
542 Ga0496116_0001204 3300048919 Bacteria 30298
543 Ga0496117_0002757 3300048920 Bacteria 21518
544 Ga0496118_0121451 3300048921 Bacteria 1702
545 Ga0496121_0000010 3300048924 Bacteria 793488
546 Ga0496122_0000561 3300048925 Bacteria 76046
547 Ga0496122_0020542 3300048925 Bacteria 5958
548 Ga0496123_0001189 3300048926 Bacteria 38315
549 Ga0496123_0019831 3300048926 Bacteria 5280
550 Ga0496124_0000508 3300048927 Bacteria 66913
551 Ga0501031_0157671 3300049568 Bacteria 1484
552 Ga0501032_0011617 3300049569 Bacteria 6316
553 Ga0501032_0054008 3300049569 Bacteria 2705
554 Ga0501033_0240003 3300049570 Bacteria 1286
555 Ga0501034_0001100 3300049571 Bacteria 38025
556 Ga0501034_0005663 3300049571 Bacteria 13592
557 Ga0501034_0016302 3300049571 Bacteria 7628
558 Ga0501034_0134743 3300049571 Bacteria 2451
559 Ga0501034_0555672 3300049571 Bacteria 1057
560 Ga0501036_0563249 3300049572 Bacteria 946
561 Ga0501037_0021267 3300049573 Bacteria 4794
562 Ga0501038_0000440 3300049574 Bacteria 36195
563 Ga0501038_0209604 3300049574 Bacteria 1560
564 Ga0501043_0003830 3300049579 Bacteria 12375
565 Ga0501046_0006720 3300049580 Bacteria 10156
566 Ga0501047_0010701 3300049581 Bacteria 8669
567 Ga0501047_0030967 3300049581 Bacteria 5158
568 Ga0501047_0083198 3300049581 Bacteria 3076
569 Ga0501047_0515294 3300049581 Unclassified 1022
570 Ga0501047_0570577 3300049581 Bacteria 955
571 Ga0501048_0542056 3300049582 Bacteria 835
572 Ga0501067_0080868 3300049583 Bacteria 1801
573 Ga0501072_0433818 3300049588 Bacteria 1041
574 Ga0501073_0002013 3300049589 Bacteria 15173
575 Ga0501073_0411181 3300049589 Bacteria 935
576 Ga0501074_0002600 3300049590 Bacteria 12616
577 Ga0501219_000271 3300049703 Bacteria 9199
578 Ga0501225_0035699 3300049705 Bacteria 1369
579 Ga0501079_0044871 3300049741 Bacteria 3412
580 Ga0501080_0018745 3300049742 Bacteria 6404
581 Ga0501080_0181426 3300049742 Bacteria 1937
582 Ga0501080_0406615 3300049742 Unclassified 1224
583 Ga0501083_0003280 3300049744 Bacteria 11303
584 Ga0501083_0012750 3300049744 Bacteria 5878
585 Ga0501241_000065 3300049758 Bacteria 26175
586 Ga0501035_0002949 3300049822 Bacteria 16363
587 Ga0501035_0079018 3300049822 Bacteria 2906
588 Ga0501035_0336413 3300049822 Bacteria 1266
589 Ga0501044_0028667 3300049823 Bacteria 5875
590 Ga0501044_0045316 3300049823 Bacteria 4557
591 Ga0501044_0124154 3300049823 Bacteria 2580
592 Ga0501044_0164390 3300049823 Bacteria 2194
593 Ga0501044_0224147 3300049823 Bacteria 1830
594 Ga0501044_0330125 3300049823 Bacteria 1448
595 Ga0501044_0474163 3300049823 Bacteria 1155
596 nmdc:mga0k408_83018_c1 3300050493 Bacteria 1878
597 nmdc:mga05p37_5997_c1 3300050507 Bacteria 14305
598 nmdc:mga09592_13372_c1 3300050508 Bacteria 6702
599 nmdc:mga0qj67_90651_c1 3300050509 Bacteria 2456
600 nmdc:mga08y16_216972_c1 3300050511 Bacteria 1981
601 nmdc:mga0n895_174419_c1 3300050512 Bacteria 2181
602 nmdc:mga0n895_4449_c1 3300050512 Bacteria 11512
603 nmdc:mga0n895_80619_c1 3300050512 Bacteria 3243
604 Ga0500644_0002591 3300053088 Bacteria 4516
605 Ga0500644_0071148 3300053088 Bacteria 1254
606 Ga0500583_0015747 3300053092 Unclassified 3001
607 Ga0500651_0051214 3300053093 Bacteria 2589
608 Ga0500651_0183181 3300053093 Bacteria 1243
609 Ga0500566_0168173 3300053094 Bacteria 1136
610 Ga0500569_000396 3300053109 Bacteria 7076
611 Ga0500618_017751 3300053125 Bacteria 1767
612 Ga0500642_0010291 3300053130 Unclassified 3292
613 Ga0500658_0000574 3300053134 Bacteria 15463
614 Ga0500559_0033862 3300053136 Bacteria 2201
615 Ga0500559_0144518 3300053136 Bacteria 1115
616 Ga0500577_0001248 3300053142 Bacteria 6501
617 Ga0500588_0002432 3300053146 Bacteria 3782
618 Ga0500588_0127783 3300053146 Unclassified 902
619 Ga0500590_087079 3300053148 Bacteria 1523
620 Ga0500616_0003565 3300053153 Bacteria 11787
621 Ga0500616_0009931 3300053153 Bacteria 5729
622 Ga0500622_0000059 3300053156 Bacteria 134223
623 Ga0500622_0012858 3300053156 Bacteria 4523
624 Ga0500633_0000453 3300053160 Bacteria 6464
625 Ga0500636_0120446 3300053177 Bacteria 1473
626 Ga0501084_0169257 3300054114 Bacteria 1844
627 Ga0501084_0471611 3300054114 Bacteria 1061
628 Ga0501082_0108575 3300060353 Bacteria 2401
629 Ga0501082_0369824 3300060353 Bacteria 1251
630 Ga0501082_0503307 3300060353 Bacteria 1059

