F473890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 329 | 666 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10146578|Ga0065715_101465782 |
| Length | 249 |
| Sequence | MRSDSFRNVWILFRREFASYFATPLALVFIVIFLALAGLFTFFLGGFYERGQADLAPFFNYHPWLYLFLMPALSMRLWAEERKSGTIELLMTLPITPWQAVIGKYLAAWAVAGLALVLTFPVWITVNYLGDPDNGAILAGYIGSFLVAGGLLAIGACFSAATRNQVIAFIVTVVACFAFLLSGFALVLNAFQGWAPQPVIDAVASLSFLTHFGSIAKGVIDIRDLLYFATVIAVWLIATAIVLDMKKAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 2 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 222 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 225 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 226 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 227 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 228 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 229 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 230 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 231 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 234 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 235 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 236 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 314 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 318 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 319 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 320 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 326 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 0 |
| Rhizoplane | 3.74 |
| Rhizosphere | 85.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10063715 | 3300003316 | Bacteria | 5470 |
| 2 | rootH2_10014765 | 3300003320 | Bacteria | 2904 |
| 3 | rootL2_10154988 | 3300003322 | Bacteria | 1402 |
| 4 | Ga0065712_10208499 | 3300005290 | Bacteria | 1081 |
| 5 | Ga0065715_10146578 | 3300005293 | Bacteria | 1781 |
| 6 | Ga0065707_10187323 | 3300005295 | Bacteria | 1381 |
| 7 | Ga0070658_10039060 | 3300005327 | Bacteria | 3828 |
| 8 | Ga0070658_10149939 | 3300005327 | Bacteria | 1952 |
| 9 | Ga0070690_100021236 | 3300005330 | Bacteria | 3961 |
| 10 | Ga0070670_100018560 | 3300005331 | Bacteria | 5964 |
| 11 | Ga0070670_100061369 | 3300005331 | Bacteria | 3228 |
| 12 | Ga0068869_100092396 | 3300005334 | Bacteria | 2278 |
| 13 | Ga0070666_10019045 | 3300005335 | Bacteria | 4426 |
| 14 | Ga0070666_10038837 | 3300005335 | Bacteria | 3169 |
| 15 | Ga0070666_10044901 | 3300005335 | Bacteria | 2962 |
| 16 | Ga0070680_100037681 | 3300005336 | Bacteria | 3907 |
| 17 | Ga0070680_100039466 | 3300005336 | Bacteria | 3821 |
| 18 | Ga0070680_100065109 | 3300005336 | Bacteria | 2987 |
| 19 | Ga0070680_100102832 | 3300005336 | Bacteria | 2373 |
| 20 | Ga0070680_100425877 | 3300005336 | Bacteria | 1132 |
| 21 | Ga0070682_100050639 | 3300005337 | Bacteria | 2594 |
| 22 | Ga0070660_100003339 | 3300005339 | Bacteria | 11029 |
| 23 | Ga0070660_100242406 | 3300005339 | Bacteria | 1469 |
| 24 | Ga0070691_10000119 | 3300005341 | Bacteria | 23698 |
| 25 | Ga0070691_10001304 | 3300005341 | Bacteria | 10585 |
| 26 | Ga0070687_100002796 | 3300005343 | Bacteria | 6644 |
| 27 | Ga0070661_100006893 | 3300005344 | Bacteria | 7838 |
| 28 | Ga0070692_10079488 | 3300005345 | Bacteria | 1763 |
| 29 | Ga0070692_10080580 | 3300005345 | Bacteria | 1753 |
| 30 | Ga0070668_100045493 | 3300005347 | Bacteria | 3367 |
| 31 | Ga0070668_100148690 | 3300005347 | Bacteria | 1893 |
| 32 | Ga0070669_100007529 | 3300005353 | Bacteria | 7796 |
| 33 | Ga0070675_100002577 | 3300005354 | Bacteria | 13587 |
| 34 | Ga0070671_100000891 | 3300005355 | Bacteria | 21786 |
| 35 | Ga0070671_100068719 | 3300005355 | Bacteria | 2955 |
| 36 | Ga0070671_100148038 | 3300005355 | Bacteria | 1982 |
| 37 | Ga0070674_100027736 | 3300005356 | Bacteria | 3713 |
| 38 | Ga0070674_100305969 | 3300005356 | Bacteria | 1269 |
| 39 | Ga0070673_100000445 | 3300005364 | Bacteria | 21871 |
| 40 | Ga0070673_100308371 | 3300005364 | Bacteria | 1395 |
| 41 | Ga0070688_100002973 | 3300005365 | Bacteria | 8635 |
| 42 | Ga0070659_100018792 | 3300005366 | Bacteria | 5217 |
| 43 | Ga0070667_100002761 | 3300005367 | Bacteria | 15189 |
| 44 | Ga0070667_100081782 | 3300005367 | Bacteria | 2764 |
| 45 | Ga0070667_100089774 | 3300005367 | Bacteria | 2640 |
| 46 | Ga0070667_100300210 | 3300005367 | Bacteria | 1446 |
| 47 | Ga0070667_100405690 | 3300005367 | Bacteria | 1241 |
| 48 | Ga0070709_10001572 | 3300005434 | Bacteria | 12327 |
| 49 | Ga0070709_10092457 | 3300005434 | Bacteria | 1998 |
| 50 | Ga0070709_10150510 | 3300005434 | Bacteria | 1608 |
