F473890

General Info

Members Datasets Scaffolds Average Seq Length
668 329 666 240

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10146578|Ga0065715_101465782
Length 249
Sequence MRSDSFRNVWILFRREFASYFATPLALVFIVIFLALAGLFTFFLGGFYERGQADLAPFFNYHPWLYLFLMPALSMRLWAEERKSGTIELLMTLPITPWQAVIGKYLAAWAVAGLALVLTFPVWITVNYLGDPDNGAILAGYIGSFLVAGGLLAIGACFSAATRNQVIAFIVTVVACFAFLLSGFALVLNAFQGWAPQPVIDAVASLSFLTHFGSIAKGVIDIRDLLYFATVIAVWLIATAIVLDMKKAD

Samples

Sample ID Description Type Environment
1 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
2 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
225 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
226 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
227 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
228 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
229 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
230 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
231 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
316 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
317 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
318 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
319 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
323 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
326 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
327 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 3.74
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10063715 3300003316 Bacteria 5470
2 rootH2_10014765 3300003320 Bacteria 2904
3 rootL2_10154988 3300003322 Bacteria 1402
4 Ga0065712_10208499 3300005290 Bacteria 1081
5 Ga0065715_10146578 3300005293 Bacteria 1781
6 Ga0065707_10187323 3300005295 Bacteria 1381
7 Ga0070658_10039060 3300005327 Bacteria 3828
8 Ga0070658_10149939 3300005327 Bacteria 1952
9 Ga0070690_100021236 3300005330 Bacteria 3961
10 Ga0070670_100018560 3300005331 Bacteria 5964
11 Ga0070670_100061369 3300005331 Bacteria 3228
12 Ga0068869_100092396 3300005334 Bacteria 2278
13 Ga0070666_10019045 3300005335 Bacteria 4426
14 Ga0070666_10038837 3300005335 Bacteria 3169
15 Ga0070666_10044901 3300005335 Bacteria 2962
16 Ga0070680_100037681 3300005336 Bacteria 3907
17 Ga0070680_100039466 3300005336 Bacteria 3821
18 Ga0070680_100065109 3300005336 Bacteria 2987
19 Ga0070680_100102832 3300005336 Bacteria 2373
20 Ga0070680_100425877 3300005336 Bacteria 1132
21 Ga0070682_100050639 3300005337 Bacteria 2594
22 Ga0070660_100003339 3300005339 Bacteria 11029
23 Ga0070660_100242406 3300005339 Bacteria 1469
24 Ga0070691_10000119 3300005341 Bacteria 23698
25 Ga0070691_10001304 3300005341 Bacteria 10585
26 Ga0070687_100002796 3300005343 Bacteria 6644
27 Ga0070661_100006893 3300005344 Bacteria 7838
28 Ga0070692_10079488 3300005345 Bacteria 1763
29 Ga0070692_10080580 3300005345 Bacteria 1753
30 Ga0070668_100045493 3300005347 Bacteria 3367
31 Ga0070668_100148690 3300005347 Bacteria 1893
32 Ga0070669_100007529 3300005353 Bacteria 7796
33 Ga0070675_100002577 3300005354 Bacteria 13587
34 Ga0070671_100000891 3300005355 Bacteria 21786
35 Ga0070671_100068719 3300005355 Bacteria 2955
36 Ga0070671_100148038 3300005355 Bacteria 1982
37 Ga0070674_100027736 3300005356 Bacteria 3713
38 Ga0070674_100305969 3300005356 Bacteria 1269
39 Ga0070673_100000445 3300005364 Bacteria 21871
40 Ga0070673_100308371 3300005364 Bacteria 1395
41 Ga0070688_100002973 3300005365 Bacteria 8635
42 Ga0070659_100018792 3300005366 Bacteria 5217
43 Ga0070667_100002761 3300005367 Bacteria 15189
44 Ga0070667_100081782 3300005367 Bacteria 2764
45 Ga0070667_100089774 3300005367 Bacteria 2640
46 Ga0070667_100300210 3300005367 Bacteria 1446
47 Ga0070667_100405690 3300005367 Bacteria 1241
48 Ga0070709_10001572 3300005434 Bacteria 12327
49 Ga0070709_10092457 3300005434 Bacteria 1998
50 Ga0070709_10150510 3300005434 Bacteria 1608
51 Ga0070714_100001876 3300005435 Bacteria 15328
52 Ga0070714_100030694 3300005435 Bacteria 4476
53 Ga0070714_100060690 3300005435 Bacteria 3246
54 Ga0070714_100536205 3300005435 Bacteria 1119
55 Ga0070713_100000866 3300005436 Bacteria 19339
56 Ga0070713_100034919 3300005436 Bacteria 4045
57 Ga0070713_100168600 3300005436 Bacteria 1960
58 Ga0070710_10059059 3300005437 Bacteria 2177
59 Ga0070701_10067762 3300005438 Bacteria 1900
60 Ga0070701_10487304 3300005438 Bacteria 798
61 Ga0070711_100075513 3300005439 Bacteria 2387
62 Ga0070711_100561413 3300005439 Bacteria 948
63 Ga0070700_100041276 3300005441 Bacteria 2828
64 Ga0070663_100084100 3300005455 Bacteria 2344
65 Ga0070663_100549712 3300005455 Unclassified 965
66 Ga0070663_100796645 3300005455 Bacteria 810
67 Ga0070678_100039011 3300005456 Bacteria 3348
68 Ga0070678_100080711 3300005456 Bacteria 2464
69 Ga0070662_100066899 3300005457 Bacteria 2638
70 Ga0070662_100078592 3300005457 Bacteria 2451
71 Ga0070681_10042175 3300005458 Bacteria 4574
72 Ga0070681_10062197 3300005458 Bacteria 3707
73 Ga0070681_10129381 3300005458 Bacteria 2457
74 Ga0070681_10142044 3300005458 Bacteria 2330
75 Ga0070681_10327918 3300005458 Bacteria 1440
76 Ga0068867_100211038 3300005459 Bacteria 1559
77 Ga0068867_100323836 3300005459 Bacteria 1278
78 Ga0070685_10018483 3300005466 Bacteria 3749
79 Ga0070699_100112466 3300005518 Bacteria 2392
80 Ga0070679_100011761 3300005530 Bacteria 8343
81 Ga0070679_100088281 3300005530 Bacteria 3088
82 Ga0070679_100146197 3300005530 Bacteria 2342
83 Ga0070679_100178214 3300005530 Unclassified 2098
84 Ga0070679_100290487 3300005530 Bacteria 1586
85 Ga0070684_100017546 3300005535 Bacteria 5879
86 Ga0068853_100356014 3300005539 Bacteria 1362
87 Ga0068853_100356844 3300005539 Bacteria 1361
88 Ga0070672_100045680 3300005543 Bacteria 3390
89 Ga0070672_100820945 3300005543 Bacteria 819
90 Ga0070686_100048477 3300005544 Bacteria 2691
91 Ga0070686_100147087 3300005544 Bacteria 1646
92 Ga0070695_100006694 3300005545 Bacteria 6816
93 Ga0070695_100027998 3300005545 Bacteria 3495
94 Ga0070696_100186177 3300005546 Bacteria 1543
95 Ga0070693_100046047 3300005547 Bacteria 2475
96 Ga0070665_100010311 3300005548 Bacteria 9452
97 Ga0070665_100012783 3300005548 Bacteria 8457
98 Ga0070665_100014489 3300005548 Bacteria 7907
99 Ga0070665_100019765 3300005548 Bacteria 6760
100 Ga0070665_100033526 3300005548 Bacteria 5166
101 Ga0070665_100056141 3300005548 Bacteria 3949
102 Ga0070665_100105036 3300005548 Bacteria 2827
103 Ga0070704_100564881 3300005549 Bacteria 996
104 Ga0068855_100001501 3300005563 Bacteria 29235
105 Ga0068855_100002250 3300005563 Bacteria 23850
106 Ga0068855_100110676 3300005563 Bacteria 3152
107 Ga0068855_100381880 3300005563 Bacteria 1547
108 Ga0068855_100588233 3300005563 Bacteria 1201
109 Ga0070664_100000661 3300005564 Bacteria 26303
110 Ga0070664_100238064 3300005564 Bacteria 1633
111 Ga0068857_100000836 3300005577 Bacteria 23064
112 Ga0068857_100035280 3300005577 Bacteria 4429
113 Ga0068854_100104576 3300005578 Bacteria 2127
114 Ga0068854_100177284 3300005578 Bacteria 1662
115 Ga0068856_100002253 3300005614 Bacteria 19920
116 Ga0068856_100004043 3300005614 Bacteria 14693
117 Ga0068856_100008954 3300005614 Bacteria 9738
118 Ga0068856_100184039 3300005614 Bacteria 2102
119 Ga0068856_100565361 3300005614 Bacteria 1158
120 Ga0070702_100022138 3300005615 Bacteria 3356
121 Ga0068859_100005026 3300005617 Bacteria 13419
122 Ga0068859_100034295 3300005617 Bacteria 5094
123 Ga0068859_100035905 3300005617 Bacteria 4974
124 Ga0068859_100488510 3300005617 Bacteria 1327
125 Ga0068864_100003379 3300005618 Bacteria 13195
126 Ga0068861_100003461 3300005719 Bacteria 10479
127 Ga0068861_100004925 3300005719 Bacteria 8995
128 Ga0068861_100089702 3300005719 Bacteria 2423
129 Ga0068861_100242702 3300005719 Bacteria 1533
130 Ga0068863_100000741 3300005841 Bacteria 32605
131 Ga0068863_100000781 3300005841 Bacteria 31993
132 Ga0068863_100035610 3300005841 Bacteria 4740
133 Ga0068858_100003988 3300005842 Bacteria 14568
134 Ga0068858_100011296 3300005842 Bacteria 8438
135 Ga0068858_100044466 3300005842 Bacteria 4116
136 Ga0068858_100227728 3300005842 Bacteria 1767
137 Ga0068858_100354326 3300005842 Bacteria 1406
138 Ga0068858_100500430 3300005842 Bacteria 1174
139 Ga0068860_100002939 3300005843 Bacteria 17616
140 Ga0068860_100017032 3300005843 Bacteria 7083
141 Ga0068860_100355087 3300005843 Bacteria 1443
142 Ga0068862_100015763 3300005844 Bacteria 6281
143 Ga0068862_100052283 3300005844 Bacteria 3495
144 Ga0068862_100276834 3300005844 Bacteria 1537
145 Ga0081539_10000123 3300005985 Bacteria 181245
146 Ga0070717_10004672 3300006028 Bacteria 9939
147 Ga0070717_10076653 3300006028 Bacteria 2799
148 Ga0070716_100038995 3300006173 Bacteria 2633
149 Ga0070716_100062491 3300006173 Bacteria 2159
150 Ga0070712_100000181 3300006175 Bacteria 34961
151 Ga0070712_100034312 3300006175 Bacteria 3438
152 Ga0070712_100433241 3300006175 Bacteria 1092
153 Ga0097621_100034303 3300006237 Bacteria 4048
154 Ga0097621_100433079 3300006237 Bacteria 1182
155 Ga0068871_100093094 3300006358 Bacteria 2514
156 Ga0068871_100337226 3300006358 Bacteria 1331
157 Ga0075428_100011010 3300006844 Bacteria 10059
158 Ga0075428_100269154 3300006844 Bacteria 1833
159 Ga0075428_100307598 3300006844 Bacteria 1704
160 Ga0075430_100001590 3300006846 Bacteria 18565
161 Ga0075430_100030395 3300006846 Bacteria 4587
162 Ga0075430_100064703 3300006846 Bacteria 3072
163 Ga0075430_100089766 3300006846 Bacteria 2571
164 Ga0075430_100123739 3300006846 Unclassified 2156
165 Ga0075430_100628627 3300006846 Bacteria 886
166 Ga0075431_100001092 3300006847 Bacteria 24307
167 Ga0075431_100328334 3300006847 Bacteria 1541
168 Ga0075431_100354503 3300006847 Bacteria 1474
169 Ga0075433_10232829 3300006852 Bacteria 1636
170 Ga0075434_100033051 3300006871 Bacteria 5103
171 Ga0075434_100530756 3300006871 Bacteria 1197
172 Ga0075429_100000286 3300006880 Bacteria 35609
173 Ga0075429_100031359 3300006880 Bacteria 4619
174 Ga0068865_100137397 3300006881 Bacteria 1839
175 Ga0075436_100000796 3300006914 Bacteria 20914
176 Ga0075436_100029672 3300006914 Bacteria 3761
177 Ga0075436_100189269 3300006914 Bacteria 1456
178 Ga0097620_100005026 3300006931 Bacteria 13419
179 Ga0097620_100034299 3300006931 Bacteria 5094
180 Ga0097620_100035904 3300006931 Bacteria 4974
181 Ga0097620_100488520 3300006931 Bacteria 1327
182 Ga0075435_100021729 3300007076 Bacteria 4942
183 Ga0099794_10009212 3300007265 Bacteria 4138
184 Ga0099794_10010013 3300007265 Bacteria 4013
185 Ga0099795_10000673 3300007788 Bacteria 6568
186 Ga0105240_10002206 3300009093 Bacteria 31749
187 Ga0105240_10003739 3300009093 Bacteria 23508
188 Ga0105240_10010425 3300009093 Bacteria 13058
189 Ga0105240_10012887 3300009093 Bacteria 11513
190 Ga0105240_10036236 3300009093 Bacteria 6347
191 Ga0105240_10099290 3300009093 Bacteria 3543
192 Ga0105240_10099462 3300009093 Bacteria 3540
193 Ga0105240_10101015 3300009093 Bacteria 3509
194 Ga0105240_10115948 3300009093 Bacteria 3232
195 Ga0105240_10261817 3300009093 Bacteria 1995
196 Ga0105240_10353810 3300009093 Bacteria 1666
197 Ga0105240_10612283 3300009093 Bacteria 1198
198 Ga0111539_10022128 3300009094 Bacteria 7814
199 Ga0105245_10027245 3300009098 Bacteria 5036
200 Ga0105245_10732330 3300009098 Bacteria 1024
201 Ga0105247_10000647 3300009101 Bacteria 27761