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005615 Ga0070702_100071228 Ga0070702_1000712282 199
2 3300006871 Ga0075434_100227180 Ga0075434_1002271802 199
3 3300050512 nmdc:mga0n895_174419_c1 nmdc:mga0n895_174419_c1_493_1185 199
4 3300005335 Ga0070666_10006667 Ga0070666_100066675 202
5 3300005329 Ga0070683_100120125 Ga0070683_1001201252 203
6 3300005330 Ga0070690_100313143 Ga0070690_1003131432 205
7 3300013308 Ga0157375_10349206 Ga0157375_103492062 205
8 3300060353 Ga0501082_0503307 Ga0501082_0503307_301_993 208
9 3300050511 nmdc:mga08y16_216972_c1 nmdc:mga08y16_216972_c1_1153_1935 210
10 3300005441 Ga0070700_100000102 Ga0070700_1000001022 215
11 3300026075 Ga0207708_10000021 Ga0207708_10000021134 215
12 3300005345 Ga0070692_10416093 Ga0070692_104160931 216
13 3300025915 Ga0207693_10257495 Ga0207693_102574952 216
14 3300025928 Ga0207700_10425131 Ga0207700_104251312 216
15 3300013296 Ga0157374_11251229 Ga0157374_112512291 218
16 3300025936 Ga0207670_10080714 Ga0207670_100807142 218
17 3300005337 Ga0070682_100000015 Ga0070682_100000015142 219
18 3300026089 Ga0207648_10847054 Ga0207648_108470541 219
19 3300005842 Ga0068858_100169837 Ga0068858_1001698371 220
20 3300038443 Ga0395901_0175371 Ga0395901_0175371_19_708 220
21 3300044693 Ga0466961_0358031 Ga0466961_0358031_11_700 220
22 3300005548 Ga0070665_100000006 Ga0070665_100000006114 221
23 3300013296 Ga0157374_10182361 Ga0157374_101823612 221
24 3300028379 Ga0268266_10000010 Ga0268266_10000010194 221
25 3300031616 Ga0307508_10001227 Ga0307508_1000122714 221
26 3300046472 Ga0495580_0507971 Ga0495580_0507971_76_768 221
27 3300048905 Ga0496102_0795186 Ga0496102_0795186_63_794 221
28 3300053146 Ga0500588_0127783 Ga0500588_0127783_170_862 221
29 iso_pu_bacteria 2710264753 2710605218 221
30 3300005347 Ga0070668_100637107 Ga0070668_1006371071 222
31 3300005365 Ga0070688_100119306 Ga0070688_1001193062 222
32 3300005466 Ga0070685_10055087 Ga0070685_100550872 222
33 3300025972 Ga0207668_10592526 Ga0207668_105925261 222
34 3300028379 Ga0268266_10004453 Ga0268266_1000445310 222
35 3300049744 Ga0501083_0003280 Ga0501083_0003280_673_1407 222
36 3300005353 Ga0070669_100000011 Ga0070669_10000001199 223
37 3300006871 Ga0075434_100367612 Ga0075434_1003676122 223
38 3300025923 Ga0207681_10000012 Ga0207681_10000012188 223
39 3300026078 Ga0207702_10898410 Ga0207702_108984101 223
40 3300050512 nmdc:mga0n895_80619_c1 nmdc:mga0n895_80619_c1_2184_2951 223
41 3300006881 Ga0068865_100567849 Ga0068865_1005678492 225
42 3300025938 Ga0207704_10497020 Ga0207704_104970201 225
43 3300005548 Ga0070665_100000139 Ga0070665_100000139130 227
44 3300031344 Ga0265316_10024806 Ga0265316_100248064 227
45 3300037466 Ga0395898_0073271 Ga0395898_0073271_2294_3049 227
46 3300031344 Ga0265316_10011620 Ga0265316_100116205 228
47 3300048907 Ga0496104_0418645 Ga0496104_0418645_414_1169 229
48 3300003354 JGI25160J50197_1006688 JGI25160J50197_10066884 230
49 3300005328 Ga0070676_10216074 Ga0070676_102160742 230
50 3300005549 Ga0070704_100014221 Ga0070704_1000142213 230
51 3300005617 Ga0068859_100000011 Ga0068859_10000001193 230
52 3300006931 Ga0097620_100000011 Ga0097620_100000011160 230
53 3300009174 Ga0105241_10040937 Ga0105241_100409372 230
54 3300025208 Ga0209436_101120 Ga0209436_1011202 230
55 3300025284 Ga0209130_1002305 Ga0209130_10023057 230
56 3300025302 Ga0207426_1000057 Ga0207426_1000057225 230
57 3300025942 Ga0207689_10151400 Ga0207689_101514002 230
58 3300025944 Ga0207661_10157990 Ga0207661_101579902 230
59 3300025949 Ga0207667_10144494 Ga0207667_101444941 230
60 3300048908 Ga0496105_0035928 Ga0496105_0035928_1844_2599 230
61 3300009177 Ga0105248_10665272 Ga0105248_106652722 231
62 3300047446 Ga0495679_004166 Ga0495679_004166_3378_4124 231
63 3300048925 Ga0496122_0000561 Ga0496122_0000561_47008_47781 232
64 3300048926 Ga0496123_0001189 Ga0496123_0001189_110_883 232
65 3300048927 Ga0496124_0000508 Ga0496124_0000508_28285_29058 232
66 3300053156 Ga0500622_0000059 Ga0500622_0000059_86712_87479 232
67 3300005327 Ga0070658_10039194 Ga0070658_100391943 233
68 3300006871 Ga0075434_100005109 Ga0075434_10000510912 233
69 3300013308 Ga0157375_10000047 Ga0157375_1000004740 233
70 3300050512 nmdc:mga0n895_4449_c1 nmdc:mga0n895_4449_c1_9302_10069 233
71 3300005985 Ga0081539_10003256 Ga0081539_100032566 234
72 3300013306 Ga0163162_10079249 Ga0163162_100792493 234
73 3300026067 Ga0207678_10544187 Ga0207678_105441871 234
74 3300003794 Ga0055531_10000102 Ga0055531_1000010274 235
75 3300010375 Ga0105239_10081746 Ga0105239_100817461 235
76 3300025304 Ga0209257_1000004 Ga0209257_10000041277 235
77 3300003323 rootH1_10002657 rootH1_100026574 236
78 3300003763 Ga0055529_1000421 Ga0055529_100042133 236
79 3300006847 Ga0075431_100000720 Ga0075431_1000007206 236
80 3300006880 Ga0075429_100106113 Ga0075429_1001061132 236
81 3300025272 Ga0209455_1000026 Ga0209455_1000026249 236
82 3300037312 Ga0395899_0066596 Ga0395899_0066596_1196_1951 236
83 3300037418 Ga0395900_0014052 Ga0395900_0014052_6225_6980 236
84 3300037471 Ga0395905_0079111 Ga0395905_0079111_301_1056 236
85 3300039437 Ga0436365_0914891 Ga0436365_0914891_331_1092 236
86 3300044706 Ga0466964_0112667 Ga0466964_0112667_162_917 236
87 3300045836 Ga0466958_0367920 Ga0466958_0367920_90_845 236
88 3300049823 Ga0501044_0224147 Ga0501044_0224147_797_1513 236
89 3300050508 nmdc:mga09592_13372_c1 nmdc:mga09592_13372_c1_783_1559 236
90 3300005329 Ga0070683_100159176 Ga0070683_1001591762 237
91 3300005444 Ga0070694_100216474 Ga0070694_1002164741 237
92 3300005536 Ga0070697_100020693 Ga0070697_1000206932 237
93 3300009093 Ga0105240_10711610 Ga0105240_107116101 237
94 3300009147 Ga0114129_10021791 Ga0114129_100217916 237
95 3300014326 Ga0157380_10511169 Ga0157380_105111692 237
96 3300038443 Ga0395901_0000076 Ga0395901_0000076_46569_47324 237
97 3300044684 Ga0466966_0079420 Ga0466966_0079420_1093_1875 237
98 3300046615 Ga0495656_0182621 Ga0495656_0182621_116_895 237