| 51 | Ga0070714_100001876 | 3300005435 | Bacteria | 15328 |
| 52 | Ga0070714_100030694 | 3300005435 | Bacteria | 4476 |
| 53 | Ga0070714_100060690 | 3300005435 | Bacteria | 3246 |
| 54 | Ga0070714_100536205 | 3300005435 | Bacteria | 1119 |
| 55 | Ga0070713_100000866 | 3300005436 | Bacteria | 19339 |
| 56 | Ga0070713_100034919 | 3300005436 | Bacteria | 4045 |
| 57 | Ga0070713_100168600 | 3300005436 | Bacteria | 1960 |
| 58 | Ga0070710_10059059 | 3300005437 | Bacteria | 2177 |
| 59 | Ga0070701_10067762 | 3300005438 | Bacteria | 1900 |
| 60 | Ga0070701_10487304 | 3300005438 | Bacteria | 798 |
| 61 | Ga0070711_100075513 | 3300005439 | Bacteria | 2387 |
| 62 | Ga0070711_100561413 | 3300005439 | Bacteria | 948 |
| 63 | Ga0070700_100041276 | 3300005441 | Bacteria | 2828 |
| 64 | Ga0070663_100084100 | 3300005455 | Bacteria | 2344 |
| 65 | Ga0070663_100549712 | 3300005455 | Unclassified | 965 |
| 66 | Ga0070663_100796645 | 3300005455 | Bacteria | 810 |
| 67 | Ga0070678_100039011 | 3300005456 | Bacteria | 3348 |
| 68 | Ga0070678_100080711 | 3300005456 | Bacteria | 2464 |
| 69 | Ga0070662_100066899 | 3300005457 | Bacteria | 2638 |
| 70 | Ga0070662_100078592 | 3300005457 | Bacteria | 2451 |
| 71 | Ga0070681_10042175 | 3300005458 | Bacteria | 4574 |
| 72 | Ga0070681_10062197 | 3300005458 | Bacteria | 3707 |
| 73 | Ga0070681_10129381 | 3300005458 | Bacteria | 2457 |
| 74 | Ga0070681_10142044 | 3300005458 | Bacteria | 2330 |
| 75 | Ga0070681_10327918 | 3300005458 | Bacteria | 1440 |
| 76 | Ga0068867_100211038 | 3300005459 | Bacteria | 1559 |
| 77 | Ga0068867_100323836 | 3300005459 | Bacteria | 1278 |
| 78 | Ga0070685_10018483 | 3300005466 | Bacteria | 3749 |
| 79 | Ga0070699_100112466 | 3300005518 | Bacteria | 2392 |
| 80 | Ga0070679_100011761 | 3300005530 | Bacteria | 8343 |
| 81 | Ga0070679_100088281 | 3300005530 | Bacteria | 3088 |
| 82 | Ga0070679_100146197 | 3300005530 | Bacteria | 2342 |
| 83 | Ga0070679_100178214 | 3300005530 | Unclassified | 2098 |
| 84 | Ga0070679_100290487 | 3300005530 | Bacteria | 1586 |
| 85 | Ga0070684_100017546 | 3300005535 | Bacteria | 5879 |
| 86 | Ga0068853_100356014 | 3300005539 | Bacteria | 1362 |
| 87 | Ga0068853_100356844 | 3300005539 | Bacteria | 1361 |
| 88 | Ga0070672_100045680 | 3300005543 | Bacteria | 3390 |
| 89 | Ga0070672_100820945 | 3300005543 | Bacteria | 819 |
| 90 | Ga0070686_100048477 | 3300005544 | Bacteria | 2691 |
| 91 | Ga0070686_100147087 | 3300005544 | Bacteria | 1646 |
| 92 | Ga0070695_100006694 | 3300005545 | Bacteria | 6816 |
| 93 | Ga0070695_100027998 | 3300005545 | Bacteria | 3495 |
| 94 | Ga0070696_100186177 | 3300005546 | Bacteria | 1543 |
| 95 | Ga0070693_100046047 | 3300005547 | Bacteria | 2475 |
| 96 | Ga0070665_100010311 | 3300005548 | Bacteria | 9452 |
| 97 | Ga0070665_100012783 | 3300005548 | Bacteria | 8457 |
| 98 | Ga0070665_100014489 | 3300005548 | Bacteria | 7907 |
| 99 | Ga0070665_100019765 | 3300005548 | Bacteria | 6760 |
| 100 | Ga0070665_100033526 | 3300005548 | Bacteria | 5166 |
| 101 | Ga0070665_100056141 | 3300005548 | Bacteria | 3949 |
| 102 | Ga0070665_100105036 | 3300005548 | Bacteria | 2827 |
| 103 | Ga0070704_100564881 | 3300005549 | Bacteria | 996 |
| 104 | Ga0068855_100001501 | 3300005563 | Bacteria | 29235 |
| 105 | Ga0068855_100002250 | 3300005563 | Bacteria | 23850 |
| 106 | Ga0068855_100110676 | 3300005563 | Bacteria | 3152 |
| 107 | Ga0068855_100381880 | 3300005563 | Bacteria | 1547 |
| 108 | Ga0068855_100588233 | 3300005563 | Bacteria | 1201 |
| 109 | Ga0070664_100000661 | 3300005564 | Bacteria | 26303 |
| 110 | Ga0070664_100238064 | 3300005564 | Bacteria | 1633 |
| 111 | Ga0068857_100000836 | 3300005577 | Bacteria | 23064 |
| 112 | Ga0068857_100035280 | 3300005577 | Bacteria | 4429 |
| 113 | Ga0068854_100104576 | 3300005578 | Bacteria | 2127 |
| 114 | Ga0068854_100177284 | 3300005578 | Bacteria | 1662 |
| 115 | Ga0068856_100002253 | 3300005614 | Bacteria | 19920 |
| 116 | Ga0068856_100004043 | 3300005614 | Bacteria | 14693 |
| 117 | Ga0068856_100008954 | 3300005614 | Bacteria | 9738 |
| 118 | Ga0068856_100184039 | 3300005614 | Bacteria | 2102 |
| 119 | Ga0068856_100565361 | 3300005614 | Bacteria | 1158 |
| 120 | Ga0070702_100022138 | 3300005615 | Bacteria | 3356 |
| 121 | Ga0068859_100005026 | 3300005617 | Bacteria | 13419 |
| 122 | Ga0068859_100034295 | 3300005617 | Bacteria | 5094 |
| 123 | Ga0068859_100035905 | 3300005617 | Bacteria | 4974 |
| 124 | Ga0068859_100488510 | 3300005617 | Bacteria | 1327 |
| 125 | Ga0068864_100003379 | 3300005618 | Bacteria | 13195 |