202 Ga0105247_10080790 3300009101 Bacteria 2048
203 Ga0105247_10343576 3300009101 Bacteria 1048
204 Ga0114129_10002253 3300009147 Bacteria 26642
205 Ga0105241_10016150 3300009174 Bacteria 5472
206 Ga0105241_10471341 3300009174 Bacteria 1114
207 Ga0105242_10089934 3300009176 Bacteria 2581
208 Ga0105242_10688117 3300009176 Bacteria 999
209 Ga0105242_10690215 3300009176 Bacteria 997
210 Ga0105248_10000013 3300009177 Bacteria 328864
211 Ga0105248_10005642 3300009177 Bacteria 13743
212 Ga0105248_10276665 3300009177 Bacteria 1890
213 Ga0105237_10002725 3300009545 Bacteria 21560
214 Ga0105237_10066395 3300009545 Bacteria 3602
215 Ga0105237_10196296 3300009545 Bacteria 2018
216 Ga0105237_10449591 3300009545 Bacteria 1294
217 Ga0105237_10611015 3300009545 Bacteria 1097
218 Ga0105238_10000461 3300009551 Bacteria 42710
219 Ga0105238_10040400 3300009551 Bacteria 4727
220 Ga0105238_10050294 3300009551 Bacteria 4195
221 Ga0105238_10058599 3300009551 Bacteria 3859
222 Ga0105238_10087038 3300009551 Bacteria 3111
223 Ga0105238_10155360 3300009551 Bacteria 2263
224 Ga0105238_10289440 3300009551 Bacteria 1620
225 Ga0105249_10009919 3300009553 Bacteria 8349
226 Ga0105249_10020093 3300009553 Bacteria 5967
227 Ga0105249_10025047 3300009553 Bacteria 5369
228 Ga0105249_10035160 3300009553 Bacteria 4542
229 Ga0105249_10080123 3300009553 Bacteria 3033
230 Ga0105249_10514829 3300009553 Bacteria 1243
231 Ga0099796_10000179 3300010159 Bacteria 9577
232 Ga0099796_10002198 3300010159 Bacteria 4221
233 Ga0099796_10048797 3300010159 Bacteria 1461
234 Ga0105239_10022924 3300010375 Bacteria 6883
235 Ga0105239_10152220 3300010375 Bacteria 2582
236 Ga0105239_10382350 3300010375 Unclassified 1592
237 Ga0105239_10447548 3300010375 Bacteria 1465
238 Ga0105239_10543619 3300010375 Bacteria 1323
239 Ga0157373_10003066 3300013100 Bacteria 12614
240 Ga0157370_10006819 3300013104 Bacteria 12517
241 Ga0157370_10037443 3300013104 Bacteria 4702
242 Ga0157370_10044127 3300013104 Bacteria 4287
243 Ga0157370_10421304 3300013104 Bacteria 1228
244 Ga0157369_10005690 3300013105 Bacteria 14475
245 Ga0157369_10314084 3300013105 Bacteria 1629
246 Ga0157374_10034539 3300013296 Bacteria 4620
247 Ga0157374_10074134 3300013296 Bacteria 3213
248 Ga0157374_10169643 3300013296 Bacteria 2128
249 Ga0157374_10494389 3300013296 Bacteria 1227
250 Ga0157378_10229724 3300013297 Bacteria 1767
251 Ga0163162_10068152 3300013306 Bacteria 3609
252 Ga0163162_10165803 3300013306 Bacteria 2333
253 Ga0157372_10025789 3300013307 Bacteria 6393
254 Ga0157372_10091442 3300013307 Bacteria 3461
255 Ga0157375_10032542 3300013308 Bacteria 4946
256 Ga0157375_10072895 3300013308 Bacteria 3451
257 Ga0163163_10000224 3300014325 Bacteria 58364
258 Ga0163163_10060146 3300014325 Bacteria 3761
259 Ga0163163_10388959 3300014325 Bacteria 1452
260 Ga0157380_10009519 3300014326 Bacteria 6968
261 Ga0157380_10642912 3300014326 Bacteria 1057
262 Ga0157377_10029000 3300014745 Bacteria 2984
263 Ga0157379_10008268 3300014968 Bacteria 9042
264 Ga0157379_10017027 3300014968 Bacteria 6398
265 Ga0157379_10026449 3300014968 Bacteria 5166
266 Ga0157379_10760097 3300014968 Bacteria 913
267 Ga0157376_10245155 3300014969 Bacteria 1671
268 Ga0213874_10016451 3300021377 Bacteria 1969
269 Ga0213874_10031242 3300021377 Bacteria 1540
270 Ga0213876_10025821 3300021384 Bacteria 3097
271 Ga0213875_10077555 3300021388 Bacteria 1551
272 Ga0207642_10059297 3300025899 Bacteria 1769
273 Ga0207710_10000933 3300025900 Bacteria 15560
274 Ga0207710_10217357 3300025900 Bacteria 948
275 Ga0207688_10067867 3300025901 Bacteria 2018
276 Ga0207680_10071994 3300025903 Bacteria 2144
277 Ga0207680_10088588 3300025903 Bacteria 1963
278 Ga0207699_10000104 3300025906 Bacteria 60711
279 Ga0207699_10019784 3300025906 Bacteria 3597
280 Ga0207699_10103833 3300025906 Bacteria 1809
281 Ga0207699_10232692 3300025906 Bacteria 1263
282 Ga0207645_10037462 3300025907 Bacteria 3112
283 Ga0207705_10000418 3300025909 Bacteria 37385
284 Ga0207654_10030759 3300025911 Bacteria 2950
285 Ga0207707_10000094 3300025912 Bacteria 89818
286 Ga0207707_10003808 3300025912 Bacteria 13370
287 Ga0207707_10018500 3300025912 Bacteria 6073
288 Ga0207707_10066336 3300025912 Bacteria 3143
289 Ga0207707_10285609 3300025912 Bacteria 1428
290 Ga0207695_10030245 3300025913 Bacteria 5964
291 Ga0207695_10033954 3300025913 Bacteria 5554
292 Ga0207695_10034537 3300025913 Bacteria 5497
293 Ga0207695_10042966 3300025913 Bacteria 4821
294 Ga0207695_10065688 3300025913 Bacteria 3729
295 Ga0207695_10081742 3300025913 Bacteria 3268
296 Ga0207695_10085650 3300025913 Bacteria 3180
297 Ga0207695_10135105 3300025913 Bacteria 2420
298 Ga0207695_10186234 3300025913 Bacteria 1995
299 Ga0207695_10189005 3300025913 Bacteria 1977
300 Ga0207671_10038756 3300025914 Bacteria 3531
301 Ga0207671_10060225 3300025914 Bacteria 2816
302 Ga0207671_10165061 3300025914 Bacteria 1717
303 Ga0207671_10217537 3300025914 Bacteria 1496
304 Ga0207671_10579844 3300025914 Bacteria 894
305 Ga0207693_10003070 3300025915 Bacteria 14405
306 Ga0207693_10020163 3300025915 Bacteria 5304
307 Ga0207693_10288170 3300025915 Bacteria 1287
308 Ga0207663_10059044 3300025916 Bacteria 2424
309 Ga0207663_10269537 3300025916 Bacteria 1261
310 Ga0207660_10003683 3300025917 Bacteria 9990
311 Ga0207660_10056250 3300025917 Bacteria 2814
312 Ga0207660_10088885 3300025917 Bacteria 2286
313 Ga0207660_10503604 3300025917 Bacteria 983
314 Ga0207662_10005619 3300025918 Bacteria 6706
315 Ga0207657_10004952 3300025919 Bacteria 14016
316 Ga0207657_10114611 3300025919 Bacteria 2222
317 Ga0207657_10218018 3300025919 Bacteria 1529
318 Ga0207649_10080241 3300025920 Bacteria 2110
319 Ga0207652_10003121 3300025921 Bacteria 13813
320 Ga0207652_10011314 3300025921 Bacteria 7190
321 Ga0207652_10038059 3300025921 Bacteria 4075
322 Ga0207652_10119697 3300025921 Bacteria 2342
323 Ga0207652_10231444 3300025921 Bacteria 1665
324 Ga0207652_10294565 3300025921 Bacteria 1464
325 Ga0207681_10054586 3300025923 Bacteria 2717
326 Ga0207694_10011442 3300025924 Bacteria 6696
327 Ga0207694_10057032 3300025924 Bacteria 3035
328 Ga0207694_10247688 3300025924 Bacteria 1457
329 Ga0207694_10295280 3300025924 Bacteria 1333
330 Ga0207694_10529201 3300025924 Bacteria 988
331 Ga0207650_10049485 3300025925 Bacteria 3104
332 Ga0207659_10032545 3300025926 Bacteria 3580
333 Ga0207659_10319133 3300025926 Bacteria 1281
334 Ga0207687_10016415 3300025927 Bacteria 4864
335 Ga0207700_10000335 3300025928 Bacteria 27697
336 Ga0207700_10030158 3300025928 Bacteria 3837
337 Ga0207700_10363340 3300025928 Bacteria 1263
338 Ga0207664_10015253 3300025929 Bacteria 5570
339 Ga0207664_10058745 3300025929 Bacteria 3061
340 Ga0207664_10087010 3300025929 Bacteria 2554
341 Ga0207644_10038265 3300025931 Bacteria 3378
342 Ga0207644_10197769 3300025931 Bacteria 1584
343 Ga0207690_10019811 3300025932 Bacteria 4146
344 Ga0207706_10010097 3300025933 Bacteria 8647
345 Ga0207706_10028926 3300025933 Bacteria 4947
346 Ga0207686_10147679 3300025934 Bacteria 1633
347 Ga0207686_10364428 3300025934 Bacteria 1092
348 Ga0207665_10055300 3300025939 Bacteria 2677
349 Ga0207665_10090135 3300025939 Bacteria 2125
350 Ga0207665_10140055 3300025939 Bacteria 1724
351 Ga0207691_10027055 3300025940 Bacteria 5382
352 Ga0207691_10221902 3300025940 Bacteria 1639
353 Ga0207711_10000003 3300025941 Bacteria 1042791
354 Ga0207689_10107137 3300025942 Bacteria 2297
355 Ga0207661_10121207 3300025944 Bacteria 2227
356 Ga0207661_10188121 3300025944 Bacteria 1808
357 Ga0207679_10006329 3300025945 Bacteria 7479
358 Ga0207667_10001596 3300025949 Bacteria 28502
359 Ga0207667_10003668 3300025949 Bacteria 18928
360 Ga0207667_10029961 3300025949 Bacteria 5894
361 Ga0207667_10103023 3300025949 Bacteria 2944
362 Ga0207651_10004330 3300025960 Bacteria 7132
363 Ga0207712_10007064 3300025961 Bacteria 7082
364 Ga0207712_10017096 3300025961 Bacteria 4706
365 Ga0207712_10042910 3300025961 Bacteria 3117
366 Ga0207668_10022023 3300025972 Bacteria 4072
367 Ga0207668_10065206 3300025972 Bacteria 2577
368 Ga0207640_10136532 3300025981 Bacteria 1781
369 Ga0207658_10004874 3300025986 Bacteria 9262
370 Ga0207658_10086116 3300025986 Bacteria 2422
371 Ga0207658_10244985 3300025986 Bacteria 1520
372 Ga0207677_10131743 3300026023 Bacteria 1900
373 Ga0207703_10000259 3300026035 Bacteria 59607
374 Ga0207703_10006874 3300026035 Bacteria 9059
375 Ga0207703_10297289 3300026035 Bacteria 1471
376 Ga0207703_10353111 3300026035 Bacteria 1354
377 Ga0207639_10574293 3300026041 Bacteria 1037
378 Ga0207678_10032626 3300026067 Bacteria 4538
379 Ga0207678_10349626 3300026067 Bacteria 1275
380 Ga0207708_10024029 3300026075 Bacteria 4609
381 Ga0207708_10159685 3300026075 Bacteria 1779
382 Ga0207702_10000045 3300026078 Bacteria 144714
383 Ga0207702_10049989 3300026078 Bacteria 3529
384 Ga0207702_10175845 3300026078 Bacteria 1967
385 Ga0207641_10000196 3300026088 Bacteria 81985
386 Ga0207641_10002905 3300026088 Bacteria 15500
387 Ga0207641_10006042 3300026088 Bacteria 10261
388 Ga0207648_10023272 3300026089 Bacteria 5555
389 Ga0207648_10140388 3300026089 Bacteria 2129
390 Ga0207676_10010514 3300026095 Bacteria 6593
391 Ga0207676_10164863 3300026095 Bacteria 1924
392 Ga0207674_10000026 3300026116 Bacteria 151359
393 Ga0207674_10040771 3300026116 Bacteria 4807
394 Ga0207675_100006173 3300026118 Bacteria 11383
395 Ga0207675_100038632 3300026118 Bacteria 4454
396 Ga0207675_100046089 3300026118 Bacteria 4072
397 Ga0207675_100189057 3300026118 Bacteria 1974
398 Ga0207675_100541579 3300026118 Bacteria 1162
399 Ga0207683_10064816 3300026121 Bacteria 3220
400 Ga0207683_10467184 3300026121 Unclassified 1164
401 Ga0207698_10909913 3300026142 Bacteria 887
402 Ga0209179_1010003 3300027512 Bacteria 1641
403 Ga0209179_1024902 3300027512 Bacteria 1190
404 Ga0209983_1005372 3300027665 Bacteria 2656
405 Ga0209588_1028331 3300027671 Bacteria 1783
406 Ga0207428_10070656 3300027907 Bacteria 2744
407 Ga0268266_10000512 3300028379 Bacteria 54629
408 Ga0268266_10009688 3300028379 Bacteria 8465
409 Ga0268266_10010214 3300028379 Bacteria 8224
410 Ga0268266_10090242 3300028379 Bacteria 2686
411 Ga0268266_10149071 3300028379 Bacteria 2106
412 Ga0268266_10451342 3300028379 Bacteria 1222
413 Ga0268265_10001867 3300028380 Bacteria 16773
414 Ga0268265_10027901 3300028380 Bacteria 4036
415 Ga0268265_10037669 3300028380 Bacteria 3551
416 Ga0268264_10000182 3300028381 Bacteria 134007
417 Ga0268264_10025318 3300028381 Bacteria 4847
418 Ga0268264_10648480 3300028381 Bacteria 1045
419 Ga0265334_10023301 3300028573 Bacteria 2518
420 Ga0265318_10001660 3300028577 Bacteria 12792
421 Ga0307515_10055442 3300028794 Bacteria 5791
422 Ga0265338_10000017 3300028800 Bacteria 344481
423 Ga0265338_10426543 3300028800 Bacteria 942
424 Ga0307511_10000008 3300030521 Bacteria 159928
425 Ga0265330_10010677 3300031235 Bacteria 4322
426 Ga0265328_10010751 3300031239 Bacteria 3676
427 Ga0265320_10089932 3300031240 Bacteria 1423
428 Ga0265325_10000008 3300031241 Bacteria 186174
429 Ga0265329_10013556 3300031242 Bacteria 2901
430 Ga0265340_10000054 3300031247 Bacteria 53196
431 Ga0265340_10013729 3300031247 Bacteria 4248
432 Ga0265339_10001599 3300031249 Bacteria 16756