99 3300049822 Ga0501035_0002949 Ga0501035_0002949_14020_14775 237
100 3300050507 nmdc:mga05p37_5997_c1 nmdc:mga05p37_5997_c1_4072_4851 237
101 iso_pu_bacteria 2818991460 2819677872 237
102 iso_pu_bacteria 2855683550 2855686693 237
103 iso_pu_bacteria 2947224130 2947224259 237
104 iso_pu_bacteria 8003830390 8003834958 237
105 3300005334 Ga0068869_100099918 Ga0068869_1000999183 238
106 3300005843 Ga0068860_100001923 Ga0068860_1000019238 238
107 3300025942 Ga0207689_10115395 Ga0207689_101153953 238
108 3300032004 Ga0307414_10281480 Ga0307414_102814802 238
109 iso_pu_bacteria 2585427687 2586211134 238
110 iso_pu_bacteria 2738541302 2738856421 238
111 iso_pu_bacteria 2739367651 2739589257 238
112 iso_pu_bacteria 2739367663 2739647009 238
113 iso_pu_bacteria 2818991437 2819546831 238
114 iso_pu_bacteria 2842722452 2842725535 238
115 iso_pu_bacteria 2842909656 2842914682 238
116 iso_pu_bacteria 2849281842 2849283241 238
117 iso_pu_bacteria 2857627736 2857631426 238
118 iso_pu_bacteria 2904445276 2904447002 238
119 iso_pu_bacteria 2914759650 2914760425 238
120 iso_pu_bacteria 2945997725 2946002558 238
121 iso_pu_bacteria 2954016120 2954019396 238
122 iso_pu_bacteria 8003151029 8003151329 238
123 3300005289 Ga0065704_10095126 Ga0065704_100951261 239
124 3300005937 Ga0081455_10003869 Ga0081455_100038695 239
125 3300006847 Ga0075431_100053263 Ga0075431_1000532633 239
126 3300009093 Ga0105240_10456337 Ga0105240_104563372 239
127 3300009148 Ga0105243_10000046 Ga0105243_10000046101 239
128 3300009176 Ga0105242_11085776 Ga0105242_110857761 239
129 3300010375 Ga0105239_10147561 Ga0105239_101475613 239
130 3300013104 Ga0157370_10003006 Ga0157370_100030063 239
131 3300013104 Ga0157370_10104991 Ga0157370_101049913 239
132 3300015682 Ga0183373_1001 Ga0183373_1001116 239
133 3300025297 Ga0209758_1073087 Ga0209758_10730872 239
134 3300025932 Ga0207690_10204777 Ga0207690_102047772 239
135 3300025935 Ga0207709_10000020 Ga0207709_10000020241 239
136 3300031251 Ga0265327_10000488 Ga0265327_100004888 239
137 3300031548 Ga0307408_100111614 Ga0307408_1001116142 239
138 3300031731 Ga0307405_10033941 Ga0307405_100339412 239
139 3300032002 Ga0307416_100011062 Ga0307416_1000110626 239
140 3300032126 Ga0307415_100127958 Ga0307415_1001279582 239
141 3300037312 Ga0395899_0336844 Ga0395899_0336844_13_768 239
142 3300037466 Ga0395898_0759827 Ga0395898_0759827_24_779 239
143 3300037471 Ga0395905_0044068 Ga0395905_0044068_554_1309 239
144 3300038443 Ga0395901_0152560 Ga0395901_0152560_1628_2383 239
145 3300038443 Ga0395901_0713132 Ga0395901_0713132_14_769 239
146 3300042005 Ga0439448_0024166 Ga0439448_0024166_120_875 239
147 3300042008 Ga0439450_023135 Ga0439450_023135_98_853 239
148 3300044712 Ga0453684_0136467 Ga0453684_0136467_1435_2211 239
149 3300048906 Ga0496103_0195150 Ga0496103_0195150_433_1188 239
150 3300048909 Ga0496106_0010094 Ga0496106_0010094_999_1754 239
151 3300048915 Ga0496112_0758954 Ga0496112_0758954_16_771 239
152 3300048918 Ga0496115_0492952 Ga0496115_0492952_194_949 239
153 3300048919 Ga0496116_0001204 Ga0496116_0001204_20138_20908 239
154 3300048920 Ga0496117_0002757 Ga0496117_0002757_18444_19214 239
155 3300048921 Ga0496118_0121451 Ga0496118_0121451_901_1671 239
156 3300048925 Ga0496122_0020542 Ga0496122_0020542_481_1251 239
157 3300048926 Ga0496123_0019831 Ga0496123_0019831_2226_2996 239
158 3300049581 Ga0501047_0515294 Ga0501047_0515294_47_808 239
159 3300049582 Ga0501048_0542056 Ga0501048_0542056_58_813 239
160 3300050509 nmdc:mga0qj67_90651_c1 nmdc:mga0qj67_90651_c1_467_1237 239
161 3300053153 Ga0500616_0009931 Ga0500616_0009931_4132_4893 239
162 3300054114 Ga0501084_0169257 Ga0501084_0169257_1061_1816 239
163 iso_pu_bacteria 2739367656 2739614285 239
164 iso_pu_bacteria 2816332139 2816503455 239
165 iso_pu_bacteria 2818991442 2819572115 239
166 iso_pu_bacteria 2821136567 2821141642 239
167 iso_pu_bacteria 2890737413 2890738699 239
168 iso_pu_bacteria 2904467357 2904469944 239
169 iso_pu_bacteria 2929239360 2929245250 239
170 3300002459 JGI24751J29686_10022049 JGI24751J29686_100220492 240
171 3300002773 JGI25152J39213_1000173 JGI25152J39213_100017310 240
172 3300002774 JGI25150J39212_1000015 JGI25150J39212_1000015122 240
173 3300003187 JGI25151J46595_10000043 JGI25151J46595_1000004310 240
174 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009263 240
175 3300003316 rootH1_10044602 rootH1_100446022 240
176 3300003320 rootH2_10145766 rootH2_101457662 240
177 3300003781 Ga0055536_1000038 Ga0055536_10000389 240
178 3300003791 Ga0055530_10004665 Ga0055530_100046652 240
179 3300005288 Ga0065714_10064423 Ga0065714_10064423185 240
180 3300005289 Ga0065704_10182599 Ga0065704_101825992 240
181 3300005331 Ga0070670_100002522 Ga0070670_10000252215 240
182 3300005539 Ga0068853_100130161 Ga0068853_1001301612 240
183 3300005539 Ga0068853_100204968 Ga0068853_1002049682 240
184 3300005539 Ga0068853_100252884 Ga0068853_1002528843 240
185 3300005563 Ga0068855_100138670 Ga0068855_1001386702 240
186 3300005577 Ga0068857_100078482 Ga0068857_1000784824 240
187 3300005578 Ga0068854_100381614 Ga0068854_1003816142 240
188 3300005718 Ga0068866_10276168 Ga0068866_102761682 240
189 3300005719 Ga0068861_100379733 Ga0068861_1003797331 240
190 3300005843 Ga0068860_100488887 Ga0068860_1004888872 240
191 3300009036 Ga0105244_10012248 Ga0105244_100122483 240
192 3300009553 Ga0105249_10111323 Ga0105249_101113233 240
193 3300011119 Ga0105246_10022431 Ga0105246_100224312 240
194 3300013102 Ga0157371_10000076 Ga0157371_100000769 240
195 3300013104 Ga0157370_10003873 Ga0157370_100038735 240
196 3300013104 Ga0157370_10042959 Ga0157370_100429591 240
197 3300013105 Ga0157369_10000007 Ga0157369_10000007234 240
198 3300013306 Ga0163162_10000035 Ga0163162_1000003596 240
199 3300013306 Ga0163162_10251694 Ga0163162_102516942 240
200 3300013307 Ga0157372_10109475 Ga0157372_101094753 240