| 126 | Ga0068861_100003461 | 3300005719 | Bacteria | 10479 |
| 127 | Ga0068861_100004925 | 3300005719 | Bacteria | 8995 |
| 128 | Ga0068861_100089702 | 3300005719 | Bacteria | 2423 |
| 129 | Ga0068861_100242702 | 3300005719 | Bacteria | 1533 |
| 130 | Ga0068863_100000741 | 3300005841 | Bacteria | 32605 |
| 131 | Ga0068863_100000781 | 3300005841 | Bacteria | 31993 |
| 132 | Ga0068863_100035610 | 3300005841 | Bacteria | 4740 |
| 133 | Ga0068858_100003988 | 3300005842 | Bacteria | 14568 |
| 134 | Ga0068858_100011296 | 3300005842 | Bacteria | 8438 |
| 135 | Ga0068858_100044466 | 3300005842 | Bacteria | 4116 |
| 136 | Ga0068858_100227728 | 3300005842 | Bacteria | 1767 |
| 137 | Ga0068858_100354326 | 3300005842 | Bacteria | 1406 |
| 138 | Ga0068858_100500430 | 3300005842 | Bacteria | 1174 |
| 139 | Ga0068860_100002939 | 3300005843 | Bacteria | 17616 |
| 140 | Ga0068860_100017032 | 3300005843 | Bacteria | 7083 |
| 141 | Ga0068860_100355087 | 3300005843 | Bacteria | 1443 |
| 142 | Ga0068862_100015763 | 3300005844 | Bacteria | 6281 |
| 143 | Ga0068862_100052283 | 3300005844 | Bacteria | 3495 |
| 144 | Ga0068862_100276834 | 3300005844 | Bacteria | 1537 |
| 145 | Ga0081539_10000123 | 3300005985 | Bacteria | 181245 |
| 146 | Ga0070717_10004672 | 3300006028 | Bacteria | 9939 |
| 147 | Ga0070717_10076653 | 3300006028 | Bacteria | 2799 |
| 148 | Ga0070716_100038995 | 3300006173 | Bacteria | 2633 |
| 149 | Ga0070716_100062491 | 3300006173 | Bacteria | 2159 |
| 150 | Ga0070712_100000181 | 3300006175 | Bacteria | 34961 |
| 151 | Ga0070712_100034312 | 3300006175 | Bacteria | 3438 |
| 152 | Ga0070712_100433241 | 3300006175 | Bacteria | 1092 |
| 153 | Ga0097621_100034303 | 3300006237 | Bacteria | 4048 |
| 154 | Ga0097621_100433079 | 3300006237 | Bacteria | 1182 |
| 155 | Ga0068871_100093094 | 3300006358 | Bacteria | 2514 |
| 156 | Ga0068871_100337226 | 3300006358 | Bacteria | 1331 |
| 157 | Ga0075428_100011010 | 3300006844 | Bacteria | 10059 |
| 158 | Ga0075428_100269154 | 3300006844 | Bacteria | 1833 |
| 159 | Ga0075428_100307598 | 3300006844 | Bacteria | 1704 |
| 160 | Ga0075430_100001590 | 3300006846 | Bacteria | 18565 |
| 161 | Ga0075430_100030395 | 3300006846 | Bacteria | 4587 |
| 162 | Ga0075430_100064703 | 3300006846 | Bacteria | 3072 |
| 163 | Ga0075430_100089766 | 3300006846 | Bacteria | 2571 |
| 164 | Ga0075430_100123739 | 3300006846 | Unclassified | 2156 |
| 165 | Ga0075430_100628627 | 3300006846 | Bacteria | 886 |
| 166 | Ga0075431_100001092 | 3300006847 | Bacteria | 24307 |
| 167 | Ga0075431_100328334 | 3300006847 | Bacteria | 1541 |
| 168 | Ga0075431_100354503 | 3300006847 | Bacteria | 1474 |
| 169 | Ga0075433_10232829 | 3300006852 | Bacteria | 1636 |
| 170 | Ga0075434_100033051 | 3300006871 | Bacteria | 5103 |
| 171 | Ga0075434_100530756 | 3300006871 | Bacteria | 1197 |
| 172 | Ga0075429_100000286 | 3300006880 | Bacteria | 35609 |
| 173 | Ga0075429_100031359 | 3300006880 | Bacteria | 4619 |
| 174 | Ga0068865_100137397 | 3300006881 | Bacteria | 1839 |
| 175 | Ga0075436_100000796 | 3300006914 | Bacteria | 20914 |
| 176 | Ga0075436_100029672 | 3300006914 | Bacteria | 3761 |
| 177 | Ga0075436_100189269 | 3300006914 | Bacteria | 1456 |
| 178 | Ga0097620_100005026 | 3300006931 | Bacteria | 13419 |
| 179 | Ga0097620_100034299 | 3300006931 | Bacteria | 5094 |
| 180 | Ga0097620_100035904 | 3300006931 | Bacteria | 4974 |
| 181 | Ga0097620_100488520 | 3300006931 | Bacteria | 1327 |
| 182 | Ga0075435_100021729 | 3300007076 | Bacteria | 4942 |
| 183 | Ga0099794_10009212 | 3300007265 | Bacteria | 4138 |
| 184 | Ga0099794_10010013 | 3300007265 | Bacteria | 4013 |
| 185 | Ga0099795_10000673 | 3300007788 | Bacteria | 6568 |
| 186 | Ga0105240_10002206 | 3300009093 | Bacteria | 31749 |
| 187 | Ga0105240_10003739 | 3300009093 | Bacteria | 23508 |
| 188 | Ga0105240_10010425 | 3300009093 | Bacteria | 13058 |
| 189 | Ga0105240_10012887 | 3300009093 | Bacteria | 11513 |
| 190 | Ga0105240_10036236 | 3300009093 | Bacteria | 6347 |
| 191 | Ga0105240_10099290 | 3300009093 | Bacteria | 3543 |
| 192 | Ga0105240_10099462 | 3300009093 | Bacteria | 3540 |
| 193 | Ga0105240_10101015 | 3300009093 | Bacteria | 3509 |
| 194 | Ga0105240_10115948 | 3300009093 | Bacteria | 3232 |
| 195 | Ga0105240_10261817 | 3300009093 | Bacteria | 1995 |
| 196 | Ga0105240_10353810 | 3300009093 | Bacteria | 1666 |
| 197 | Ga0105240_10612283 | 3300009093 | Bacteria | 1198 |
| 198 | Ga0111539_10022128 | 3300009094 | Bacteria | 7814 |
| 199 | Ga0105245_10027245 | 3300009098 | Bacteria | 5036 |
| 200 | Ga0105245_10732330 | 3300009098 | Bacteria | 1024 |