433 Ga0265331_10021786 3300031250 Bacteria 3275
434 Ga0265331_10035413 3300031250 Bacteria 2456
435 Ga0265331_10045023 3300031250 Bacteria 2131
436 Ga0265316_10008009 3300031344 Bacteria 9865
437 Ga0265316_10026388 3300031344 Bacteria 4833
438 Ga0265316_10321874 3300031344 Bacteria 1123
439 Ga0307513_10129833 3300031456 Bacteria 2468
440 Ga0307513_10129948 3300031456 Bacteria 2467
441 Ga0307509_10000099 3300031507 Bacteria 121307
442 Ga0307509_10000154 3300031507 Bacteria 106459
443 Ga0307408_100007916 3300031548 Bacteria 7026
444 Ga0307408_100032300 3300031548 Bacteria 3649
445 Ga0307408_100176127 3300031548 Bacteria 1711
446 Ga0265313_10002014 3300031595 Bacteria 18229
447 Ga0265313_10011807 3300031595 Bacteria 5400
448 Ga0265313_10012307 3300031595 Bacteria 5235
449 Ga0265313_10107543 3300031595 Bacteria 1230
450 Ga0265342_10003097 3300031712 Bacteria 13890
451 Ga0265342_10011102 3300031712 Bacteria 6183
452 Ga0265342_10113422 3300031712 Bacteria 1532
453 Ga0316576_10108570 3300031727 Bacteria 2079
454 Ga0307413_10017158 3300031824 Bacteria 3765
455 Ga0307413_10526681 3300031824 Bacteria 954
456 Ga0307409_100233820 3300031995 Bacteria 1668
457 Ga0307416_100005410 3300032002 Bacteria 7838
458 Ga0307411_10109890 3300032005 Bacteria 1970
459 Ga0307411_10522313 3300032005 Bacteria 1008
460 Ga0307415_100261549 3300032126 Bacteria 1412
461 Ga0307510_10000003 3300033180 Bacteria 756654
462 Ga0307510_10004142 3300033180 Bacteria 17024
463 Ga0373958_0022342 3300034819 Bacteria 1181
464 Ga0373934_0143455 3300035086 Bacteria 977
465 Ga0373936_0029807 3300035113 Bacteria 2149
466 Ga0373939_0112563 3300035114 Bacteria 950
467 Ga0373954_0136292 3300035118 Bacteria 1196
468 Ga0373960_0055800 3300035121 Bacteria 1185
469 Ga0373943_0012543 3300035170 Bacteria 3819
470 Ga0373943_0173100 3300035170 Bacteria 1182
471 Ga0316574_0250414 3300035398 Bacteria 1132
472 Ga0373931_0028615 3300035691 Bacteria 2855
473 Ga0373935_0033430 3300035692 Bacteria 3200
474 Ga0373935_0333695 3300035692 Bacteria 1078
475 Ga0373927_0040298 3300035695 Bacteria 3030
476 Ga0373933_0010033 3300035724 Bacteria 5185
477 Ga0373933_0051341 3300035724 Unclassified 2464
478 Ga0373947_0014193 3300035725 Bacteria 4568
479 Ga0373937_0019319 3300036401 Bacteria 6097
480 Ga0373937_0208674 3300036401 Unclassified 1837
481 Ga0373937_0476545 3300036401 Bacteria 1185
482 Ga0373925_0005045 3300037068 Bacteria 9901
483 Ga0373925_0281495 3300037068 Bacteria 1339
484 Ga0395905_0767652 3300037471 Bacteria 867
485 Ga0436364_0227708 3300037853 Bacteria 2809
486 Ga0436364_0486989 3300037853 Bacteria 773
487 Ga0436365_0991661 3300039437 Bacteria 5505
488 Ga0436365_1473558 3300039437 Bacteria 3190
489 Ga0436360_0326253 3300039438 Bacteria 935
490 Ga0436360_0624728 3300039438 Bacteria 2040
491 Ga0436361_0132850 3300039447 Bacteria 3980
492 Ga0436363_0209315 3300039450 Bacteria 1048
493 Ga0436363_0517558 3300039450 Bacteria 6614
494 Ga0436363_1409576 3300039450 Bacteria 9695
495 Ga0436363_1476208 3300039450 Bacteria 2359
496 Ga0436362_0524883 3300039453 Bacteria 1017
497 Ga0439466_0024021 3300041411 Bacteria 2140
498 Ga0439437_001170 3300042000 Bacteria 2746
499 Ga0439455_0028446 3300042012 Bacteria 1376
500 Ga0439456_053821 3300042013 Bacteria 881
501 Ga0450911_000008 3300042115 Bacteria 168304
502 Ga0450895_002243 3300042132 Bacteria 1427
503 Ga0450902_032557 3300042137 Bacteria 879
504 Ga0450904_000004 3300042139 Bacteria 62161
505 Ga0450906_027675 3300042145 Bacteria 1005
506 Ga0439446_0000721 3300042156 Bacteria 6892
507 Ga0439446_0012537 3300042156 Bacteria 2315
508 Ga0439435_0103729 3300042436 Bacteria 876
509 Ga0439459_0024299 3300042438 Bacteria 1187
510 Ga0439460_0033412 3300042461 Bacteria 1477
511 Ga0450893_0000346 3300042532 Bacteria 6432
512 Ga0450893_0026708 3300042532 Bacteria 1016
513 Ga0451577_0007135 3300042876 Bacteria 11020
514 Ga0451577_0311205 3300042876 Bacteria 1428
515 Ga0466969_0018357 3300044656 Bacteria 3645
516 Ga0466969_0039567 3300044656 Bacteria 2367
517 Ga0466969_0140916 3300044656 Bacteria 1114
518 Ga0466959_0040445 3300045049 Bacteria 3444
519 Ga0451576_0003293 3300045051 Bacteria 22424
520 Ga0451576_0078101 3300045051 Bacteria 3445
521 Ga0495638_0001409 3300046460 Bacteria 21856
522 Ga0495638_0017538 3300046460 Bacteria 4770
523 Ga0495651_0092349 3300046462 Bacteria 2268
524 Ga0495650_0026413 3300046471 Bacteria 2702
525 Ga0495580_0419786 3300046472 Bacteria 900
526 Ga0495606_0032078 3300046507 Bacteria 3644
527 Ga0495606_0440343 3300046507 Bacteria 670
528 Ga0495640_0006768 3300046533 Bacteria 9044
529 Ga0495645_0265094 3300046543 Bacteria 1136
530 Ga0495634_0191876 3300046642 Bacteria 1274
531 Ga0495625_0079278 3300046660 Bacteria 2290
532 Ga0495625_0124535 3300046660 Bacteria 1751
533 Ga0495659_0073761 3300046664 Bacteria 1283
534 Ga0495623_0027113 3300046679 Bacteria 3685
535 Ga0495671_0026581 3300046692 Bacteria 2999
536 Ga0495649_0117893 3300046694 Bacteria 1405
537 Ga0495604_0243713 3300047317 Bacteria 1228
538 Ga0495672_0008659 3300047320 Bacteria 7478
539 Ga0495672_0018987 3300047320 Bacteria 4547
540 Ga0495672_0094644 3300047320 Bacteria 1633
541 Ga0495687_082743 3300047443 Bacteria 1252
542 Ga0495675_0099446 3300047444 Bacteria 1822
543 Ga0495684_0130141 3300047471 Bacteria 1891
544 Ga0495602_0142475 3300048088 Bacteria 1896
545 Ga0496100_0232163 3300048903 Bacteria 1358
546 Ga0496100_0456567 3300048903 Bacteria 980
547 Ga0496101_0163715 3300048904 Bacteria 1707
548 Ga0496101_0184979 3300048904 Bacteria 1606
549 Ga0496102_0004416 3300048905 Bacteria 11878
550 Ga0496102_0014849 3300048905 Bacteria 6775
551 Ga0496103_0089733 3300048906 Bacteria 1939
552 Ga0496104_0006495 3300048907 Bacteria 10283
553 Ga0496104_0089374 3300048907 Bacteria 2943
554 Ga0496105_0130713 3300048908 Bacteria 2070
555 Ga0496106_0225072 3300048909 Bacteria 1496
556 Ga0496106_0718481 3300048909 Bacteria 796
557 Ga0496107_0228677 3300048910 Unclassified 1384
558 Ga0496108_0042139 3300048911 Bacteria 3811
559 Ga0496109_0229342 3300048912 Bacteria 1747
560 Ga0496109_0492969 3300048912 Bacteria 1156
561 Ga0496110_0184964 3300048913 Bacteria 1892
562 Ga0496111_0301357 3300048914 Bacteria 1188
563 Ga0496112_0066496 3300048915 Bacteria 3557
564 Ga0496112_0200136 3300048915 Bacteria 1957
565 Ga0496113_0026120 3300048916 Bacteria 4172
566 Ga0496114_0375658 3300048917 Unclassified 1258
567 Ga0496114_0560386 3300048917 Bacteria 1009
568 Ga0496115_0018696 3300048918 Bacteria 5327
569 Ga0496115_0155234 3300048918 Bacteria 1891
570 Ga0496116_0003291 3300048919 Bacteria 16067
571 Ga0496117_0000095 3300048920 Bacteria 198731
572 Ga0496118_0000003 3300048921 Bacteria 773148
573 Ga0496118_0088844 3300048921 Bacteria 2136
574 Ga0496118_0116563 3300048921 Bacteria 1755
575 Ga0496119_0009520 3300048922 Bacteria 8320
576 Ga0496119_0020125 3300048922 Bacteria 4879
577 Ga0496119_0138697 3300048922 Bacteria 1316
578 Ga0496120_0000693 3300048923 Bacteria 49436
579 Ga0496120_0117155 3300048923 Bacteria 1382
580 Ga0496121_0009504 3300048924 Bacteria 11156
581 Ga0496121_0011641 3300048924 Bacteria 9727
582 Ga0496124_0005346 3300048927 Bacteria 14493
583 Ga0496125_0000112 3300048928 Bacteria 188192
584 Ga0496125_0027039 3300048928 Bacteria 5210
585 Ga0496126_0002920 3300048929 Bacteria 22234
586 Ga0496126_0003855 3300048929 Bacteria 18532
587 Ga0496126_0009185 3300048929 Bacteria 10546
588 Ga0496126_0045173 3300048929 Bacteria 4051
589 Ga0496126_0064500 3300048929 Bacteria 3281
590 Ga0501299_016954 3300049522 Bacteria 1295
591 Ga0501033_0012309 3300049570 Bacteria 6530
592 Ga0501033_0046837 3300049570 Bacteria 3215
593 Ga0501034_0023505 3300049571 Bacteria 6281
594 Ga0501036_0298441 3300049572 Bacteria 1348
595 Ga0501036_0311051 3300049572 Bacteria 1317
596 Ga0501038_0270058 3300049574 Bacteria 1341
597 Ga0501041_0085994 3300049577 Bacteria 1940
598 Ga0501042_0108676 3300049578 Bacteria 1997
599 Ga0501042_0381242 3300049578 Bacteria 1021
600 Ga0501046_0063072 3300049580 Bacteria 2894
601 Ga0501047_0000618 3300049581 Bacteria 37530
602 Ga0501047_0075687 3300049581 Bacteria 3239
603 Ga0501048_0077144 3300049582 Bacteria 2352
604 Ga0501070_0042982 3300049586 Bacteria 3762
605 Ga0501071_0147652 3300049587 Bacteria 1753
606 Ga0501072_0352717 3300049588 Bacteria 1168
607 Ga0501073_0074078 3300049589 Bacteria 2371
608 Ga0501075_0142808 3300049591 Bacteria 1825
609 Ga0501076_0186284 3300049592 Bacteria 1693
610 Ga0501044_0032978 3300049823 Bacteria 5443
611 Ga0501044_0456593 3300049823 Bacteria 1183
612 Ga0501044_0470633 3300049823 Bacteria 1161
613 Ga0501226_000005 3300049853 Bacteria 271019
614 nmdc:mga05p37_15071_c1 3300050507 Bacteria 9282
615 nmdc:mga05p37_419090_c1 3300050507 Bacteria 1558
616 nmdc:mga09592_1068_c1 3300050508 Bacteria 21776
617 nmdc:mga09592_32074_c1 3300050508 Bacteria 4379
618 nmdc:mga0qj67_1805_c1 3300050509 Bacteria 15127
619 nmdc:mga0qj67_239275_c1 3300050509 Bacteria 1473
620 nmdc:mga0qj67_2664_c1 3300050509 Bacteria 12788
621 nmdc:mga0qj67_351273_c1 3300050509 Bacteria 1192
622 nmdc:mga0qj67_41338_c1 3300050509 Bacteria 3626
623 nmdc:mga0qj67_50623_c1 3300050509 Bacteria 3285
624 nmdc:mga06r32_111861_c1 3300050510 Bacteria 2687
625 nmdc:mga06r32_294_c1 3300050510 Bacteria 41509
626 nmdc:mga06r32_4213_c1 3300050510 Bacteria 12884
627 nmdc:mga08y16_123023_c1 3300050511 Bacteria 2700
628 nmdc:mga0n895_33474_c1 3300050512 Bacteria 4940
629 nmdc:mga0n895_404788_c1 3300050512 Bacteria 1380
630 nmdc:mga0n895_71599_c1 3300050512 Bacteria 3438
631 nmdc:mga0rr50_485618_c1 3300050513 Bacteria 1049
632 nmdc:mga0rr50_8286_c1 3300050513 Bacteria 4957
633 nmdc:mga08x19_100_c1 3300050514 Bacteria 76036
634 nmdc:mga08x19_23616_c1 3300050514 Bacteria 3815
635 Ga0495619_0034228 3300053085 Bacteria 3303
636 Ga0500644_0047545 3300053088 Bacteria 1456
637 Ga0500583_0012417 3300053092 Bacteria 3249
638 Ga0500583_0022380 3300053092 Bacteria 2646
639 Ga0500583_0062805 3300053092 Bacteria 1757
640 Ga0500641_0075097 3300053096 Bacteria 1428
641 Ga0500650_0046612 3300053098 Bacteria 2009
642 Ga0500556_0068801 3300053104 Bacteria 1319
643 Ga0500591_085117 3300053115 Bacteria 1395
644 Ga0500614_067344 3300053123 Bacteria 976
645 Ga0500617_005236 3300053124 Bacteria 4937
646 Ga0500617_059969 3300053124 Bacteria 1686
647 Ga0500658_0034738 3300053134 Bacteria 1992
648 Ga0500568_0036113 3300053139 Bacteria 2013
649 Ga0500568_0056190 3300053139 Bacteria 1534
650 Ga0500568_0117369 3300053139 Bacteria 992
651 Ga0500588_0004209 3300053146 Bacteria 3102
652 Ga0500588_0008613 3300053146 Bacteria 2391
653 Ga0500589_082919 3300053147 Bacteria 1428
654 Ga0500622_0001895 3300053156 Bacteria 15796
655 Ga0500622_0011421 3300053156 Bacteria 4837
656 Ga0500622_0028001 3300053156 Bacteria 2968
657 Ga0500630_064737 3300053159 Bacteria 1741
658 Ga0500636_0167225 3300053177 Bacteria 1193
659 Ga0500637_0001099 3300053178 Bacteria 11152
660 Ga0500637_0050556 3300053178 Bacteria 2369
661 Ga0500637_0063113 3300053178 Bacteria 2124
662 Ga0500637_0078151 3300053178 Bacteria 1909
663 Ga0501084_0000106 3300054114 Bacteria 62239
664 Ga0501084_0108946 3300054114 Bacteria 2327
665 Ga0501084_0250959 3300054114 Bacteria 1494
666 Ga0501082_0138390 3300060353 Bacteria 2113