201 3300013308 Ga0157375_10245141 Ga0157375_102451412 240
202 3300014497 Ga0182008_10000222 Ga0182008_1000022240 240
203 3300015261 Ga0182006_1000220 Ga0182006_100022015 240
204 3300015261 Ga0182006_1000233 Ga0182006_100023325 240
205 3300015261 Ga0182006_1087055 Ga0182006_10870551 240
206 3300015262 Ga0182007_10000007 Ga0182007_10000007102 240
207 3300017792 Ga0163161_10000130 Ga0163161_1000013032 240
208 3300017792 Ga0163161_10002968 Ga0163161_100029687 240
209 3300017792 Ga0163161_10003393 Ga0163161_100033935 240
210 3300025245 Ga0207425_1000023 Ga0207425_1000023261 240
211 3300025258 Ga0209129_1000032 Ga0209129_100003211 240
212 3300025292 Ga0209676_1000201 Ga0209676_100020192 240
213 3300025294 Ga0209025_1000047 Ga0209025_100004711 240
214 3300025297 Ga0209758_1000144 Ga0209758_1000144119 240
215 3300025298 Ga0209050_1000203 Ga0209050_100020392 240
216 3300025728 Ga0207655_1056887 Ga0207655_10568872 240
217 3300025949 Ga0207667_10401637 Ga0207667_104016371 240
218 3300025961 Ga0207712_10016687 Ga0207712_100166873 240
219 3300025981 Ga0207640_10363459 Ga0207640_103634591 240
220 3300026041 Ga0207639_10034683 Ga0207639_100346834 240
221 3300026041 Ga0207639_10822897 Ga0207639_108228971 240
222 3300026116 Ga0207674_10070485 Ga0207674_100704853 240
223 3300031731 Ga0307405_10000037 Ga0307405_1000003757 240
224 3300031903 Ga0307407_10000025 Ga0307407_1000002547 240
225 3300031995 Ga0307409_100005817 Ga0307409_1000058174 240
226 3300032002 Ga0307416_100000068 Ga0307416_10000006832 240
227 3300032004 Ga0307414_10001935 Ga0307414_100019355 240
228 3300032004 Ga0307414_10018687 Ga0307414_100186871 240
229 3300032004 Ga0307414_10355908 Ga0307414_103559082 240
230 3300044712 Ga0453684_0414374 Ga0453684_0414374_728_1492 240
231 3300046461 Ga0495641_0102548 Ga0495641_0102548_400_1161 240
232 3300046512 Ga0495610_0002219 Ga0495610_0002219_2262_3026 240
233 3300046512 Ga0495610_0004850 Ga0495610_0004850_5716_6480 240
234 3300046558 Ga0495633_0012073 Ga0495633_0012073_2308_3072 240
235 3300047322 Ga0495680_0270486 Ga0495680_0270486_14_775 240
236 3300049589 Ga0501073_0411181 Ga0501073_0411181_62_826 240
237 3300053153 Ga0500616_0003565 Ga0500616_0003565_1936_2736 240
238 iso_pu_bacteria 2522125168 2522548101 240
239 iso_pu_bacteria 2721755487 2722725638 240
240 iso_pu_bacteria 2842903701 2842907313 240
241 iso_pu_bacteria 2896317667 2896320331 240
242 iso_pu_bacteria 2896344016 2896344862 240
243 iso_pu_bacteria 2898713307 2898714615 240
244 iso_pu_bacteria 2904780799 2904782349 240
245 iso_pu_bacteria 2910245624 2910246140 240
246 iso_pu_bacteria 2919177583 2919178453 240
247 iso_pu_bacteria 3003233435 3003237014 240
248 3300002738 JGI25154J39366_1000004 JGI25154J39366_1000004134 241
249 3300003215 JGI25153J46596_10006198 JGI25153J46596_100061984 241
250 3300003322 rootL2_10022160 rootL2_100221603 241
251 3300003354 JGI25160J50197_1002338 JGI25160J50197_10023382 241
252 3300005328 Ga0070676_10271310 Ga0070676_102713102 241
253 3300005334 Ga0068869_100007354 Ga0068869_1000073542 241
254 3300005335 Ga0070666_10000042 Ga0070666_10000042104 241
255 3300005336 Ga0070680_100000878 Ga0070680_10000087813 241
256 3300005337 Ga0070682_100001122 Ga0070682_10000112210 241
257 3300005338 Ga0068868_100004734 Ga0068868_1000047343 241
258 3300005338 Ga0068868_100158262 Ga0068868_1001582622 241
259 3300005338 Ga0068868_100269746 Ga0068868_1002697461 241
260 3300005339 Ga0070660_100105936 Ga0070660_1001059363 241
261 3300005340 Ga0070689_100465007 Ga0070689_1004650072 241
262 3300005347 Ga0070668_100061242 Ga0070668_1000612423 241
263 3300005347 Ga0070668_100333339 Ga0070668_1003333392 241
264 3300005353 Ga0070669_100017262 Ga0070669_1000172622 241
265 3300005355 Ga0070671_100102928 Ga0070671_1001029281 241
266 3300005355 Ga0070671_100228278 Ga0070671_1002282782 241
267 3300005364 Ga0070673_100284812 Ga0070673_1002848122 241
268 3300005364 Ga0070673_100304793 Ga0070673_1003047931 241
269 3300005367 Ga0070667_100013413 Ga0070667_1000134132 241
270 3300005367 Ga0070667_100044613 Ga0070667_1000446133 241
271 3300005466 Ga0070685_10080154 Ga0070685_100801542 241
272 3300005466 Ga0070685_10286675 Ga0070685_102866751 241
273 3300005467 Ga0070706_100222188 Ga0070706_1002221881 241
274 3300005530 Ga0070679_100000398 Ga0070679_1000003989 241
275 3300005530 Ga0070679_100003316 Ga0070679_1000033166 241
276 3300005535 Ga0070684_100109828 Ga0070684_1001098282 241
277 3300005539 Ga0068853_100017299 Ga0068853_1000172995 241
278 3300005547 Ga0070693_100000650 Ga0070693_10000065011 241
279 3300005563 Ga0068855_100029707 Ga0068855_1000297076 241
280 3300005563 Ga0068855_100224589 Ga0068855_1002245892 241
281 3300005577 Ga0068857_100001316 Ga0068857_10000131613 241
282 3300005614 Ga0068856_100097121 Ga0068856_1000971212 241
283 3300005616 Ga0068852_100001166 Ga0068852_1000011667 241
284 3300005616 Ga0068852_100002787 Ga0068852_1000027875 241
285 3300005616 Ga0068852_100009916 Ga0068852_1000099166 241
286 3300005617 Ga0068859_100013654 Ga0068859_1000136543 241
287 3300005617 Ga0068859_100067304 Ga0068859_1000673042 241
288 3300005618 Ga0068864_100009257 Ga0068864_1000092573 241
289 3300005618 Ga0068864_100201391 Ga0068864_1002013912 241
290 3300005618 Ga0068864_100480459 Ga0068864_1004804592 241
291 3300005834 Ga0068851_10012661 Ga0068851_100126612 241
292 3300005841 Ga0068863_100005978 Ga0068863_1000059783 241
293 3300005841 Ga0068863_100017784 Ga0068863_1000177842 241
294 3300005842 Ga0068858_100046101 Ga0068858_1000461013 241
295 3300005843 Ga0068860_100002561 Ga0068860_1000025616 241
296 3300005843 Ga0068860_100003920 Ga0068860_1000039209 241
297 3300006195 Ga0075366_10050396 Ga0075366_100503964 241
298 3300006237 Ga0097621_100002185 Ga0097621_1000021852 241
299 3300006237 Ga0097621_100637491 Ga0097621_1006374912 241
300 3300006358 Ga0068871_100019766 Ga0068871_1000197664 241
301 3300006358 Ga0068871_100113091 Ga0068871_1001130912 241