| 201 | Ga0105247_10000647 | 3300009101 | Bacteria | 27761 |
| 202 | Ga0105247_10080790 | 3300009101 | Bacteria | 2048 |
| 203 | Ga0105247_10343576 | 3300009101 | Bacteria | 1048 |
| 204 | Ga0114129_10002253 | 3300009147 | Bacteria | 26642 |
| 205 | Ga0105241_10016150 | 3300009174 | Bacteria | 5472 |
| 206 | Ga0105241_10471341 | 3300009174 | Bacteria | 1114 |
| 207 | Ga0105242_10089934 | 3300009176 | Bacteria | 2581 |
| 208 | Ga0105242_10688117 | 3300009176 | Bacteria | 999 |
| 209 | Ga0105242_10690215 | 3300009176 | Bacteria | 997 |
| 210 | Ga0105248_10000013 | 3300009177 | Bacteria | 328864 |
| 211 | Ga0105248_10005642 | 3300009177 | Bacteria | 13743 |
| 212 | Ga0105248_10276665 | 3300009177 | Bacteria | 1890 |
| 213 | Ga0105237_10002725 | 3300009545 | Bacteria | 21560 |
| 214 | Ga0105237_10066395 | 3300009545 | Bacteria | 3602 |
| 215 | Ga0105237_10196296 | 3300009545 | Bacteria | 2018 |
| 216 | Ga0105237_10449591 | 3300009545 | Bacteria | 1294 |
| 217 | Ga0105237_10611015 | 3300009545 | Bacteria | 1097 |
| 218 | Ga0105238_10000461 | 3300009551 | Bacteria | 42710 |
| 219 | Ga0105238_10040400 | 3300009551 | Bacteria | 4727 |
| 220 | Ga0105238_10050294 | 3300009551 | Bacteria | 4195 |
| 221 | Ga0105238_10058599 | 3300009551 | Bacteria | 3859 |
| 222 | Ga0105238_10087038 | 3300009551 | Bacteria | 3111 |
| 223 | Ga0105238_10155360 | 3300009551 | Bacteria | 2263 |
| 224 | Ga0105238_10289440 | 3300009551 | Bacteria | 1620 |
| 225 | Ga0105249_10009919 | 3300009553 | Bacteria | 8349 |
| 226 | Ga0105249_10020093 | 3300009553 | Bacteria | 5967 |
| 227 | Ga0105249_10025047 | 3300009553 | Bacteria | 5369 |
| 228 | Ga0105249_10035160 | 3300009553 | Bacteria | 4542 |
| 229 | Ga0105249_10080123 | 3300009553 | Bacteria | 3033 |
| 230 | Ga0105249_10514829 | 3300009553 | Bacteria | 1243 |
| 231 | Ga0099796_10000179 | 3300010159 | Bacteria | 9577 |
| 232 | Ga0099796_10002198 | 3300010159 | Bacteria | 4221 |
| 233 | Ga0099796_10048797 | 3300010159 | Bacteria | 1461 |
| 234 | Ga0105239_10022924 | 3300010375 | Bacteria | 6883 |
| 235 | Ga0105239_10152220 | 3300010375 | Bacteria | 2582 |
| 236 | Ga0105239_10382350 | 3300010375 | Unclassified | 1592 |
| 237 | Ga0105239_10447548 | 3300010375 | Bacteria | 1465 |
| 238 | Ga0105239_10543619 | 3300010375 | Bacteria | 1323 |
| 239 | Ga0157373_10003066 | 3300013100 | Bacteria | 12614 |
| 240 | Ga0157370_10006819 | 3300013104 | Bacteria | 12517 |
| 241 | Ga0157370_10037443 | 3300013104 | Bacteria | 4702 |
| 242 | Ga0157370_10044127 | 3300013104 | Bacteria | 4287 |
| 243 | Ga0157370_10421304 | 3300013104 | Bacteria | 1228 |
| 244 | Ga0157369_10005690 | 3300013105 | Bacteria | 14475 |
| 245 | Ga0157369_10314084 | 3300013105 | Bacteria | 1629 |
| 246 | Ga0157374_10034539 | 3300013296 | Bacteria | 4620 |
| 247 | Ga0157374_10074134 | 3300013296 | Bacteria | 3213 |
| 248 | Ga0157374_10169643 | 3300013296 | Bacteria | 2128 |
| 249 | Ga0157374_10494389 | 3300013296 | Bacteria | 1227 |
| 250 | Ga0157378_10229724 | 3300013297 | Bacteria | 1767 |
| 251 | Ga0163162_10068152 | 3300013306 | Bacteria | 3609 |
| 252 | Ga0163162_10165803 | 3300013306 | Bacteria | 2333 |
| 253 | Ga0157372_10025789 | 3300013307 | Bacteria | 6393 |
| 254 | Ga0157372_10091442 | 3300013307 | Bacteria | 3461 |
| 255 | Ga0157375_10032542 | 3300013308 | Bacteria | 4946 |
| 256 | Ga0157375_10072895 | 3300013308 | Bacteria | 3451 |
| 257 | Ga0163163_10000224 | 3300014325 | Bacteria | 58364 |
| 258 | Ga0163163_10060146 | 3300014325 | Bacteria | 3761 |
| 259 | Ga0163163_10388959 | 3300014325 | Bacteria | 1452 |
| 260 | Ga0157380_10009519 | 3300014326 | Bacteria | 6968 |
| 261 | Ga0157380_10642912 | 3300014326 | Bacteria | 1057 |
| 262 | Ga0157377_10029000 | 3300014745 | Bacteria | 2984 |
| 263 | Ga0157379_10008268 | 3300014968 | Bacteria | 9042 |
| 264 | Ga0157379_10017027 | 3300014968 | Bacteria | 6398 |
| 265 | Ga0157379_10026449 | 3300014968 | Bacteria | 5166 |
| 266 | Ga0157379_10760097 | 3300014968 | Bacteria | 913 |
| 267 | Ga0157376_10245155 | 3300014969 | Bacteria | 1671 |
| 268 | Ga0213874_10016451 | 3300021377 | Bacteria | 1969 |
| 269 | Ga0213874_10031242 | 3300021377 | Bacteria | 1540 |
| 270 | Ga0213876_10025821 | 3300021384 | Bacteria | 3097 |
| 271 | Ga0213875_10077555 | 3300021388 | Bacteria | 1551 |
| 272 | Ga0207642_10059297 | 3300025899 | Bacteria | 1769 |
| 273 | Ga0207710_10000933 | 3300025900 | Bacteria | 15560 |
| 274 | Ga0207710_10217357 | 3300025900 | Bacteria | 948 |
| 275 | Ga0207688_10067867 | 3300025901 | Bacteria | 2018 |