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0456567 Ga0496100_0456567_352_963 203
2 3300005547 Ga0070693_100046047 Ga0070693_1000460472 211
3 3300009098 Ga0105245_10027245 Ga0105245_100272452 212
4 3300025927 Ga0207687_10016415 Ga0207687_100164155 212
5 3300028577 Ga0265318_10001660 Ga0265318_1000166011 213
6 3300031240 Ga0265320_10089932 Ga0265320_100899322 213
7 3300031250 Ga0265331_10045023 Ga0265331_100450232 213
8 3300031595 Ga0265313_10011807 Ga0265313_100118073 213
9 3300035086 Ga0373934_0143455 Ga0373934_0143455_282_959 213
10 3300027512 Ga0209179_1024902 Ga0209179_10249022 214
11 3300035692 Ga0373935_0033430 Ga0373935_0033430_2336_3067 214
12 3300039437 Ga0436365_0991661 Ga0436365_0991661_846_1571 214
13 3300050512 nmdc:mga0n895_71599_c1 nmdc:mga0n895_71599_c1_861_1595 214
14 3300046507 Ga0495606_0440343 Ga0495606_0440343_12_659 215
15 3300005434 Ga0070709_10001572 Ga0070709_100015725 216
16 3300005435 Ga0070714_100030694 Ga0070714_1000306942 216
17 3300005436 Ga0070713_100000866 Ga0070713_10000086613 216
18 3300005437 Ga0070710_10059059 Ga0070710_100590592 216
19 3300005439 Ga0070711_100561413 Ga0070711_1005614131 216
20 3300005546 Ga0070696_100186177 Ga0070696_1001861772 216
21 3300005614 Ga0068856_100002253 Ga0068856_1000022535 216
22 3300006173 Ga0070716_100062491 Ga0070716_1000624912 216
23 3300006175 Ga0070712_100000181 Ga0070712_10000018110 216
24 3300006237 Ga0097621_100433079 Ga0097621_1004330792 216
25 3300006914 Ga0075436_100000796 Ga0075436_10000079615 216
26 3300007076 Ga0075435_100021729 Ga0075435_1000217292 216
27 3300014968 Ga0157379_10026449 Ga0157379_100264494 216
28 3300025906 Ga0207699_10000104 Ga0207699_1000010432 216
29 3300025915 Ga0207693_10003070 Ga0207693_1000307011 216
30 3300025928 Ga0207700_10000335 Ga0207700_100003356 216
31 3300025929 Ga0207664_10015253 Ga0207664_100152537 216
32 3300025939 Ga0207665_10090135 Ga0207665_100901352 216
33 3300026078 Ga0207702_10000045 Ga0207702_1000004588 216
34 3300050512 nmdc:mga0n895_33474_c1 nmdc:mga0n895_33474_c1_2014_2748 216
35 3300050513 nmdc:mga0rr50_8286_c1 nmdc:mga0rr50_8286_c1_744_1478 216
36 3300050514 nmdc:mga08x19_100_c1 nmdc:mga08x19_100_c1_38393_39127 216
37 3300021384 Ga0213876_10025821 Ga0213876_100258213 217
38 3300013104 Ga0157370_10421304 Ga0157370_104213042 218
39 3300049570 Ga0501033_0012309 Ga0501033_0012309_3032_3766 218
40 3300049586 Ga0501070_0042982 Ga0501070_0042982_910_1644 218
41 3300035121 Ga0373960_0055800 Ga0373960_0055800_491_1153 220
42 3300042461 Ga0439460_0033412 Ga0439460_0033412_684_1418 222
43 3300048907 Ga0496104_0089374 Ga0496104_0089374_2261_2929 222
44 3300007265 Ga0099794_10009212 Ga0099794_100092122 226
45 3300009177 Ga0105248_10000013 Ga0105248_10000013143 226
46 3300021388 Ga0213875_10077555 Ga0213875_100775552 226
47 3300025941 Ga0207711_10000003 Ga0207711_10000003143 226
48 3300027671 Ga0209588_1028331 Ga0209588_10283312 226
49 3300039450 Ga0436363_0209315 Ga0436363_0209315_233_967 226
50 3300048910 Ga0496107_0228677 Ga0496107_0228677_386_1135 226
51 3300048913 Ga0496110_0184964 Ga0496110_0184964_1127_1876 226
52 3300050513 nmdc:mga0rr50_485618_c1 nmdc:mga0rr50_485618_c1_299_1021 226
53 3300006028 Ga0070717_10076653 Ga0070717_100766532 227
54 3300010159 Ga0099796_10048797 Ga0099796_100487972 227
55 3300035170 Ga0373943_0012543 Ga0373943_0012543_920_1654 227
56 3300035695 Ga0373927_0040298 Ga0373927_0040298_580_1314 227
57 3300037068 Ga0373925_0281495 Ga0373925_0281495_260_994 227
58 3300048904 Ga0496101_0184979 Ga0496101_0184979_564_1313 227
59 3300048907 Ga0496104_0006495 Ga0496104_0006495_9396_10145 227
60 3300048912 Ga0496109_0229342 Ga0496109_0229342_946_1695 227
61 3300048917 Ga0496114_0560386 Ga0496114_0560386_222_971 227
62 3300048918 Ga0496115_0018696 Ga0496115_0018696_4387_5136 227
63 3300054114 Ga0501084_0108946 Ga0501084_0108946_1578_2312 227
64 3300006175 Ga0070712_100034312 Ga0070712_1000343125 228
65 3300013297 Ga0157378_10229724 Ga0157378_102297242 228
66 3300025915 Ga0207693_10288170 Ga0207693_102881702 228
67 3300035170 Ga0373943_0173100 Ga0373943_0173100_75_809 228
68 3300035725 Ga0373947_0014193 Ga0373947_0014193_62_796 228
69 3300037068 Ga0373925_0005045 Ga0373925_0005045_1503_2237 228
70 3300046533 Ga0495640_0006768 Ga0495640_0006768_7518_8252 228
71 3300046642 Ga0495634_0191876 Ga0495634_0191876_451_1185 228
72 3300047471 Ga0495684_0130141 Ga0495684_0130141_73_807 228
73 3300048917 Ga0496114_0375658 Ga0496114_0375658_281_1015 228
74 3300007788 Ga0099795_10000673 Ga0099795_100006736 229
75 3300010159 Ga0099796_10000179 Ga0099796_100001797 229
76 3300027512 Ga0209179_1010003 Ga0209179_10100032 229
77 3300053156 Ga0500622_0011421 Ga0500622_0011421_3274_4008 229
78 3300009176 Ga0105242_10688117 Ga0105242_106881172 230
79 3300025934 Ga0207686_10364428 Ga0207686_103644282 230
80 3300037853 Ga0436364_0227708 Ga0436364_0227708_108_842 230
81 3300037853 Ga0436364_0486989 Ga0436364_0486989_13_747 230
82 3300039438 Ga0436360_0326253 Ga0436360_0326253_167_901 230
83 3300005336 Ga0070680_100037681 Ga0070680_1000376813 231
84 3300005336 Ga0070680_100102832 Ga0070680_1001028322 231
85 3300005339 Ga0070660_100242406 Ga0070660_1002424062 231
86 3300005345 Ga0070692_10080580 Ga0070692_100805802 231
87 3300005347 Ga0070668_100045493 Ga0070668_1000454932 231
88 3300005353 Ga0070669_100007529 Ga0070669_1000075297 231
89 3300005438 Ga0070701_10487304 Ga0070701_104873041 231
90 3300005441 Ga0070700_100041276 Ga0070700_1000412761 231
91 3300005455 Ga0070663_100796645 Ga0070663_1007966451 231
92 3300005457 Ga0070662_100078592 Ga0070662_1000785922 231
93 3300005458 Ga0070681_10129381 Ga0070681_101293812 231
94 3300005530 Ga0070679_100088281 Ga0070679_1000882812 231
95 3300005719 Ga0068861_100089702 Ga0068861_1000897022 231
96 3300005844 Ga0068862_100015763 Ga0068862_1000157635 231
97 3300006880 Ga0075429_100031359 Ga0075429_1000313594 231
98 3300009094 Ga0111539_10022128 Ga0111539_100221284 231
99 3300009174 Ga0105241_10471341 Ga0105241_104713412 231
100 3300009553 Ga0105249_10080123 Ga0105249_100801232 231
101 3300010375 Ga0105239_10382350 Ga0105239_103823502 231
102 3300014326 Ga0157380_10642912 Ga0157380_106429122 231
103 3300025907 Ga0207645_10037462 Ga0207645_100374622 231
104 3300025912 Ga0207707_10285609 Ga0207707_102856092 231
105 3300025917 Ga0207660_10088885 Ga0207660_100888853 231
106 3300025919 Ga0207657_10218018 Ga0207657_102180182 231
107 3300025921 Ga0207652_10231444 Ga0207652_102314442 231
108 3300025923 Ga0207681_10054586 Ga0207681_100545862 231
109 3300025933 Ga0207706_10010097 Ga0207706_100100978 231
110 3300025972 Ga0207668_10022023 Ga0207668_100220232 231
111 3300026067 Ga0207678_10349626 Ga0207678_103496262 231
112 3300026075 Ga0207708_10159685 Ga0207708_101596852 231
113 3300026095 Ga0207676_10164863 Ga0207676_101648632 231
114 3300026118 Ga0207675_100046089 Ga0207675_1000460894 231
115 3300026121 Ga0207683_10467184 Ga0207683_104671842 231
116 3300027907 Ga0207428_10070656 Ga0207428_100706563 231
117 3300028380 Ga0268265_10001867 Ga0268265_1000186714 231
118 3300031250 Ga0265331_10021786 Ga0265331_100217862 231
119 3300031712 Ga0265342_10113422 Ga0265342_101134222 231
120 3300032005 Ga0307411_10522313 Ga0307411_105223132 231
121 3300048088 Ga0495602_0142475 Ga0495602_0142475_751_1485 231
122 3300049570 Ga0501033_0046837 Ga0501033_0046837_2356_3105 231
123 3300049572 Ga0501036_0298441 Ga0501036_0298441_391_1140 231
124 3300049580 Ga0501046_0063072 Ga0501046_0063072_339_1073 231
125 3300049581 Ga0501047_0000618 Ga0501047_0000618_10665_11399 231
126 3300049581 Ga0501047_0075687 Ga0501047_0075687_325_1074 231
127 3300049582 Ga0501048_0077144 Ga0501048_0077144_1407_2156 231
128 3300049589 Ga0501073_0074078 Ga0501073_0074078_738_1472 231
129 3300049823 Ga0501044_0032978 Ga0501044_0032978_2792_3526 231
130 3300049823 Ga0501044_0456593 Ga0501044_0456593_175_924 231
131 3300050510 nmdc:mga06r32_111861_c1 nmdc:mga06r32_111861_c1_1587_2333 231
132 3300050511 nmdc:mga08y16_123023_c1 nmdc:mga08y16_123023_c1_326_1072 231
133 3300005341 Ga0070691_10000119 Ga0070691_100001198 232
134 3300005345 Ga0070692_10079488 Ga0070692_100794882 232
135 3300005434 Ga0070709_10092457 Ga0070709_100924572 232
136 3300005436 Ga0070713_100034919 Ga0070713_1000349192 232
137 3300005545 Ga0070695_100027998 Ga0070695_1000279982 232
138 3300005564 Ga0070664_100238064 Ga0070664_1002380642 232
139 3300005577 Ga0068857_100000836 Ga0068857_1000008365 232
140 3300005578 Ga0068854_100104576 Ga0068854_1001045762 232
141 3300005614 Ga0068856_100004043 Ga0068856_1000040437 232
142 3300006871 Ga0075434_100033051 Ga0075434_1000330514 232
143 3300006914 Ga0075436_100029672 Ga0075436_1000296723 232
144 3300009093 Ga0105240_10002206 Ga0105240_1000220616 232
145 3300009174 Ga0105241_10016150 Ga0105241_100161502 232
146 3300009545 Ga0105237_10002725 Ga0105237_100027259 232
147 3300009551 Ga0105238_10000461 Ga0105238_1000046117 232
148 3300010375 Ga0105239_10152220 Ga0105239_101522202 232
149 3300013100 Ga0157373_10003066 Ga0157373_100030665 232
150 3300013104 Ga0157370_10006819 Ga0157370_100068195 232
151 3300013105 Ga0157369_10005690 Ga0157369_100056907 232
152 3300013296 Ga0157374_10074134 Ga0157374_100741342 232
153 3300014968 Ga0157379_10017027 Ga0157379_100170274 232
154 3300025906 Ga0207699_10103833 Ga0207699_101038332 232
155 3300025911 Ga0207654_10030759 Ga0207654_100307592 232
156 3300025913 Ga0207695_10034537 Ga0207695_100345372 232
157 3300025914 Ga0207671_10165061 Ga0207671_101650612 232
158 3300025924 Ga0207694_10295280 Ga0207694_102952802 232
159 3300025949 Ga0207667_10029961 Ga0207667_100299612 232
160 3300026078 Ga0207702_10049989 Ga0207702_100499892 232
161 3300026116 Ga0207674_10000026 Ga0207674_10000026121 232
162 3300028379 Ga0268266_10451342 Ga0268266_104513422 232
163 3300035724 Ga0373933_0051341 Ga0373933_0051341_147_881 232
164 3300036401 Ga0373937_0208674 Ga0373937_0208674_545_1279 232
165 3300049578 Ga0501042_0381242 Ga0501042_0381242_106_843 232
166 3300049571 Ga0501034_0023505 Ga0501034_0023505_5367_6101 233
167 3300005455 Ga0070663_100549712 Ga0070663_1005497122 234
168 3300013308 Ga0157375_10032542 Ga0157375_100325422 235