302 3300006358 Ga0068871_100368432 Ga0068871_1003684322 241
303 3300006931 Ga0097620_100013654 Ga0097620_1000136543 241
304 3300006931 Ga0097620_100067307 Ga0097620_1000673072 241
305 3300009093 Ga0105240_10002364 Ga0105240_1000236416 241
306 3300009093 Ga0105240_10186537 Ga0105240_101865372 241
307 3300009098 Ga0105245_10639164 Ga0105245_106391642 241
308 3300009101 Ga0105247_10022031 Ga0105247_100220312 241
309 3300009174 Ga0105241_10006161 Ga0105241_100061612 241
310 3300009174 Ga0105241_10009180 Ga0105241_100091802 241
311 3300009174 Ga0105241_10170247 Ga0105241_101702472 241
312 3300009174 Ga0105241_10429835 Ga0105241_104298352 241
313 3300009176 Ga0105242_10377038 Ga0105242_103770381 241
314 3300009545 Ga0105237_10002312 Ga0105237_1000231216 241
315 3300009545 Ga0105237_10011376 Ga0105237_100113764 241
316 3300009545 Ga0105237_10067355 Ga0105237_100673551 241
317 3300009545 Ga0105237_10103921 Ga0105237_101039213 241
318 3300009551 Ga0105238_10029135 Ga0105238_100291352 241
319 3300009553 Ga0105249_10084947 Ga0105249_100849472 241
320 3300010375 Ga0105239_10006736 Ga0105239_100067365 241
321 3300013104 Ga0157370_10007415 Ga0157370_100074153 241
322 3300013104 Ga0157370_10083964 Ga0157370_100839642 241
323 3300013105 Ga0157369_10061089 Ga0157369_100610891 241
324 3300013105 Ga0157369_10167491 Ga0157369_101674912 241
325 3300013297 Ga0157378_10045074 Ga0157378_100450742 241
326 3300013297 Ga0157378_10055052 Ga0157378_100550522 241
327 3300013297 Ga0157378_10182995 Ga0157378_101829952 241
328 3300013306 Ga0163162_10031627 Ga0163162_100316273 241
329 3300013306 Ga0163162_10096379 Ga0163162_100963793 241
330 3300013306 Ga0163162_10540197 Ga0163162_105401972 241
331 3300013307 Ga0157372_10000052 Ga0157372_1000005242 241
332 3300013307 Ga0157372_10155631 Ga0157372_101556312 241
333 3300013307 Ga0157372_11158708 Ga0157372_111587081 241
334 3300013308 Ga0157375_10192383 Ga0157375_101923833 241
335 3300013308 Ga0157375_10268339 Ga0157375_102683392 241
336 3300014969 Ga0157376_10002899 Ga0157376_100028992 241
337 3300025246 Ga0209646_1000025 Ga0209646_1000025203 241
338 3300025250 Ga0209026_1000380 Ga0209026_100038012 241
339 3300025297 Ga0209758_1012637 Ga0209758_10126373 241
340 3300025302 Ga0207426_1000261 Ga0207426_100026183 241
341 3300025900 Ga0207710_10008199 Ga0207710_100081993 241
342 3300025903 Ga0207680_10000228 Ga0207680_1000022826 241
343 3300025904 Ga0207647_10065536 Ga0207647_100655362 241
344 3300025909 Ga0207705_10482521 Ga0207705_104825211 241
345 3300025911 Ga0207654_10004675 Ga0207654_100046756 241
346 3300025911 Ga0207654_10017743 Ga0207654_100177432 241
347 3300025911 Ga0207654_10108666 Ga0207654_101086662 241
348 3300025912 Ga0207707_10000722 Ga0207707_1000072215 241
349 3300025913 Ga0207695_10023732 Ga0207695_100237323 241
350 3300025913 Ga0207695_10034360 Ga0207695_100343602 241
351 3300025913 Ga0207695_10186053 Ga0207695_101860532 241
352 3300025914 Ga0207671_10001247 Ga0207671_1000124715 241
353 3300025914 Ga0207671_10242774 Ga0207671_102427742 241
354 3300025914 Ga0207671_10341463 Ga0207671_103414632 241
355 3300025917 Ga0207660_10004797 Ga0207660_100047974 241
356 3300025919 Ga0207657_10025764 Ga0207657_100257642 241
357 3300025921 Ga0207652_10006617 Ga0207652_100066176 241
358 3300025921 Ga0207652_10069673 Ga0207652_100696732 241
359 3300025923 Ga0207681_10053814 Ga0207681_100538142 241
360 3300025924 Ga0207694_10019125 Ga0207694_100191256 241
361 3300025931 Ga0207644_10206585 Ga0207644_102065852 241
362 3300025931 Ga0207644_10345614 Ga0207644_103456141 241
363 3300025934 Ga0207686_10200092 Ga0207686_102000921 241
364 3300025940 Ga0207691_10137081 Ga0207691_101370812 241
365 3300025940 Ga0207691_10461343 Ga0207691_104613432 241
366 3300025942 Ga0207689_10009695 Ga0207689_100096952 241
367 3300025949 Ga0207667_10002024 Ga0207667_1000202416 241
368 3300025949 Ga0207667_10177371 Ga0207667_101773713 241
369 3300025960 Ga0207651_10063857 Ga0207651_100638571 241
370 3300025960 Ga0207651_10297158 Ga0207651_102971581 241
371 3300025961 Ga0207712_10009009 Ga0207712_100090093 241
372 3300025972 Ga0207668_10043711 Ga0207668_100437113 241
373 3300025981 Ga0207640_10071765 Ga0207640_100717652 241
374 3300025986 Ga0207658_10497426 Ga0207658_104974262 241
375 3300026023 Ga0207677_10049146 Ga0207677_100491462 241
376 3300026035 Ga0207703_10004767 Ga0207703_100047672 241
377 3300026041 Ga0207639_10032202 Ga0207639_100322022 241
378 3300026078 Ga0207702_10058064 Ga0207702_100580643 241
379 3300026088 Ga0207641_10000158 Ga0207641_100001582 241
380 3300026088 Ga0207641_10006686 Ga0207641_100066868 241
381 3300026095 Ga0207676_10004127 Ga0207676_100041276 241
382 3300026095 Ga0207676_10180655 Ga0207676_101806552 241
383 3300026116 Ga0207674_10016794 Ga0207674_100167946 241
384 3300026142 Ga0207698_10001210 Ga0207698_100012107 241
385 3300026142 Ga0207698_10008221 Ga0207698_100082212 241
386 3300026142 Ga0207698_10014430 Ga0207698_100144302 241
387 3300028381 Ga0268264_10009194 Ga0268264_100091945 241
388 3300028381 Ga0268264_10031602 Ga0268264_100316023 241
389 3300031456 Ga0307513_10128438 Ga0307513_101284382 241
390 3300031507 Ga0307509_10290943 Ga0307509_102909432 241
391 3300031616 Ga0307508_10229940 Ga0307508_102299402 241
392 3300031824 Ga0307413_10008102 Ga0307413_100081027 241
393 3300031838 Ga0307518_10045018 Ga0307518_100450182 241
394 3300031903 Ga0307407_10262336 Ga0307407_102623362 241
395 3300031911 Ga0307412_10329066 Ga0307412_103290662 241
396 3300032004 Ga0307414_10236412 Ga0307414_102364122 241
397 3300032126 Ga0307415_100555413 Ga0307415_1005554132 241
398 3300037418 Ga0395900_0009771 Ga0395900_0009771_3834_4595 241
399 3300037418 Ga0395900_0113365 Ga0395900_0113365_288_1061 241
400 3300037418 Ga0395900_0148325 Ga0395900_0148325_1587_2348 241
401 3300037466 Ga0395898_0019394 Ga0395898_0019394_3779_4540 241
402 3300037466 Ga0395898_0201687 Ga0395898_0201687_955_1722 241