| 276 | Ga0207680_10071994 | 3300025903 | Bacteria | 2144 |
| 277 | Ga0207680_10088588 | 3300025903 | Bacteria | 1963 |
| 278 | Ga0207699_10000104 | 3300025906 | Bacteria | 60711 |
| 279 | Ga0207699_10019784 | 3300025906 | Bacteria | 3597 |
| 280 | Ga0207699_10103833 | 3300025906 | Bacteria | 1809 |
| 281 | Ga0207699_10232692 | 3300025906 | Bacteria | 1263 |
| 282 | Ga0207645_10037462 | 3300025907 | Bacteria | 3112 |
| 283 | Ga0207705_10000418 | 3300025909 | Bacteria | 37385 |
| 284 | Ga0207654_10030759 | 3300025911 | Bacteria | 2950 |
| 285 | Ga0207707_10000094 | 3300025912 | Bacteria | 89818 |
| 286 | Ga0207707_10003808 | 3300025912 | Bacteria | 13370 |
| 287 | Ga0207707_10018500 | 3300025912 | Bacteria | 6073 |
| 288 | Ga0207707_10066336 | 3300025912 | Bacteria | 3143 |
| 289 | Ga0207707_10285609 | 3300025912 | Bacteria | 1428 |
| 290 | Ga0207695_10030245 | 3300025913 | Bacteria | 5964 |
| 291 | Ga0207695_10033954 | 3300025913 | Bacteria | 5554 |
| 292 | Ga0207695_10034537 | 3300025913 | Bacteria | 5497 |
| 293 | Ga0207695_10042966 | 3300025913 | Bacteria | 4821 |
| 294 | Ga0207695_10065688 | 3300025913 | Bacteria | 3729 |
| 295 | Ga0207695_10081742 | 3300025913 | Bacteria | 3268 |
| 296 | Ga0207695_10085650 | 3300025913 | Bacteria | 3180 |
| 297 | Ga0207695_10135105 | 3300025913 | Bacteria | 2420 |
| 298 | Ga0207695_10186234 | 3300025913 | Bacteria | 1995 |
| 299 | Ga0207695_10189005 | 3300025913 | Bacteria | 1977 |
| 300 | Ga0207671_10038756 | 3300025914 | Bacteria | 3531 |
| 301 | Ga0207671_10060225 | 3300025914 | Bacteria | 2816 |
| 302 | Ga0207671_10165061 | 3300025914 | Bacteria | 1717 |
| 303 | Ga0207671_10217537 | 3300025914 | Bacteria | 1496 |
| 304 | Ga0207671_10579844 | 3300025914 | Bacteria | 894 |
| 305 | Ga0207693_10003070 | 3300025915 | Bacteria | 14405 |
| 306 | Ga0207693_10020163 | 3300025915 | Bacteria | 5304 |
| 307 | Ga0207693_10288170 | 3300025915 | Bacteria | 1287 |
| 308 | Ga0207663_10059044 | 3300025916 | Bacteria | 2424 |
| 309 | Ga0207663_10269537 | 3300025916 | Bacteria | 1261 |
| 310 | Ga0207660_10003683 | 3300025917 | Bacteria | 9990 |
| 311 | Ga0207660_10056250 | 3300025917 | Bacteria | 2814 |
| 312 | Ga0207660_10088885 | 3300025917 | Bacteria | 2286 |
| 313 | Ga0207660_10503604 | 3300025917 | Bacteria | 983 |
| 314 | Ga0207662_10005619 | 3300025918 | Bacteria | 6706 |
| 315 | Ga0207657_10004952 | 3300025919 | Bacteria | 14016 |
| 316 | Ga0207657_10114611 | 3300025919 | Bacteria | 2222 |
| 317 | Ga0207657_10218018 | 3300025919 | Bacteria | 1529 |
| 318 | Ga0207649_10080241 | 3300025920 | Bacteria | 2110 |
| 319 | Ga0207652_10003121 | 3300025921 | Bacteria | 13813 |
| 320 | Ga0207652_10011314 | 3300025921 | Bacteria | 7190 |
| 321 | Ga0207652_10038059 | 3300025921 | Bacteria | 4075 |
| 322 | Ga0207652_10119697 | 3300025921 | Bacteria | 2342 |
| 323 | Ga0207652_10231444 | 3300025921 | Bacteria | 1665 |
| 324 | Ga0207652_10294565 | 3300025921 | Bacteria | 1464 |
| 325 | Ga0207681_10054586 | 3300025923 | Bacteria | 2717 |
| 326 | Ga0207694_10011442 | 3300025924 | Bacteria | 6696 |
| 327 | Ga0207694_10057032 | 3300025924 | Bacteria | 3035 |
| 328 | Ga0207694_10247688 | 3300025924 | Bacteria | 1457 |
| 329 | Ga0207694_10295280 | 3300025924 | Bacteria | 1333 |
| 330 | Ga0207694_10529201 | 3300025924 | Bacteria | 988 |
| 331 | Ga0207650_10049485 | 3300025925 | Bacteria | 3104 |
| 332 | Ga0207659_10032545 | 3300025926 | Bacteria | 3580 |
| 333 | Ga0207659_10319133 | 3300025926 | Bacteria | 1281 |
| 334 | Ga0207687_10016415 | 3300025927 | Bacteria | 4864 |
| 335 | Ga0207700_10000335 | 3300025928 | Bacteria | 27697 |
| 336 | Ga0207700_10030158 | 3300025928 | Bacteria | 3837 |
| 337 | Ga0207700_10363340 | 3300025928 | Bacteria | 1263 |
| 338 | Ga0207664_10015253 | 3300025929 | Bacteria | 5570 |
| 339 | Ga0207664_10058745 | 3300025929 | Bacteria | 3061 |
| 340 | Ga0207664_10087010 | 3300025929 | Bacteria | 2554 |
| 341 | Ga0207644_10038265 | 3300025931 | Bacteria | 3378 |
| 342 | Ga0207644_10197769 | 3300025931 | Bacteria | 1584 |
| 343 | Ga0207690_10019811 | 3300025932 | Bacteria | 4146 |
| 344 | Ga0207706_10010097 | 3300025933 | Bacteria | 8647 |
| 345 | Ga0207706_10028926 | 3300025933 | Bacteria | 4947 |
| 346 | Ga0207686_10147679 | 3300025934 | Bacteria | 1633 |
| 347 | Ga0207686_10364428 | 3300025934 | Bacteria | 1092 |
| 348 | Ga0207665_10055300 | 3300025939 | Bacteria | 2677 |
| 349 | Ga0207665_10090135 | 3300025939 | Bacteria | 2125 |
| 350 | Ga0207665_10140055 | 3300025939 | Bacteria | 1724 |
| 351 | Ga0207691_10027055 | 3300025940 | Bacteria | 5382 |