169 3300005336 Ga0070680_100065109 Ga0070680_1000651094 236
170 3300005458 Ga0070681_10142044 Ga0070681_101420442 236
171 3300005530 Ga0070679_100290487 Ga0070679_1002904872 236
172 3300025912 Ga0207707_10000094 Ga0207707_1000009468 236
173 3300025914 Ga0207671_10217537 Ga0207671_102175372 236
174 3300025917 Ga0207660_10056250 Ga0207660_100562502 236
175 3300025919 Ga0207657_10114611 Ga0207657_101146112 236
176 3300025921 Ga0207652_10003121 Ga0207652_100031215 236
177 3300025924 Ga0207694_10011442 Ga0207694_100114423 236
178 3300025949 Ga0207667_10103023 Ga0207667_101030233 236
179 3300025981 Ga0207640_10136532 Ga0207640_101365322 236
180 3300044656 Ga0466969_0039567 Ga0466969_0039567_1053_1787 236
181 3300053092 Ga0500583_0022380 Ga0500583_0022380_819_1553 236
182 3300053104 Ga0500556_0068801 Ga0500556_0068801_173_907 236
183 3300053124 Ga0500617_005236 Ga0500617_005236_1134_1868 236
184 3300053134 Ga0500658_0034738 Ga0500658_0034738_257_991 236
185 3300053146 Ga0500588_0008613 Ga0500588_0008613_197_931 236
186 3300046660 Ga0495625_0124535 Ga0495625_0124535_654_1400 237
187 3300031727 Ga0316576_10108570 Ga0316576_101085703 238
188 3300035398 Ga0316574_0250414 Ga0316574_0250414_54_788 238
189 3300025906 Ga0207699_10232692 Ga0207699_102326922 239
190 iso_pu_bacteria 2808606373 2808904865 239
191 3300050509 nmdc:mga0qj67_239275_c1 nmdc:mga0qj67_239275_c1_504_1238 240
192 iso_pu_bacteria 2808606379 2808939487 240
193 3300005563 Ga0068855_100588233 Ga0068855_1005882332 241
194 3300009093 Ga0105240_10099290 Ga0105240_100992902 241
195 3300009093 Ga0105240_10099462 Ga0105240_100994624 241
196 3300009545 Ga0105237_10196296 Ga0105237_101962962 241
197 3300009551 Ga0105238_10058599 Ga0105238_100585995 241
198 3300013104 Ga0157370_10044127 Ga0157370_100441275 241
199 3300013307 Ga0157372_10091442 Ga0157372_100914423 241
200 3300025912 Ga0207707_10066336 Ga0207707_100663362 241
201 3300025913 Ga0207695_10085650 Ga0207695_100856504 241
202 3300049823 Ga0501044_0470633 Ga0501044_0470633_212_937 241
203 3300005530 Ga0070679_100011761 Ga0070679_1000117618 242
204 3300025921 Ga0207652_10038059 Ga0207652_100380595 242
205 3300005290 Ga0065712_10208499 Ga0065712_102084992 243
206 3300005435 Ga0070714_100060690 Ga0070714_1000606902 243
207 3300005458 Ga0070681_10062197 Ga0070681_100621973 243
208 3300005518 Ga0070699_100112466 Ga0070699_1001124662 243
209 3300005530 Ga0070679_100146197 Ga0070679_1001461972 243
210 3300005545 Ga0070695_100006694 Ga0070695_1000066947 243
211 3300006844 Ga0075428_100307598 Ga0075428_1003075982 243
212 3300007265 Ga0099794_10010013 Ga0099794_100100132 243
213 3300010159 Ga0099796_10002198 Ga0099796_100021983 243
214 3300025912 Ga0207707_10018500 Ga0207707_100185003 243
215 3300025916 Ga0207663_10269537 Ga0207663_102695371 243
216 3300025921 Ga0207652_10119697 Ga0207652_101196972 243
217 3300042000 Ga0439437_001170 Ga0439437_001170_122_853 243
218 3300042012 Ga0439455_0028446 Ga0439455_0028446_388_1119 243
219 3300042115 Ga0450911_000008 Ga0450911_000008_138708_139439 243
220 3300042137 Ga0450902_032557 Ga0450902_032557_60_791 243
221 3300042139 Ga0450904_000004 Ga0450904_000004_2502_3233 243
222 3300042156 Ga0439446_0012537 Ga0439446_0012537_184_915 243
223 3300042438 Ga0439459_0024299 Ga0439459_0024299_69_800 243
224 3300042532 Ga0450893_0000346 Ga0450893_0000346_1108_1839 243
225 3300046692 Ga0495671_0026581 Ga0495671_0026581_1793_2536 243
226 3300049853 Ga0501226_000005 Ga0501226_000005_142824_143555 243
227 3300053124 Ga0500617_059969 Ga0500617_059969_827_1558 243
228 3300053146 Ga0500588_0004209 Ga0500588_0004209_2012_2743 243
229 3300003316 rootH1_10063715 rootH1_100637156 244
230 3300003320 rootH2_10014765 rootH2_100147652 244
231 3300003322 rootL2_10154988 rootL2_101549882 244
232 3300005293 Ga0065715_10146578 Ga0065715_101465782 244
233 3300005295 Ga0065707_10187323 Ga0065707_101873232 244
234 3300005327 Ga0070658_10039060 Ga0070658_100390604 244
235 3300005327 Ga0070658_10149939 Ga0070658_101499391 244
236 3300005330 Ga0070690_100021236 Ga0070690_1000212362 244
237 3300005331 Ga0070670_100018560 Ga0070670_1000185605 244
238 3300005331 Ga0070670_100061369 Ga0070670_1000613693 244
239 3300005334 Ga0068869_100092396 Ga0068869_1000923961 244
240 3300005335 Ga0070666_10019045 Ga0070666_100190454 244
241 3300005335 Ga0070666_10038837 Ga0070666_100388372 244
242 3300005335 Ga0070666_10044901 Ga0070666_100449012 244
243 3300005336 Ga0070680_100039466 Ga0070680_1000394662 244
244 3300005336 Ga0070680_100425877 Ga0070680_1004258772 244
245 3300005337 Ga0070682_100050639 Ga0070682_1000506392 244
246 3300005339 Ga0070660_100003339 Ga0070660_1000033399 244
247 3300005341 Ga0070691_10001304 Ga0070691_100013042 244
248 3300005343 Ga0070687_100002796 Ga0070687_1000027965 244
249 3300005344 Ga0070661_100006893 Ga0070661_1000068934 244
250 3300005347 Ga0070668_100148690 Ga0070668_1001486902 244
251 3300005354 Ga0070675_100002577 Ga0070675_1000025776 244
252 3300005355 Ga0070671_100000891 Ga0070671_10000089112 244
253 3300005355 Ga0070671_100068719 Ga0070671_1000687192 244
254 3300005355 Ga0070671_100148038 Ga0070671_1001480382 244
255 3300005356 Ga0070674_100027736 Ga0070674_1000277363 244
256 3300005356 Ga0070674_100305969 Ga0070674_1003059691 244
257 3300005364 Ga0070673_100000445 Ga0070673_1000004453 244
258 3300005364 Ga0070673_100308371 Ga0070673_1003083712 244
259 3300005365 Ga0070688_100002973 Ga0070688_1000029732 244
260 3300005366 Ga0070659_100018792 Ga0070659_1000187924 244
261 3300005367 Ga0070667_100002761 Ga0070667_10000276110 244
262 3300005367 Ga0070667_100081782 Ga0070667_1000817822 244
263 3300005367 Ga0070667_100089774 Ga0070667_1000897742 244
264 3300005367 Ga0070667_100300210 Ga0070667_1003002102 244
265 3300005367 Ga0070667_100405690 Ga0070667_1004056902 244
266 3300005434 Ga0070709_10150510 Ga0070709_101505102 244
267 3300005435 Ga0070714_100001876 Ga0070714_1000018763 244
268 3300005435 Ga0070714_100536205 Ga0070714_1005362052 244
269 3300005436 Ga0070713_100168600 Ga0070713_1001686002 244
270 3300005438 Ga0070701_10067762 Ga0070701_100677622 244
271 3300005439 Ga0070711_100075513 Ga0070711_1000755132 244
272 3300005455 Ga0070663_100084100 Ga0070663_1000841002 244
273 3300005456 Ga0070678_100039011 Ga0070678_1000390114 244
274 3300005456 Ga0070678_100080711 Ga0070678_1000807112 244
275 3300005457 Ga0070662_100066899 Ga0070662_1000668993 244
276 3300005458 Ga0070681_10042175 Ga0070681_100421752 244
277 3300005458 Ga0070681_10327918 Ga0070681_103279181 244
278 3300005459 Ga0068867_100211038 Ga0068867_1002110382 244
279 3300005459 Ga0068867_100323836 Ga0068867_1003238362 244
280 3300005466 Ga0070685_10018483 Ga0070685_100184832 244
281 3300005530 Ga0070679_100178214 Ga0070679_1001782142 244
282 3300005535 Ga0070684_100017546 Ga0070684_1000175464 244
283 3300005539 Ga0068853_100356014 Ga0068853_1003560141 244
284 3300005539 Ga0068853_100356844 Ga0068853_1003568442 244
285 3300005543 Ga0070672_100045680 Ga0070672_1000456801 244
286 3300005543 Ga0070672_100820945 Ga0070672_1008209451 244
287 3300005544 Ga0070686_100048477 Ga0070686_1000484772 244
288 3300005544 Ga0070686_100147087 Ga0070686_1001470872 244
289 3300005548 Ga0070665_100010311 Ga0070665_1000103115 244
290 3300005548 Ga0070665_100012783 Ga0070665_1000127839 244
291 3300005548 Ga0070665_100014489 Ga0070665_1000144896 244
292 3300005548 Ga0070665_100019765 Ga0070665_1000197655 244
293 3300005548 Ga0070665_100033526 Ga0070665_1000335262 244
294 3300005548 Ga0070665_100056141 Ga0070665_1000561413 244
295 3300005548 Ga0070665_100105036 Ga0070665_1001050362 244
296 3300005549 Ga0070704_100564881 Ga0070704_1005648811 244
297 3300005563 Ga0068855_100001501 Ga0068855_1000015018 244
298 3300005563 Ga0068855_100002250 Ga0068855_10000225018 244
299 3300005563 Ga0068855_100110676 Ga0068855_1001106762 244
300 3300005563 Ga0068855_100381880 Ga0068855_1003818802 244
301 3300005564 Ga0070664_100000661 Ga0070664_10000066117 244
302 3300005577 Ga0068857_100035280 Ga0068857_1000352802 244
303 3300005578 Ga0068854_100177284 Ga0068854_1001772842 244
304 3300005614 Ga0068856_100008954 Ga0068856_1000089546 244
305 3300005614 Ga0068856_100184039 Ga0068856_1001840392 244
306 3300005614 Ga0068856_100565361 Ga0068856_1005653612 244
307 3300005615 Ga0070702_100022138 Ga0070702_1000221382 244
308 3300005617 Ga0068859_100005026 Ga0068859_1000050269 244
309 3300005617 Ga0068859_100034295 Ga0068859_1000342951 244
310 3300005617 Ga0068859_100035905 Ga0068859_1000359053 244
311 3300005617 Ga0068859_100488510 Ga0068859_1004885102 244
312 3300005618 Ga0068864_100003379 Ga0068864_10000337913 244
313 3300005719 Ga0068861_100003461 Ga0068861_10000346110 244
314 3300005719 Ga0068861_100004925 Ga0068861_10000492510 244
315 3300005719 Ga0068861_100242702 Ga0068861_1002427022 244
316 3300005841 Ga0068863_100000741 Ga0068863_1000007412 244
317 3300005841 Ga0068863_100000781 Ga0068863_1000007815 244
318 3300005841 Ga0068863_100035610 Ga0068863_1000356104 244
319 3300005842 Ga0068858_100003988 Ga0068858_1000039889 244
320 3300005842 Ga0068858_100011296 Ga0068858_1000112966 244
321 3300005842 Ga0068858_100044466 Ga0068858_1000444662 244
322 3300005842 Ga0068858_100227728 Ga0068858_1002277282 244
323 3300005842 Ga0068858_100354326 Ga0068858_1003543262 244
324 3300005842 Ga0068858_100500430 Ga0068858_1005004301 244
325 3300005843 Ga0068860_100002939 Ga0068860_10000293912 244
326 3300005843 Ga0068860_100017032 Ga0068860_1000170323 244
327 3300005843 Ga0068860_100355087 Ga0068860_1003550872 244
328 3300005844 Ga0068862_100052283 Ga0068862_1000522832 244
329 3300005844 Ga0068862_100276834 Ga0068862_1002768342 244
330 3300005985 Ga0081539_10000123 Ga0081539_10000123121 244
331 3300006028 Ga0070717_10004672 Ga0070717_100046727 244
332 3300006173 Ga0070716_100038995 Ga0070716_1000389952 244
333 3300006175 Ga0070712_100433241 Ga0070712_1004332412 244
334 3300006237 Ga0097621_100034303 Ga0097621_1000343032 244
335 3300006358 Ga0068871_100093094 Ga0068871_1000930942 244
336 3300006358 Ga0068871_100337226 Ga0068871_1003372262 244
337 3300006844 Ga0075428_100011010 Ga0075428_1000110107 244