403 3300037466 Ga0395898_0311010 Ga0395898_0311010_557_1318 241
404 3300038443 Ga0395901_0106738 Ga0395901_0106738_1169_1930 241
405 3300038443 Ga0395901_0141436 Ga0395901_0141436_206_967 241
406 3300044656 Ga0466969_0102706 Ga0466969_0102706_182_943 241
407 3300044658 Ga0466972_0010933 Ga0466972_0010933_17_778 241
408 3300044684 Ga0466966_0004496 Ga0466966_0004496_8355_9116 241
409 3300044693 Ga0466961_0011577 Ga0466961_0011577_1243_2004 241
410 3300044735 Ga0466968_0017676 Ga0466968_0017676_458_1219 241
411 3300046453 Ga0495627_007447 Ga0495627_007447_3194_3961 241
412 3300046558 Ga0495633_0000017 Ga0495633_0000017_80500_81267 241
413 3300046660 Ga0495625_0084598 Ga0495625_0084598_104_865 241
414 3300047320 Ga0495672_0004265 Ga0495672_0004265_9896_10657 241
415 3300047472 Ga0495686_0017519 Ga0495686_0017519_129_890 241
416 3300049569 Ga0501032_0054008 Ga0501032_0054008_483_1247 241
417 3300049571 Ga0501034_0001100 Ga0501034_0001100_4247_5011 241
418 3300049571 Ga0501034_0555672 Ga0501034_0555672_109_876 241
419 3300049572 Ga0501036_0563249 Ga0501036_0563249_128_892 241
420 3300049574 Ga0501038_0000440 Ga0501038_0000440_14427_15245 241
421 3300049574 Ga0501038_0209604 Ga0501038_0209604_183_950 241
422 3300049581 Ga0501047_0083198 Ga0501047_0083198_1997_2764 241
423 3300049583 Ga0501067_0080868 Ga0501067_0080868_334_1101 241
424 3300049588 Ga0501072_0433818 Ga0501072_0433818_142_909 241
425 3300049703 Ga0501219_000271 Ga0501219_000271_6044_6805 241
426 3300049705 Ga0501225_0035699 Ga0501225_0035699_240_1001 241
427 3300049741 Ga0501079_0044871 Ga0501079_0044871_2250_3017 241
428 3300049758 Ga0501241_000065 Ga0501241_000065_864_1631 241
429 3300049823 Ga0501044_0124154 Ga0501044_0124154_1668_2429 241
430 3300050493 nmdc:mga0k408_83018_c1 nmdc:mga0k408_83018_c1_487_1248 241
431 3300053093 Ga0500651_0183181 Ga0500651_0183181_243_1010 241
432 3300053094 Ga0500566_0168173 Ga0500566_0168173_236_997 241
433 3300053136 Ga0500559_0033862 Ga0500559_0033862_953_1723 241
434 3300053136 Ga0500559_0144518 Ga0500559_0144518_331_1092 241
435 3300053146 Ga0500588_0002432 Ga0500588_0002432_2087_2848 241
436 3300060353 Ga0501082_0108575 Ga0501082_0108575_1609_2376 241
437 iso_pu_bacteria 2911138879 2911141548 241
438 3300001979 JGI24740J21852_10002393 JGI24740J21852_100023938 242
439 3300003215 JGI25153J46596_10009612 JGI25153J46596_100096124 242
440 3300003320 rootH2_10004521 rootH2_100045214 242
441 3300003320 rootH2_10025566 rootH2_100255665 242
442 3300003320 rootH2_10028784 rootH2_1002878418 242
443 3300003320 rootH2_10115381 rootH2_101153815 242
444 3300003322 rootL2_10010741 rootL2_100107413 242
445 3300003322 rootL2_10022161 rootL2_100221613 242
446 3300003322 rootL2_10341458 rootL2_103414582 242
447 3300003323 rootH1_10034646 rootH1_100346462 242
448 3300003323 rootH1_10088863 rootH1_100888632 242
449 3300003323 rootH1_10100195 rootH1_101001953 242
450 3300003354 JGI25160J50197_1004863 JGI25160J50197_10048634 242
451 3300003761 Ga0055535_1004467 Ga0055535_10044673 242
452 3300003762 Ga0055542_1002394 Ga0055542_10023944 242
453 3300003790 Ga0055528_1001027 Ga0055528_10010278 242
454 3300003791 Ga0055530_10000288 Ga0055530_100002883 242
455 3300003794 Ga0055531_10040389 Ga0055531_100403891 242
456 3300005262 Ga0065165_1000128 Ga0065165_10001283 242
457 3300005329 Ga0070683_100038066 Ga0070683_1000380664 242
458 3300005333 Ga0070677_10018190 Ga0070677_100181903 242
459 3300005335 Ga0070666_10031488 Ga0070666_100314882 242
460 3300005338 Ga0068868_100264975 Ga0068868_1002649751 242
461 3300005341 Ga0070691_10017297 Ga0070691_100172973 242
462 3300005356 Ga0070674_100198630 Ga0070674_1001986302 242
463 3300005455 Ga0070663_100005807 Ga0070663_1000058072 242
464 3300005456 Ga0070678_100078718 Ga0070678_1000787183 242
465 3300005458 Ga0070681_10028566 Ga0070681_100285664 242
466 3300005459 Ga0068867_100341318 Ga0068867_1003413181 242
467 3300005535 Ga0070684_100117227 Ga0070684_1001172271 242
468 3300005539 Ga0068853_100010927 Ga0068853_1000109276 242
469 3300005539 Ga0068853_100084456 Ga0068853_1000844562 242
470 3300005563 Ga0068855_100077659 Ga0068855_1000776592 242
471 3300005563 Ga0068855_100259037 Ga0068855_1002590371 242
472 3300005616 Ga0068852_100026395 Ga0068852_1000263953 242
473 3300005616 Ga0068852_100036902 Ga0068852_1000369022 242
474 3300005617 Ga0068859_100039542 Ga0068859_1000395424 242
475 3300005841 Ga0068863_100052271 Ga0068863_1000522714 242
476 3300005842 Ga0068858_100461936 Ga0068858_1004619361 242
477 3300005843 Ga0068860_100000005 Ga0068860_10000000556 242
478 3300005843 Ga0068860_100662269 Ga0068860_1006622692 242
479 3300005983 Ga0081540_1020082 Ga0081540_10200823 242
480 3300006195 Ga0075366_10106217 Ga0075366_101062172 242
481 3300006871 Ga0075434_100329091 Ga0075434_1003290912 242
482 3300006931 Ga0097620_100039542 Ga0097620_1000395424 242
483 3300009093 Ga0105240_10000140 Ga0105240_100001404 242
484 3300009093 Ga0105240_10000419 Ga0105240_1000041958 242
485 3300009093 Ga0105240_10001671 Ga0105240_1000167124 242
486 3300009093 Ga0105240_10026048 Ga0105240_100260487 242
487 3300009093 Ga0105240_10056829 Ga0105240_100568294 242
488 3300009093 Ga0105240_10070744 Ga0105240_100707444 242
489 3300009093 Ga0105240_10169808 Ga0105240_101698083 242
490 3300009174 Ga0105241_10003484 Ga0105241_100034844 242
491 3300009545 Ga0105237_10000390 Ga0105237_1000039031 242
492 3300009545 Ga0105237_10022955 Ga0105237_100229554 242
493 3300009551 Ga0105238_10010129 Ga0105238_100101296 242
494 3300009551 Ga0105238_10070744 Ga0105238_100707442 242
495 3300009551 Ga0105238_10083693 Ga0105238_100836933 242
496 3300010375 Ga0105239_10000093 Ga0105239_1000009366 242
497 3300010375 Ga0105239_10002826 Ga0105239_100028267 242
498 3300010375 Ga0105239_10061586 Ga0105239_100615862 242
499 3300010375 Ga0105239_10119469 Ga0105239_101194692 242