| 352 | Ga0207691_10221902 | 3300025940 | Bacteria | 1639 |
| 353 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 354 | Ga0207689_10107137 | 3300025942 | Bacteria | 2297 |
| 355 | Ga0207661_10121207 | 3300025944 | Bacteria | 2227 |
| 356 | Ga0207661_10188121 | 3300025944 | Bacteria | 1808 |
| 357 | Ga0207679_10006329 | 3300025945 | Bacteria | 7479 |
| 358 | Ga0207667_10001596 | 3300025949 | Bacteria | 28502 |
| 359 | Ga0207667_10003668 | 3300025949 | Bacteria | 18928 |
| 360 | Ga0207667_10029961 | 3300025949 | Bacteria | 5894 |
| 361 | Ga0207667_10103023 | 3300025949 | Bacteria | 2944 |
| 362 | Ga0207651_10004330 | 3300025960 | Bacteria | 7132 |
| 363 | Ga0207712_10007064 | 3300025961 | Bacteria | 7082 |
| 364 | Ga0207712_10017096 | 3300025961 | Bacteria | 4706 |
| 365 | Ga0207712_10042910 | 3300025961 | Bacteria | 3117 |
| 366 | Ga0207668_10022023 | 3300025972 | Bacteria | 4072 |
| 367 | Ga0207668_10065206 | 3300025972 | Bacteria | 2577 |
| 368 | Ga0207640_10136532 | 3300025981 | Bacteria | 1781 |
| 369 | Ga0207658_10004874 | 3300025986 | Bacteria | 9262 |
| 370 | Ga0207658_10086116 | 3300025986 | Bacteria | 2422 |
| 371 | Ga0207658_10244985 | 3300025986 | Bacteria | 1520 |
| 372 | Ga0207677_10131743 | 3300026023 | Bacteria | 1900 |
| 373 | Ga0207703_10000259 | 3300026035 | Bacteria | 59607 |
| 374 | Ga0207703_10006874 | 3300026035 | Bacteria | 9059 |
| 375 | Ga0207703_10297289 | 3300026035 | Bacteria | 1471 |
| 376 | Ga0207703_10353111 | 3300026035 | Bacteria | 1354 |
| 377 | Ga0207639_10574293 | 3300026041 | Bacteria | 1037 |
| 378 | Ga0207678_10032626 | 3300026067 | Bacteria | 4538 |
| 379 | Ga0207678_10349626 | 3300026067 | Bacteria | 1275 |
| 380 | Ga0207708_10024029 | 3300026075 | Bacteria | 4609 |
| 381 | Ga0207708_10159685 | 3300026075 | Bacteria | 1779 |
| 382 | Ga0207702_10000045 | 3300026078 | Bacteria | 144714 |
| 383 | Ga0207702_10049989 | 3300026078 | Bacteria | 3529 |
| 384 | Ga0207702_10175845 | 3300026078 | Bacteria | 1967 |
| 385 | Ga0207641_10000196 | 3300026088 | Bacteria | 81985 |
| 386 | Ga0207641_10002905 | 3300026088 | Bacteria | 15500 |
| 387 | Ga0207641_10006042 | 3300026088 | Bacteria | 10261 |
| 388 | Ga0207648_10023272 | 3300026089 | Bacteria | 5555 |
| 389 | Ga0207648_10140388 | 3300026089 | Bacteria | 2129 |
| 390 | Ga0207676_10010514 | 3300026095 | Bacteria | 6593 |
| 391 | Ga0207676_10164863 | 3300026095 | Bacteria | 1924 |
| 392 | Ga0207674_10000026 | 3300026116 | Bacteria | 151359 |
| 393 | Ga0207674_10040771 | 3300026116 | Bacteria | 4807 |
| 394 | Ga0207675_100006173 | 3300026118 | Bacteria | 11383 |
| 395 | Ga0207675_100038632 | 3300026118 | Bacteria | 4454 |
| 396 | Ga0207675_100046089 | 3300026118 | Bacteria | 4072 |
| 397 | Ga0207675_100189057 | 3300026118 | Bacteria | 1974 |
| 398 | Ga0207675_100541579 | 3300026118 | Bacteria | 1162 |
| 399 | Ga0207683_10064816 | 3300026121 | Bacteria | 3220 |
| 400 | Ga0207683_10467184 | 3300026121 | Unclassified | 1164 |
| 401 | Ga0207698_10909913 | 3300026142 | Bacteria | 887 |
| 402 | Ga0209179_1010003 | 3300027512 | Bacteria | 1641 |
| 403 | Ga0209179_1024902 | 3300027512 | Bacteria | 1190 |
| 404 | Ga0209983_1005372 | 3300027665 | Bacteria | 2656 |
| 405 | Ga0209588_1028331 | 3300027671 | Bacteria | 1783 |
| 406 | Ga0207428_10070656 | 3300027907 | Bacteria | 2744 |
| 407 | Ga0268266_10000512 | 3300028379 | Bacteria | 54629 |
| 408 | Ga0268266_10009688 | 3300028379 | Bacteria | 8465 |
| 409 | Ga0268266_10010214 | 3300028379 | Bacteria | 8224 |
| 410 | Ga0268266_10090242 | 3300028379 | Bacteria | 2686 |
| 411 | Ga0268266_10149071 | 3300028379 | Bacteria | 2106 |
| 412 | Ga0268266_10451342 | 3300028379 | Bacteria | 1222 |
| 413 | Ga0268265_10001867 | 3300028380 | Bacteria | 16773 |
| 414 | Ga0268265_10027901 | 3300028380 | Bacteria | 4036 |
| 415 | Ga0268265_10037669 | 3300028380 | Bacteria | 3551 |
| 416 | Ga0268264_10000182 | 3300028381 | Bacteria | 134007 |
| 417 | Ga0268264_10025318 | 3300028381 | Bacteria | 4847 |
| 418 | Ga0268264_10648480 | 3300028381 | Bacteria | 1045 |
| 419 | Ga0265334_10023301 | 3300028573 | Bacteria | 2518 |
| 420 | Ga0265318_10001660 | 3300028577 | Bacteria | 12792 |
| 421 | Ga0307515_10055442 | 3300028794 | Bacteria | 5791 |
| 422 | Ga0265338_10000017 | 3300028800 | Bacteria | 344481 |
| 423 | Ga0265338_10426543 | 3300028800 | Bacteria | 942 |
| 424 | Ga0307511_10000008 | 3300030521 | Bacteria | 159928 |
| 425 | Ga0265330_10010677 | 3300031235 | Bacteria | 4322 |
| 426 | Ga0265328_10010751 | 3300031239 | Bacteria | 3676 |