338 3300006844 Ga0075428_100269154 Ga0075428_1002691542 244
339 3300006846 Ga0075430_100001590 Ga0075430_1000015908 244
340 3300006846 Ga0075430_100030395 Ga0075430_1000303954 244
341 3300006846 Ga0075430_100064703 Ga0075430_1000647033 244
342 3300006846 Ga0075430_100089766 Ga0075430_1000897662 244
343 3300006846 Ga0075430_100123739 Ga0075430_1001237392 244
344 3300006846 Ga0075430_100628627 Ga0075430_1006286272 244
345 3300006847 Ga0075431_100001092 Ga0075431_1000010928 244
346 3300006847 Ga0075431_100328334 Ga0075431_1003283342 244
347 3300006847 Ga0075431_100354503 Ga0075431_1003545032 244
348 3300006852 Ga0075433_10232829 Ga0075433_102328292 244
349 3300006871 Ga0075434_100530756 Ga0075434_1005307562 244
350 3300006880 Ga0075429_100000286 Ga0075429_10000028619 244
351 3300006881 Ga0068865_100137397 Ga0068865_1001373972 244
352 3300006914 Ga0075436_100189269 Ga0075436_1001892692 244
353 3300006931 Ga0097620_100005026 Ga0097620_1000050269 244
354 3300006931 Ga0097620_100034299 Ga0097620_1000342991 244
355 3300006931 Ga0097620_100035904 Ga0097620_1000359043 244
356 3300006931 Ga0097620_100488520 Ga0097620_1004885201 244
357 3300009093 Ga0105240_10003739 Ga0105240_100037398 244
358 3300009093 Ga0105240_10010425 Ga0105240_100104258 244
359 3300009093 Ga0105240_10012887 Ga0105240_1001288711 244
360 3300009093 Ga0105240_10036236 Ga0105240_100362365 244
361 3300009093 Ga0105240_10101015 Ga0105240_101010152 244
362 3300009093 Ga0105240_10115948 Ga0105240_101159482 244
363 3300009093 Ga0105240_10261817 Ga0105240_102618172 244
364 3300009093 Ga0105240_10353810 Ga0105240_103538102 244
365 3300009093 Ga0105240_10612283 Ga0105240_106122831 244
366 3300009098 Ga0105245_10732330 Ga0105245_107323302 244
367 3300009101 Ga0105247_10000647 Ga0105247_1000064718 244
368 3300009101 Ga0105247_10080790 Ga0105247_100807902 244
369 3300009101 Ga0105247_10343576 Ga0105247_103435761 244
370 3300009147 Ga0114129_10002253 Ga0114129_1000225318 244
371 3300009176 Ga0105242_10089934 Ga0105242_100899342 244
372 3300009176 Ga0105242_10690215 Ga0105242_106902152 244
373 3300009177 Ga0105248_10005642 Ga0105248_100056425 244
374 3300009177 Ga0105248_10276665 Ga0105248_102766651 244
375 3300009545 Ga0105237_10066395 Ga0105237_100663953 244
376 3300009545 Ga0105237_10449591 Ga0105237_104495912 244
377 3300009545 Ga0105237_10611015 Ga0105237_106110151 244
378 3300009551 Ga0105238_10040400 Ga0105238_100404003 244
379 3300009551 Ga0105238_10050294 Ga0105238_100502942 244
380 3300009551 Ga0105238_10087038 Ga0105238_100870382 244
381 3300009551 Ga0105238_10155360 Ga0105238_101553602 244
382 3300009551 Ga0105238_10289440 Ga0105238_102894402 244
383 3300009553 Ga0105249_10009919 Ga0105249_100099194 244
384 3300009553 Ga0105249_10020093 Ga0105249_100200934 244
385 3300009553 Ga0105249_10025047 Ga0105249_100250474 244
386 3300009553 Ga0105249_10035160 Ga0105249_100351602 244
387 3300009553 Ga0105249_10514829 Ga0105249_105148292 244
388 3300010375 Ga0105239_10022924 Ga0105239_100229247 244
389 3300010375 Ga0105239_10447548 Ga0105239_104475481 244
390 3300010375 Ga0105239_10543619 Ga0105239_105436192 244
391 3300013104 Ga0157370_10037443 Ga0157370_100374432 244
392 3300013105 Ga0157369_10314084 Ga0157369_103140842 244
393 3300013296 Ga0157374_10034539 Ga0157374_100345393 244
394 3300013296 Ga0157374_10169643 Ga0157374_101696432 244
395 3300013296 Ga0157374_10494389 Ga0157374_104943892 244
396 3300013306 Ga0163162_10068152 Ga0163162_100681523 244
397 3300013306 Ga0163162_10165803 Ga0163162_101658032 244
398 3300013307 Ga0157372_10025789 Ga0157372_100257896 244
399 3300013308 Ga0157375_10072895 Ga0157375_100728952 244
400 3300014325 Ga0163163_10000224 Ga0163163_1000022427 244
401 3300014325 Ga0163163_10060146 Ga0163163_100601463 244
402 3300014325 Ga0163163_10388959 Ga0163163_103889592 244
403 3300014326 Ga0157380_10009519 Ga0157380_100095195 244
404 3300014745 Ga0157377_10029000 Ga0157377_100290003 244
405 3300014968 Ga0157379_10008268 Ga0157379_100082683 244
406 3300014968 Ga0157379_10760097 Ga0157379_107600972 244
407 3300014969 Ga0157376_10245155 Ga0157376_102451552 244
408 3300021377 Ga0213874_10016451 Ga0213874_100164512 244
409 3300021377 Ga0213874_10031242 Ga0213874_100312422 244
410 3300025899 Ga0207642_10059297 Ga0207642_100592972 244
411 3300025900 Ga0207710_10000933 Ga0207710_100009335 244
412 3300025900 Ga0207710_10217357 Ga0207710_102173571 244
413 3300025901 Ga0207688_10067867 Ga0207688_100678672 244
414 3300025903 Ga0207680_10071994 Ga0207680_100719942 244
415 3300025903 Ga0207680_10088588 Ga0207680_100885882 244
416 3300025906 Ga0207699_10019784 Ga0207699_100197843 244
417 3300025909 Ga0207705_10000418 Ga0207705_1000041816 244
418 3300025912 Ga0207707_10003808 Ga0207707_1000380812 244
419 3300025913 Ga0207695_10030245 Ga0207695_100302455 244
420 3300025913 Ga0207695_10033954 Ga0207695_100339542 244
421 3300025913 Ga0207695_10042966 Ga0207695_100429663 244
422 3300025913 Ga0207695_10065688 Ga0207695_100656883 244
423 3300025913 Ga0207695_10081742 Ga0207695_100817422 244
424 3300025913 Ga0207695_10135105 Ga0207695_101351052 244
425 3300025913 Ga0207695_10186234 Ga0207695_101862342 244
426 3300025913 Ga0207695_10189005 Ga0207695_101890052 244
427 3300025914 Ga0207671_10038756 Ga0207671_100387563 244
428 3300025914 Ga0207671_10060225 Ga0207671_100602252 244
429 3300025914 Ga0207671_10579844 Ga0207671_105798441 244
430 3300025915 Ga0207693_10020163 Ga0207693_100201636 244
431 3300025916 Ga0207663_10059044 Ga0207663_100590442 244
432 3300025917 Ga0207660_10003683 Ga0207660_1000368310 244
433 3300025917 Ga0207660_10503604 Ga0207660_105036042 244
434 3300025918 Ga0207662_10005619 Ga0207662_100056195 244
435 3300025919 Ga0207657_10004952 Ga0207657_100049525 244
436 3300025920 Ga0207649_10080241 Ga0207649_100802412 244
437 3300025921 Ga0207652_10011314 Ga0207652_100113144 244
438 3300025921 Ga0207652_10294565 Ga0207652_102945652 244
439 3300025924 Ga0207694_10057032 Ga0207694_100570324 244
440 3300025924 Ga0207694_10247688 Ga0207694_102476882 244
441 3300025924 Ga0207694_10529201 Ga0207694_105292012 244
442 3300025925 Ga0207650_10049485 Ga0207650_100494854 244
443 3300025926 Ga0207659_10032545 Ga0207659_100325452 244
444 3300025926 Ga0207659_10319133 Ga0207659_103191332 244
445 3300025928 Ga0207700_10030158 Ga0207700_100301583 244
446 3300025928 Ga0207700_10363340 Ga0207700_103633402 244
447 3300025929 Ga0207664_10058745 Ga0207664_100587453 244
448 3300025929 Ga0207664_10087010 Ga0207664_100870102 244
449 3300025931 Ga0207644_10038265 Ga0207644_100382654 244
450 3300025931 Ga0207644_10197769 Ga0207644_101977692 244
451 3300025932 Ga0207690_10019811 Ga0207690_100198113 244
452 3300025933 Ga0207706_10028926 Ga0207706_100289265 244
453 3300025934 Ga0207686_10147679 Ga0207686_101476792 244
454 3300025939 Ga0207665_10055300 Ga0207665_100553002 244
455 3300025939 Ga0207665_10140055 Ga0207665_101400552 244
456 3300025940 Ga0207691_10027055 Ga0207691_100270553 244
457 3300025940 Ga0207691_10221902 Ga0207691_102219021 244
458 3300025942 Ga0207689_10107137 Ga0207689_101071372 244
459 3300025944 Ga0207661_10121207 Ga0207661_101212072 244
460 3300025944 Ga0207661_10188121 Ga0207661_101881212 244
461 3300025945 Ga0207679_10006329 Ga0207679_100063292 244
462 3300025949 Ga0207667_10001596 Ga0207667_1000159610 244
463 3300025949 Ga0207667_10003668 Ga0207667_100036684 244
464 3300025960 Ga0207651_10004330 Ga0207651_100043304 244
465 3300025961 Ga0207712_10007064 Ga0207712_100070643 244
466 3300025961 Ga0207712_10017096 Ga0207712_100170963 244
467 3300025961 Ga0207712_10042910 Ga0207712_100429103 244
468 3300025972 Ga0207668_10065206 Ga0207668_100652063 244
469 3300025986 Ga0207658_10004874 Ga0207658_100048743 244
470 3300025986 Ga0207658_10086116 Ga0207658_100861162 244
471 3300025986 Ga0207658_10244985 Ga0207658_102449852 244
472 3300026023 Ga0207677_10131743 Ga0207677_101317432 244
473 3300026035 Ga0207703_10000259 Ga0207703_1000025961 244
474 3300026035 Ga0207703_10006874 Ga0207703_100068745 244
475 3300026035 Ga0207703_10297289 Ga0207703_102972892 244
476 3300026035 Ga0207703_10353111 Ga0207703_103531112 244
477 3300026041 Ga0207639_10574293 Ga0207639_105742931 244
478 3300026067 Ga0207678_10032626 Ga0207678_100326263 244
479 3300026075 Ga0207708_10024029 Ga0207708_100240294 244
480 3300026078 Ga0207702_10175845 Ga0207702_101758452 244
481 3300026088 Ga0207641_10000196 Ga0207641_1000019651 244
482 3300026088 Ga0207641_10002905 Ga0207641_100029058 244
483 3300026088 Ga0207641_10006042 Ga0207641_100060421 244
484 3300026089 Ga0207648_10023272 Ga0207648_100232723 244
485 3300026089 Ga0207648_10140388 Ga0207648_101403881 244
486 3300026095 Ga0207676_10010514 Ga0207676_100105144 244
487 3300026116 Ga0207674_10040771 Ga0207674_100407715 244
488 3300026118 Ga0207675_100006173 Ga0207675_10000617310 244
489 3300026118 Ga0207675_100038632 Ga0207675_1000386323 244
490 3300026118 Ga0207675_100189057 Ga0207675_1001890572 244
491 3300026118 Ga0207675_100541579 Ga0207675_1005415792 244
492 3300026121 Ga0207683_10064816 Ga0207683_100648162 244
493 3300026142 Ga0207698_10909913 Ga0207698_109099132 244
494 3300027665 Ga0209983_1005372 Ga0209983_10053722 244
495 3300028379 Ga0268266_10000512 Ga0268266_1000051225 244
496 3300028379 Ga0268266_10009688 Ga0268266_100096889 244
497 3300028379 Ga0268266_10010214 Ga0268266_100102148 244
498 3300028379 Ga0268266_10090242 Ga0268266_100902423 244
499 3300028379 Ga0268266_10149071 Ga0268266_101490713 244
500 3300028380 Ga0268265_10027901 Ga0268265_100279012 244
501 3300028380 Ga0268265_10037669 Ga0268265_100376692 244
502 3300028381 Ga0268264_10000182 Ga0268264_1000018288 244
503 3300028381 Ga0268264_10025318 Ga0268264_100253184 244
504 3300028381 Ga0268264_10648480 Ga0268264_106484801 244
505 3300028573 Ga0265334_10023301 Ga0265334_100233012 244
506 3300028794 Ga0307515_10055442 Ga0307515_100554422 244
507 3300028800 Ga0265338_10000017 Ga0265338_10000017100 244
508 3300028800 Ga0265338_10426543 Ga0265338_104265432 244
509 3300030521 Ga0307511_10000008 Ga0307511_1000000836 244
510 3300031235 Ga0265330_10010677 Ga0265330_100106774 244