500 3300010375 Ga0105239_10145959 Ga0105239_101459593 242
501 3300013102 Ga0157371_10003455 Ga0157371_100034552 242
502 3300013104 Ga0157370_10034523 Ga0157370_100345232 242
503 3300013104 Ga0157370_10170202 Ga0157370_101702023 242
504 3300013104 Ga0157370_10194856 Ga0157370_101948561 242
505 3300013104 Ga0157370_10307374 Ga0157370_103073741 242
506 3300013105 Ga0157369_10000461 Ga0157369_1000046139 242
507 3300013105 Ga0157369_10124911 Ga0157369_101249112 242
508 3300013296 Ga0157374_10000004 Ga0157374_10000004328 242
509 3300013306 Ga0163162_10005547 Ga0163162_100055473 242
510 3300013307 Ga0157372_10000001 Ga0157372_1000000184 242
511 3300013307 Ga0157372_10008256 Ga0157372_100082569 242
512 3300013307 Ga0157372_10055789 Ga0157372_100557893 242
513 3300013307 Ga0157372_10121203 Ga0157372_101212034 242
514 3300014325 Ga0163163_10189424 Ga0163163_101894241 242
515 3300014969 Ga0157376_10001819 Ga0157376_100018195 242
516 3300015265 Ga0182005_1000040 Ga0182005_1000040112 242
517 3300021384 Ga0213876_10005187 Ga0213876_100051872 242
518 3300025242 Ga0209258_100356 Ga0209258_10035630 242
519 3300025254 Ga0209148_1000129 Ga0209148_100012962 242
520 3300025273 Ga0209673_1000085 Ga0209673_1000085130 242
521 3300025291 Ga0209675_1022540 Ga0209675_10225402 242
522 3300025295 Ga0209564_1003860 Ga0209564_10038603 242
523 3300025297 Ga0209758_1014696 Ga0209758_10146962 242
524 3300025297 Ga0209758_1025035 Ga0209758_10250352 242
525 3300025298 Ga0209050_1000524 Ga0209050_10005246 242
526 3300025302 Ga0207426_1004611 Ga0207426_10046112 242
527 3300025302 Ga0207426_1006919 Ga0207426_10069193 242
528 3300025304 Ga0209257_1005255 Ga0209257_10052557 242
529 3300025893 Ga0207682_10015472 Ga0207682_100154723 242
530 3300025911 Ga0207654_10013126 Ga0207654_100131262 242
531 3300025912 Ga0207707_10036114 Ga0207707_100361144 242
532 3300025913 Ga0207695_10000027 Ga0207695_10000027335 242
533 3300025913 Ga0207695_10000164 Ga0207695_10000164135 242
534 3300025913 Ga0207695_10003547 Ga0207695_100035478 242
535 3300025913 Ga0207695_10038685 Ga0207695_100386855 242
536 3300025913 Ga0207695_10221885 Ga0207695_102218851 242
537 3300025914 Ga0207671_10001635 Ga0207671_100016354 242
538 3300025914 Ga0207671_10004939 Ga0207671_100049395 242
539 3300025914 Ga0207671_10667057 Ga0207671_106670571 242
540 3300025924 Ga0207694_10023285 Ga0207694_100232853 242
541 3300025924 Ga0207694_10050498 Ga0207694_100504982 242
542 3300025924 Ga0207694_10056158 Ga0207694_100561584 242
543 3300025936 Ga0207670_10142134 Ga0207670_101421343 242
544 3300025937 Ga0207669_10263127 Ga0207669_102631272 242
545 3300025949 Ga0207667_10063189 Ga0207667_100631892 242
546 3300026023 Ga0207677_10417611 Ga0207677_104176111 242
547 3300026041 Ga0207639_10016287 Ga0207639_100162874 242
548 3300026041 Ga0207639_10082848 Ga0207639_100828482 242
549 3300026041 Ga0207639_10599231 Ga0207639_105992311 242
550 3300026067 Ga0207678_10012680 Ga0207678_100126802 242
551 3300026142 Ga0207698_10049231 Ga0207698_100492313 242
552 3300028380 Ga0268265_10472501 Ga0268265_104725012 242
553 3300028381 Ga0268264_10000012 Ga0268264_1000001238 242
554 3300028786 Ga0307517_10157592 Ga0307517_101575921 242
555 3300028786 Ga0307517_10196962 Ga0307517_101969621 242
556 3300028794 Ga0307515_10000002 Ga0307515_10000002712 242
557 3300028800 Ga0265338_10074654 Ga0265338_100746543 242
558 3300030521 Ga0307511_10000850 Ga0307511_1000085016 242
559 3300030731 Ga0316177_1035139 Ga0316177_10351393 242
560 3300030732 Ga0316176_1042321 Ga0316176_10423214 242
561 3300030742 Ga0316183_1134560 Ga0316183_11345607 242
562 3300030744 Ga0316181_1167506 Ga0316181_116750613 242
563 3300030745 Ga0316182_1005945 Ga0316182_10059452 242
564 3300031247 Ga0265340_10157090 Ga0265340_101570902 242
565 3300031456 Ga0307513_10095002 Ga0307513_100950022 242
566 3300031507 Ga0307509_10264318 Ga0307509_102643181 242
567 3300031730 Ga0307516_10002277 Ga0307516_100022777 242
568 3300031911 Ga0307412_10097081 Ga0307412_100970812 242
569 3300032004 Ga0307414_10220546 Ga0307414_102205462 242
570 3300033180 Ga0307510_10007660 Ga0307510_100076608 242
571 3300033180 Ga0307510_10303575 Ga0307510_103035752 242
572 3300035398 Ga0316574_0108115 Ga0316574_0108115_889_1662 242
573 3300035692 Ga0373935_0325288 Ga0373935_0325288_148_912 242
574 3300036712 Ga0316584_0166051 Ga0316584_0166051_69_842 242
575 3300037312 Ga0395899_0000844 Ga0395899_0000844_26240_27010 242
576 3300039093 Ga0400489_75466 Ga0400489_75466_1878_2648 242
577 3300039437 Ga0436365_1251897 Ga0436365_1251897_19217_19981 242
578 3300042007 Ga0439449_0004582 Ga0439449_0004582_3835_4605 242
579 3300042007 Ga0439449_0124594 Ga0439449_0124594_166_936 242
580 3300042134 Ga0450898_000822 Ga0450898_000822_1565_2335 242
581 3300042156 Ga0439446_0059122 Ga0439446_0059122_362_1132 242
582 3300044656 Ga0466969_0032078 Ga0466969_0032078_982_1746 242
583 3300044658 Ga0466972_0016536 Ga0466972_0016536_617_1381 242
584 3300044658 Ga0466972_0047289 Ga0466972_0047289_896_1660 242
585 3300044658 Ga0466972_0064704 Ga0466972_0064704_646_1413 242
586 3300044684 Ga0466966_0152009 Ga0466966_0152009_261_1031 242
587 3300044693 Ga0466961_0045589 Ga0466961_0045589_1381_2145 242
588 3300044693 Ga0466961_0168574 Ga0466961_0168574_404_1174 242
589 3300044706 Ga0466964_0013061 Ga0466964_0013061_1563_2327 242
590 3300044765 Ga0466970_0012503 Ga0466970_0012503_223_987 242
591 3300044842 Ga0466957_0087890 Ga0466957_0087890_808_1578 242
592 3300045049 Ga0466959_0003751 Ga0466959_0003751_328_1092 242
593 3300045049 Ga0466959_0005020 Ga0466959_0005020_4421_5185 242
594 3300045049 Ga0466959_0304006 Ga0466959_0304006_164_928 242
595 3300045836 Ga0466958_0026405 Ga0466958_0026405_2147_2911 242
596 3300046454 Ga0495592_0122497 Ga0495592_0122497_863_1633 242
597 3300046462 Ga0495651_0130455 Ga0495651_0130455_544_1314 242
598 3300046463 Ga0495653_0071695 Ga0495653_0071695_496_1266 242