| 427 | Ga0265320_10089932 | 3300031240 | Bacteria | 1423 |
| 428 | Ga0265325_10000008 | 3300031241 | Bacteria | 186174 |
| 429 | Ga0265329_10013556 | 3300031242 | Bacteria | 2901 |
| 430 | Ga0265340_10000054 | 3300031247 | Bacteria | 53196 |
| 431 | Ga0265340_10013729 | 3300031247 | Bacteria | 4248 |
| 432 | Ga0265339_10001599 | 3300031249 | Bacteria | 16756 |
| 433 | Ga0265331_10021786 | 3300031250 | Bacteria | 3275 |
| 434 | Ga0265331_10035413 | 3300031250 | Bacteria | 2456 |
| 435 | Ga0265331_10045023 | 3300031250 | Bacteria | 2131 |
| 436 | Ga0265316_10008009 | 3300031344 | Bacteria | 9865 |
| 437 | Ga0265316_10026388 | 3300031344 | Bacteria | 4833 |
| 438 | Ga0265316_10321874 | 3300031344 | Bacteria | 1123 |
| 439 | Ga0307513_10129833 | 3300031456 | Bacteria | 2468 |
| 440 | Ga0307513_10129948 | 3300031456 | Bacteria | 2467 |
| 441 | Ga0307509_10000099 | 3300031507 | Bacteria | 121307 |
| 442 | Ga0307509_10000154 | 3300031507 | Bacteria | 106459 |
| 443 | Ga0307408_100007916 | 3300031548 | Bacteria | 7026 |
| 444 | Ga0307408_100032300 | 3300031548 | Bacteria | 3649 |
| 445 | Ga0307408_100176127 | 3300031548 | Bacteria | 1711 |
| 446 | Ga0265313_10002014 | 3300031595 | Bacteria | 18229 |
| 447 | Ga0265313_10011807 | 3300031595 | Bacteria | 5400 |
| 448 | Ga0265313_10012307 | 3300031595 | Bacteria | 5235 |
| 449 | Ga0265313_10107543 | 3300031595 | Bacteria | 1230 |
| 450 | Ga0265342_10003097 | 3300031712 | Bacteria | 13890 |
| 451 | Ga0265342_10011102 | 3300031712 | Bacteria | 6183 |
| 452 | Ga0265342_10113422 | 3300031712 | Bacteria | 1532 |
| 453 | Ga0316576_10108570 | 3300031727 | Bacteria | 2079 |
| 454 | Ga0307413_10017158 | 3300031824 | Bacteria | 3765 |
| 455 | Ga0307413_10526681 | 3300031824 | Bacteria | 954 |
| 456 | Ga0307409_100233820 | 3300031995 | Bacteria | 1668 |
| 457 | Ga0307416_100005410 | 3300032002 | Bacteria | 7838 |
| 458 | Ga0307411_10109890 | 3300032005 | Bacteria | 1970 |
| 459 | Ga0307411_10522313 | 3300032005 | Bacteria | 1008 |
| 460 | Ga0307415_100261549 | 3300032126 | Bacteria | 1412 |
| 461 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 462 | Ga0307510_10004142 | 3300033180 | Bacteria | 17024 |
| 463 | Ga0373958_0022342 | 3300034819 | Bacteria | 1181 |
| 464 | Ga0373934_0143455 | 3300035086 | Bacteria | 977 |
| 465 | Ga0373936_0029807 | 3300035113 | Bacteria | 2149 |
| 466 | Ga0373939_0112563 | 3300035114 | Bacteria | 950 |
| 467 | Ga0373954_0136292 | 3300035118 | Bacteria | 1196 |
| 468 | Ga0373960_0055800 | 3300035121 | Bacteria | 1185 |
| 469 | Ga0373943_0012543 | 3300035170 | Bacteria | 3819 |
| 470 | Ga0373943_0173100 | 3300035170 | Bacteria | 1182 |
| 471 | Ga0316574_0250414 | 3300035398 | Bacteria | 1132 |
| 472 | Ga0373931_0028615 | 3300035691 | Bacteria | 2855 |
| 473 | Ga0373935_0033430 | 3300035692 | Bacteria | 3200 |
| 474 | Ga0373935_0333695 | 3300035692 | Bacteria | 1078 |
| 475 | Ga0373927_0040298 | 3300035695 | Bacteria | 3030 |
| 476 | Ga0373933_0010033 | 3300035724 | Bacteria | 5185 |
| 477 | Ga0373933_0051341 | 3300035724 | Unclassified | 2464 |
| 478 | Ga0373947_0014193 | 3300035725 | Bacteria | 4568 |
| 479 | Ga0373937_0019319 | 3300036401 | Bacteria | 6097 |
| 480 | Ga0373937_0208674 | 3300036401 | Unclassified | 1837 |
| 481 | Ga0373937_0476545 | 3300036401 | Bacteria | 1185 |
| 482 | Ga0373925_0005045 | 3300037068 | Bacteria | 9901 |
| 483 | Ga0373925_0281495 | 3300037068 | Bacteria | 1339 |
| 484 | Ga0395905_0767652 | 3300037471 | Bacteria | 867 |
| 485 | Ga0436364_0227708 | 3300037853 | Bacteria | 2809 |
| 486 | Ga0436364_0486989 | 3300037853 | Bacteria | 773 |
| 487 | Ga0436365_0991661 | 3300039437 | Bacteria | 5505 |
| 488 | Ga0436365_1473558 | 3300039437 | Bacteria | 3190 |
| 489 | Ga0436360_0326253 | 3300039438 | Bacteria | 935 |
| 490 | Ga0436360_0624728 | 3300039438 | Bacteria | 2040 |
| 491 | Ga0436361_0132850 | 3300039447 | Bacteria | 3980 |
| 492 | Ga0436363_0209315 | 3300039450 | Bacteria | 1048 |
| 493 | Ga0436363_0517558 | 3300039450 | Bacteria | 6614 |
| 494 | Ga0436363_1409576 | 3300039450 | Bacteria | 9695 |
| 495 | Ga0436363_1476208 | 3300039450 | Bacteria | 2359 |
| 496 | Ga0436362_0524883 | 3300039453 | Bacteria | 1017 |
| 497 | Ga0439466_0024021 | 3300041411 | Bacteria | 2140 |
| 498 | Ga0439437_001170 | 3300042000 | Bacteria | 2746 |
| 499 | Ga0439455_0028446 | 3300042012 | Bacteria | 1376 |
| 500 | Ga0439456_053821 | 3300042013 | Bacteria | 881 |
| 501 | Ga0450911_000008 | 3300042115 | Bacteria | 168304 |
| 502 | Ga0450895_002243 | 3300042132 | Bacteria | 1427 |