511 3300031239 Ga0265328_10010751 Ga0265328_100107512 244
512 3300031241 Ga0265325_10000008 Ga0265325_100000086 244
513 3300031242 Ga0265329_10013556 Ga0265329_100135562 244
514 3300031247 Ga0265340_10000054 Ga0265340_1000005420 244
515 3300031247 Ga0265340_10013729 Ga0265340_100137293 244
516 3300031249 Ga0265339_10001599 Ga0265339_1000159919 244
517 3300031250 Ga0265331_10035413 Ga0265331_100354132 244
518 3300031344 Ga0265316_10008009 Ga0265316_100080095 244
519 3300031344 Ga0265316_10026388 Ga0265316_100263884 244
520 3300031344 Ga0265316_10321874 Ga0265316_103218742 244
521 3300031456 Ga0307513_10129833 Ga0307513_101298332 244
522 3300031456 Ga0307513_10129948 Ga0307513_101299482 244
523 3300031507 Ga0307509_10000099 Ga0307509_10000099108 244
524 3300031507 Ga0307509_10000154 Ga0307509_1000015455 244
525 3300031548 Ga0307408_100007916 Ga0307408_1000079164 244
526 3300031548 Ga0307408_100032300 Ga0307408_1000323002 244
527 3300031548 Ga0307408_100176127 Ga0307408_1001761272 244
528 3300031595 Ga0265313_10002014 Ga0265313_1000201416 244
529 3300031595 Ga0265313_10012307 Ga0265313_100123072 244
530 3300031595 Ga0265313_10107543 Ga0265313_101075432 244
531 3300031712 Ga0265342_10003097 Ga0265342_100030972 244
532 3300031712 Ga0265342_10011102 Ga0265342_100111025 244
533 3300031824 Ga0307413_10017158 Ga0307413_100171583 244
534 3300031824 Ga0307413_10526681 Ga0307413_105266811 244
535 3300031995 Ga0307409_100233820 Ga0307409_1002338202 244
536 3300032002 Ga0307416_100005410 Ga0307416_1000054103 244
537 3300032005 Ga0307411_10109890 Ga0307411_101098902 244
538 3300032126 Ga0307415_100261549 Ga0307415_1002615492 244
539 3300033180 Ga0307510_10000003 Ga0307510_1000000388 244
540 3300033180 Ga0307510_10004142 Ga0307510_100041429 244
541 3300034819 Ga0373958_0022342 Ga0373958_0022342_10_744 244
542 3300035113 Ga0373936_0029807 Ga0373936_0029807_1148_1882 244
543 3300035114 Ga0373939_0112563 Ga0373939_0112563_45_779 244
544 3300035118 Ga0373954_0136292 Ga0373954_0136292_28_762 244
545 3300035691 Ga0373931_0028615 Ga0373931_0028615_238_987 244
546 3300035692 Ga0373935_0333695 Ga0373935_0333695_262_996 244
547 3300035724 Ga0373933_0010033 Ga0373933_0010033_3207_3941 244
548 3300036401 Ga0373937_0019319 Ga0373937_0019319_2229_2963 244
549 3300036401 Ga0373937_0476545 Ga0373937_0476545_424_1158 244
550 3300037471 Ga0395905_0767652 Ga0395905_0767652_21_755 244
551 3300039437 Ga0436365_1473558 Ga0436365_1473558_2445_3179 244
552 3300039438 Ga0436360_0624728 Ga0436360_0624728_149_883 244
553 3300039447 Ga0436361_0132850 Ga0436361_0132850_1074_1808 244
554 3300039450 Ga0436363_0517558 Ga0436363_0517558_2895_3629 244
555 3300039450 Ga0436363_1409576 Ga0436363_1409576_451_1185 244
556 3300039450 Ga0436363_1476208 Ga0436363_1476208_1234_1968 244
557 3300039453 Ga0436362_0524883 Ga0436362_0524883_82_816 244
558 3300041411 Ga0439466_0024021 Ga0439466_0024021_887_1621 244
559 3300042013 Ga0439456_053821 Ga0439456_053821_85_819 244
560 3300042132 Ga0450895_002243 Ga0450895_002243_636_1370 244
561 3300042145 Ga0450906_027675 Ga0450906_027675_101_835 244
562 3300042156 Ga0439446_0000721 Ga0439446_0000721_4752_5486 244
563 3300042436 Ga0439435_0103729 Ga0439435_0103729_103_837 244
564 3300042532 Ga0450893_0026708 Ga0450893_0026708_62_796 244
565 3300042876 Ga0451577_0007135 Ga0451577_0007135_6863_7597 244
566 3300042876 Ga0451577_0311205 Ga0451577_0311205_271_1005 244
567 3300044656 Ga0466969_0018357 Ga0466969_0018357_247_981 244
568 3300044656 Ga0466969_0140916 Ga0466969_0140916_140_874 244
569 3300045049 Ga0466959_0040445 Ga0466959_0040445_577_1311 244
570 3300045051 Ga0451576_0003293 Ga0451576_0003293_6264_7013 244
571 3300045051 Ga0451576_0078101 Ga0451576_0078101_2104_2838 244
572 3300046460 Ga0495638_0001409 Ga0495638_0001409_8129_8878 244
573 3300046460 Ga0495638_0017538 Ga0495638_0017538_1606_2343 244
574 3300046462 Ga0495651_0092349 Ga0495651_0092349_1192_1926 244
575 3300046471 Ga0495650_0026413 Ga0495650_0026413_1054_1788 244
576 3300046472 Ga0495580_0419786 Ga0495580_0419786_123_857 244
577 3300046507 Ga0495606_0032078 Ga0495606_0032078_2887_3621 244
578 3300046543 Ga0495645_0265094 Ga0495645_0265094_88_822 244
579 3300046660 Ga0495625_0079278 Ga0495625_0079278_644_1393 244
580 3300046664 Ga0495659_0073761 Ga0495659_0073761_382_1116 244
581 3300046679 Ga0495623_0027113 Ga0495623_0027113_849_1583 244
582 3300046694 Ga0495649_0117893 Ga0495649_0117893_256_990 244
583 3300047317 Ga0495604_0243713 Ga0495604_0243713_22_756 244
584 3300047320 Ga0495672_0008659 Ga0495672_0008659_4578_5312 244
585 3300047320 Ga0495672_0018987 Ga0495672_0018987_3177_3914 244
586 3300047320 Ga0495672_0094644 Ga0495672_0094644_612_1346 244
587 3300047443 Ga0495687_082743 Ga0495687_082743_310_1044 244
588 3300047444 Ga0495675_0099446 Ga0495675_0099446_516_1250 244
589 3300048903 Ga0496100_0232163 Ga0496100_0232163_58_792 244
590 3300048904 Ga0496101_0163715 Ga0496101_0163715_59_793 244
591 3300048905 Ga0496102_0004416 Ga0496102_0004416_1897_2631 244
592 3300048905 Ga0496102_0014849 Ga0496102_0014849_4156_4890 244
593 3300048906 Ga0496103_0089733 Ga0496103_0089733_631_1365 244
594 3300048908 Ga0496105_0130713 Ga0496105_0130713_900_1634 244
595 3300048909 Ga0496106_0225072 Ga0496106_0225072_609_1358 244
596 3300048909 Ga0496106_0718481 Ga0496106_0718481_32_766 244
597 3300048911 Ga0496108_0042139 Ga0496108_0042139_365_1114 244
598 3300048912 Ga0496109_0492969 Ga0496109_0492969_70_819 244
599 3300048914 Ga0496111_0301357 Ga0496111_0301357_357_1106 244
600 3300048915 Ga0496112_0066496 Ga0496112_0066496_1611_2360 244
601 3300048915 Ga0496112_0200136 Ga0496112_0200136_178_912 244
602 3300048916 Ga0496113_0026120 Ga0496113_0026120_2408_3157 244
603 3300048918 Ga0496115_0155234 Ga0496115_0155234_752_1486 244
604 3300048919 Ga0496116_0003291 Ga0496116_0003291_4165_4899 244
605 3300048920 Ga0496117_0000095 Ga0496117_0000095_108497_109231 244
606 3300048921 Ga0496118_0000003 Ga0496118_0000003_69013_69747 244
607 3300048921 Ga0496118_0088844 Ga0496118_0088844_213_947 244
608 3300048921 Ga0496118_0116563 Ga0496118_0116563_454_1188 244
609 3300048922 Ga0496119_0009520 Ga0496119_0009520_4916_5650 244
610 3300048922 Ga0496119_0020125 Ga0496119_0020125_3935_4669 244
611 3300048922 Ga0496119_0138697 Ga0496119_0138697_489_1223 244
612 3300048923 Ga0496120_0000693 Ga0496120_0000693_18012_18746 244
613 3300048923 Ga0496120_0117155 Ga0496120_0117155_558_1292 244
614 3300048924 Ga0496121_0009504 Ga0496121_0009504_8090_8824 244
615 3300048924 Ga0496121_0011641 Ga0496121_0011641_8538_9272 244
616 3300048927 Ga0496124_0005346 Ga0496124_0005346_12330_13064 244
617 3300048928 Ga0496125_0000112 Ga0496125_0000112_63979_64713 244
618 3300048928 Ga0496125_0027039 Ga0496125_0027039_925_1659 244
619 3300048929 Ga0496126_0002920 Ga0496126_0002920_4210_4944 244
620 3300048929 Ga0496126_0003855 Ga0496126_0003855_12947_13681 244
621 3300048929 Ga0496126_0009185 Ga0496126_0009185_21_755 244
622 3300048929 Ga0496126_0045173 Ga0496126_0045173_2002_2736 244
623 3300048929 Ga0496126_0064500 Ga0496126_0064500_484_1218 244
624 3300049522 Ga0501299_016954 Ga0501299_016954_147_881 244
625 3300049572 Ga0501036_0311051 Ga0501036_0311051_445_1179 244
626 3300049574 Ga0501038_0270058 Ga0501038_0270058_298_1032 244
627 3300049577 Ga0501041_0085994 Ga0501041_0085994_605_1339 244
628 3300049578 Ga0501042_0108676 Ga0501042_0108676_157_891 244
629 3300049587 Ga0501071_0147652 Ga0501071_0147652_302_1036 244
630 3300049588 Ga0501072_0352717 Ga0501072_0352717_65_799 244
631 3300049591 Ga0501075_0142808 Ga0501075_0142808_495_1229 244
632 3300049592 Ga0501076_0186284 Ga0501076_0186284_572_1306 244
633 3300050507 nmdc:mga05p37_15071_c1 nmdc:mga05p37_15071_c1_1194_1928 244
634 3300050507 nmdc:mga05p37_419090_c1 nmdc:mga05p37_419090_c1_753_1487 244
635 3300050508 nmdc:mga09592_1068_c1 nmdc:mga09592_1068_c1_18390_19124 244
636 3300050508 nmdc:mga09592_32074_c1 nmdc:mga09592_32074_c1_1129_1863 244
637 3300050509 nmdc:mga0qj67_1805_c1 nmdc:mga0qj67_1805_c1_8312_9046 244
638 3300050509 nmdc:mga0qj67_2664_c1 nmdc:mga0qj67_2664_c1_6475_7209 244
639 3300050509 nmdc:mga0qj67_351273_c1 nmdc:mga0qj67_351273_c1_83_817 244
640 3300050509 nmdc:mga0qj67_41338_c1 nmdc:mga0qj67_41338_c1_2699_3433 244
641 3300050509 nmdc:mga0qj67_50623_c1 nmdc:mga0qj67_50623_c1_819_1553 244
642 3300050510 nmdc:mga06r32_294_c1 nmdc:mga06r32_294_c1_17609_18343 244
643 3300050510 nmdc:mga06r32_4213_c1 nmdc:mga06r32_4213_c1_5202_5936 244
644 3300050512 nmdc:mga0n895_404788_c1 nmdc:mga0n895_404788_c1_92_826 244
645 3300050514 nmdc:mga08x19_23616_c1 nmdc:mga08x19_23616_c1_2669_3403 244
646 3300053085 Ga0495619_0034228 Ga0495619_0034228_423_1157 244
647 3300053088 Ga0500644_0047545 Ga0500644_0047545_698_1432 244
648 3300053092 Ga0500583_0012417 Ga0500583_0012417_1401_2138 244
649 3300053092 Ga0500583_0062805 Ga0500583_0062805_210_944 244
650 3300053096 Ga0500641_0075097 Ga0500641_0075097_202_936 244
651 3300053098 Ga0500650_0046612 Ga0500650_0046612_142_876 244
652 3300053115 Ga0500591_085117 Ga0500591_085117_349_1083 244
653 3300053123 Ga0500614_067344 Ga0500614_067344_158_892 244
654 3300053139 Ga0500568_0036113 Ga0500568_0036113_480_1214 244
655 3300053139 Ga0500568_0056190 Ga0500568_0056190_712_1446 244
656 3300053139 Ga0500568_0117369 Ga0500568_0117369_89_823 244
657 3300053147 Ga0500589_082919 Ga0500589_082919_482_1216 244
658 3300053156 Ga0500622_0001895 Ga0500622_0001895_8074_8808 244
659 3300053156 Ga0500622_0028001 Ga0500622_0028001_228_962 244
660 3300053159 Ga0500630_064737 Ga0500630_064737_554_1288 244
661 3300053177 Ga0500636_0167225 Ga0500636_0167225_308_1042 244
662 3300053178 Ga0500637_0001099 Ga0500637_0001099_1617_2354 244
663 3300053178 Ga0500637_0050556 Ga0500637_0050556_1229_1963 244
664 3300053178 Ga0500637_0063113 Ga0500637_0063113_747_1481 244
665 3300053178 Ga0500637_0078151 Ga0500637_0078151_951_1685 244
666 3300054114 Ga0501084_0000106 Ga0501084_0000106_19353_20087 244
667 3300054114 Ga0501084_0250959 Ga0501084_0250959_369_1103 244
668 3300060353 Ga0501082_0138390 Ga0501082_0138390_1289_2023 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