599 3300046477 Ga0495664_0053179 Ga0495664_0053179_1432_2202 242
600 3300046507 Ga0495606_0005801 Ga0495606_0005801_422_1186 242
601 3300046514 Ga0495618_0075273 Ga0495618_0075273_249_1019 242
602 3300046514 Ga0495618_0133221 Ga0495618_0133221_555_1391 242
603 3300046516 Ga0495628_0030393 Ga0495628_0030393_3377_4147 242
604 3300046517 Ga0495630_0129445 Ga0495630_0129445_323_1093 242
605 3300046524 Ga0495648_0026544 Ga0495648_0026544_908_1672 242
606 3300046526 Ga0495666_0155570 Ga0495666_0155570_64_834 242
607 3300046536 Ga0495587_0296568 Ga0495587_0296568_32_802 242
608 3300046543 Ga0495645_0001391 Ga0495645_0001391_891_1661 242
609 3300046543 Ga0495645_0028618 Ga0495645_0028618_1854_2624 242
610 3300046559 Ga0495667_0177772 Ga0495667_0177772_232_1002 242
611 3300046616 Ga0495668_0001808 Ga0495668_0001808_1277_2047 242
612 3300046642 Ga0495634_0021990 Ga0495634_0021990_1933_2703 242
613 3300046648 Ga0495611_0000038 Ga0495611_0000038_33077_33841 242
614 3300046648 Ga0495611_0099588 Ga0495611_0099588_170_934 242
615 3300046689 Ga0495613_0005144 Ga0495613_0005144_6721_7557 242
616 3300046689 Ga0495613_0032396 Ga0495613_0032396_2909_3679 242
617 3300046809 Ga0495600_0046573 Ga0495600_0046573_1355_2125 242
618 3300046809 Ga0495600_0150162 Ga0495600_0150162_362_1198 242
619 3300047319 Ga0495674_0016152 Ga0495674_0016152_2213_2983 242
620 3300047319 Ga0495674_0142519 Ga0495674_0142519_1134_1898 242
621 3300047322 Ga0495680_0165613 Ga0495680_0165613_630_1400 242
622 3300047443 Ga0495687_000243 Ga0495687_000243_57511_58275 242
623 3300047444 Ga0495675_0138570 Ga0495675_0138570_47_817 242
624 3300047471 Ga0495684_0021293 Ga0495684_0021293_2617_3453 242
625 3300047471 Ga0495684_0025538 Ga0495684_0025538_1510_2280 242
626 3300047472 Ga0495686_0000058 Ga0495686_0000058_51700_52464 242
627 3300048924 Ga0496121_0000010 Ga0496121_0000010_396434_397201 242
628 3300049568 Ga0501031_0157671 Ga0501031_0157671_532_1302 242
629 3300049569 Ga0501032_0011617 Ga0501032_0011617_3906_4676 242
630 3300049570 Ga0501033_0240003 Ga0501033_0240003_477_1247 242
631 3300049571 Ga0501034_0005663 Ga0501034_0005663_11027_11797 242
632 3300049571 Ga0501034_0016302 Ga0501034_0016302_2437_3201 242
633 3300049571 Ga0501034_0134743 Ga0501034_0134743_131_901 242
634 3300049573 Ga0501037_0021267 Ga0501037_0021267_395_1165 242
635 3300049579 Ga0501043_0003830 Ga0501043_0003830_1812_2582 242
636 3300049580 Ga0501046_0006720 Ga0501046_0006720_4658_5428 242
637 3300049581 Ga0501047_0010701 Ga0501047_0010701_5221_5991 242
638 3300049581 Ga0501047_0030967 Ga0501047_0030967_2788_3552 242
639 3300049581 Ga0501047_0570577 Ga0501047_0570577_177_941 242
640 3300049589 Ga0501073_0002013 Ga0501073_0002013_9930_10700 242
641 3300049590 Ga0501074_0002600 Ga0501074_0002600_6953_7723 242
642 3300049742 Ga0501080_0018745 Ga0501080_0018745_2966_3736 242
643 3300049742 Ga0501080_0181426 Ga0501080_0181426_948_1712 242
644 3300049742 Ga0501080_0406615 Ga0501080_0406615_57_827 242
645 3300049744 Ga0501083_0012750 Ga0501083_0012750_1811_2581 242
646 3300049822 Ga0501035_0079018 Ga0501035_0079018_1218_1982 242
647 3300049822 Ga0501035_0336413 Ga0501035_0336413_460_1230 242
648 3300049823 Ga0501044_0028667 Ga0501044_0028667_2643_3407 242
649 3300049823 Ga0501044_0045316 Ga0501044_0045316_210_980 242
650 3300049823 Ga0501044_0164390 Ga0501044_0164390_1018_1782 242
651 3300049823 Ga0501044_0330125 Ga0501044_0330125_645_1409 242
652 3300049823 Ga0501044_0474163 Ga0501044_0474163_179_949 242
653 3300053088 Ga0500644_0002591 Ga0500644_0002591_927_1694 242
654 3300053088 Ga0500644_0071148 Ga0500644_0071148_67_831 242
655 3300053092 Ga0500583_0015747 Ga0500583_0015747_1239_2003 242
656 3300053093 Ga0500651_0051214 Ga0500651_0051214_384_1190 242
657 3300053109 Ga0500569_000396 Ga0500569_000396_2818_3624 242
658 3300053125 Ga0500618_017751 Ga0500618_017751_948_1718 242
659 3300053130 Ga0500642_0010291 Ga0500642_0010291_942_1706 242
660 3300053134 Ga0500658_0000574 Ga0500658_0000574_6363_7169 242
661 3300053142 Ga0500577_0001248 Ga0500577_0001248_4410_5216 242
662 3300053148 Ga0500590_087079 Ga0500590_087079_105_872 242
663 3300053156 Ga0500622_0012858 Ga0500622_0012858_3092_3856 242
664 3300053160 Ga0500633_0000453 Ga0500633_0000453_55_822 242
665 3300053177 Ga0500636_0120446 Ga0500636_0120446_164_931 242
666 3300054114 Ga0501084_0471611 Ga0501084_0471611_179_949 242
667 3300060353 Ga0501082_0369824 Ga0501082_0369824_93_863 242
668 iso_pu_bacteria 2515154155 2515855930 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

42

236

0.99

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

283

0.97

PF08659

KR

KR domain

43

225

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9425 2 242
1vl8-assembly1.cif.gz_B crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution 0.9399 5 242
3uf0-assembly1.cif.gz_A crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy) 0.9377 4 242
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9375 7 239
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9349 2 242
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 75 239 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 83 184 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 75 239 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9399 5 242 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9341 1 242 3.40.50.720
ID Description Score Start End GO Terms
AF-I0K8G6-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125) 0.9974 22 242 GO:0008678
AF-A0A848WJQ7-F1-model_v4 SDR family oxidoreductase 0.9964 81 242 GO:0016616
AF-A0A3M0Z361-F1-model_v4 SDR family oxidoreductase 0.9951 40 242 GO:0016616
AF-A0A0F9L5W3-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9947 35 242 GO:0016616
AF-A0A7Z9G2D4-F1-model_v4 SDR family oxidoreductase 0.9914 68 242 GO:0016616

Feature Viewer

pLDDT pTM Quality
92.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map