10

245

0.73

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

51

243

0.67

PF13346

ABC2_membrane_5

ABC-2 family transporter protein

11

243

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o12-assembly1.cif.gz_E abc transporter nosdfy, amppnp-bound in gdn 0.7924 4 239
7o17-assembly1.cif.gz_E abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.7899 4 239
7o0z-assembly1.cif.gz_E abc transporter nosfy, nucleotide-free in gdn 0.7891 4 239
7o0z-assembly1.cif.gz_D abc transporter nosfy, nucleotide-free in gdn 0.7804 4 239
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.776 4 239
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7039 57 238 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6741 53 237 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6502 57 240 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5469 57 238 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5337 53 237 3.40.1710.10
ID Description Score Start End GO Terms
AF-D9PFV1-F1-model_v4 ABC transporter, permease protein 0.9943 56 240 GO:0005886
GO:0140359
AF-A0A518BMA5-F1-model_v4 ABC-2 family transporter protein 0.9853 4 244 GO:0005886
GO:0140359
AF-A0A1E5A0B5-F1-model_v4 ABC transporter domain-containing protein 0.9832 3 244 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A450WF97-F1-model_v4 ABC-2 type transport system permease protein 0.9809 1 244 GO:0005886
GO:0140359
AF-A0A2K2H7J0-F1-model_v4 ABC transporter 0.9805 1 243 GO:0005886
GO:0140359

Feature Viewer

pLDDT pTM Quality
89.3 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map