| 503 | Ga0450902_032557 | 3300042137 | Bacteria | 879 |
| 504 | Ga0450904_000004 | 3300042139 | Bacteria | 62161 |
| 505 | Ga0450906_027675 | 3300042145 | Bacteria | 1005 |
| 506 | Ga0439446_0000721 | 3300042156 | Bacteria | 6892 |
| 507 | Ga0439446_0012537 | 3300042156 | Bacteria | 2315 |
| 508 | Ga0439435_0103729 | 3300042436 | Bacteria | 876 |
| 509 | Ga0439459_0024299 | 3300042438 | Bacteria | 1187 |
| 510 | Ga0439460_0033412 | 3300042461 | Bacteria | 1477 |
| 511 | Ga0450893_0000346 | 3300042532 | Bacteria | 6432 |
| 512 | Ga0450893_0026708 | 3300042532 | Bacteria | 1016 |
| 513 | Ga0451577_0007135 | 3300042876 | Bacteria | 11020 |
| 514 | Ga0451577_0311205 | 3300042876 | Bacteria | 1428 |
| 515 | Ga0466969_0018357 | 3300044656 | Bacteria | 3645 |
| 516 | Ga0466969_0039567 | 3300044656 | Bacteria | 2367 |
| 517 | Ga0466969_0140916 | 3300044656 | Bacteria | 1114 |
| 518 | Ga0466959_0040445 | 3300045049 | Bacteria | 3444 |
| 519 | Ga0451576_0003293 | 3300045051 | Bacteria | 22424 |
| 520 | Ga0451576_0078101 | 3300045051 | Bacteria | 3445 |
| 521 | Ga0495638_0001409 | 3300046460 | Bacteria | 21856 |
| 522 | Ga0495638_0017538 | 3300046460 | Bacteria | 4770 |
| 523 | Ga0495651_0092349 | 3300046462 | Bacteria | 2268 |
| 524 | Ga0495650_0026413 | 3300046471 | Bacteria | 2702 |
| 525 | Ga0495580_0419786 | 3300046472 | Bacteria | 900 |
| 526 | Ga0495606_0032078 | 3300046507 | Bacteria | 3644 |
| 527 | Ga0495606_0440343 | 3300046507 | Bacteria | 670 |
| 528 | Ga0495640_0006768 | 3300046533 | Bacteria | 9044 |
| 529 | Ga0495645_0265094 | 3300046543 | Bacteria | 1136 |
| 530 | Ga0495634_0191876 | 3300046642 | Bacteria | 1274 |
| 531 | Ga0495625_0079278 | 3300046660 | Bacteria | 2290 |
| 532 | Ga0495625_0124535 | 3300046660 | Bacteria | 1751 |
| 533 | Ga0495659_0073761 | 3300046664 | Bacteria | 1283 |
| 534 | Ga0495623_0027113 | 3300046679 | Bacteria | 3685 |
| 535 | Ga0495671_0026581 | 3300046692 | Bacteria | 2999 |
| 536 | Ga0495649_0117893 | 3300046694 | Bacteria | 1405 |
| 537 | Ga0495604_0243713 | 3300047317 | Bacteria | 1228 |
| 538 | Ga0495672_0008659 | 3300047320 | Bacteria | 7478 |
| 539 | Ga0495672_0018987 | 3300047320 | Bacteria | 4547 |
| 540 | Ga0495672_0094644 | 3300047320 | Bacteria | 1633 |
| 541 | Ga0495687_082743 | 3300047443 | Bacteria | 1252 |
| 542 | Ga0495675_0099446 | 3300047444 | Bacteria | 1822 |
| 543 | Ga0495684_0130141 | 3300047471 | Bacteria | 1891 |
| 544 | Ga0495602_0142475 | 3300048088 | Bacteria | 1896 |
| 545 | Ga0496100_0232163 | 3300048903 | Bacteria | 1358 |
| 546 | Ga0496100_0456567 | 3300048903 | Bacteria | 980 |
| 547 | Ga0496101_0163715 | 3300048904 | Bacteria | 1707 |
| 548 | Ga0496101_0184979 | 3300048904 | Bacteria | 1606 |
| 549 | Ga0496102_0004416 | 3300048905 | Bacteria | 11878 |
| 550 | Ga0496102_0014849 | 3300048905 | Bacteria | 6775 |
| 551 | Ga0496103_0089733 | 3300048906 | Bacteria | 1939 |
| 552 | Ga0496104_0006495 | 3300048907 | Bacteria | 10283 |
| 553 | Ga0496104_0089374 | 3300048907 | Bacteria | 2943 |
| 554 | Ga0496105_0130713 | 3300048908 | Bacteria | 2070 |
| 555 | Ga0496106_0225072 | 3300048909 | Bacteria | 1496 |
| 556 | Ga0496106_0718481 | 3300048909 | Bacteria | 796 |
| 557 | Ga0496107_0228677 | 3300048910 | Unclassified | 1384 |
| 558 | Ga0496108_0042139 | 3300048911 | Bacteria | 3811 |
| 559 | Ga0496109_0229342 | 3300048912 | Bacteria | 1747 |
| 560 | Ga0496109_0492969 | 3300048912 | Bacteria | 1156 |
| 561 | Ga0496110_0184964 | 3300048913 | Bacteria | 1892 |
| 562 | Ga0496111_0301357 | 3300048914 | Bacteria | 1188 |
| 563 | Ga0496112_0066496 | 3300048915 | Bacteria | 3557 |
| 564 | Ga0496112_0200136 | 3300048915 | Bacteria | 1957 |
| 565 | Ga0496113_0026120 | 3300048916 | Bacteria | 4172 |
| 566 | Ga0496114_0375658 | 3300048917 | Unclassified | 1258 |
| 567 | Ga0496114_0560386 | 3300048917 | Bacteria | 1009 |
| 568 | Ga0496115_0018696 | 3300048918 | Bacteria | 5327 |
| 569 | Ga0496115_0155234 | 3300048918 | Bacteria | 1891 |
| 570 | Ga0496116_0003291 | 3300048919 | Bacteria | 16067 |
| 571 | Ga0496117_0000095 | 3300048920 | Bacteria | 198731 |
| 572 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 573 | Ga0496118_0088844 | 3300048921 | Bacteria | 2136 |
| 574 | Ga0496118_0116563 | 3300048921 | Bacteria | 1755 |
| 575 | Ga0496119_0009520 | 3300048922 | Bacteria | 8320 |
| 576 | Ga0496119_0020125 | 3300048922 | Bacteria | 4879 |
| 577 | Ga0496119_0138697 | 3300048922 | Bacteria | 1316 |
| 578 | Ga0496120_0000693 | 3300048923 | Bacteria | 49436 |
| 579 | Ga0496120_0117155 | 3300048923 | Bacteria | 1382 |
| 580 | Ga0496121_0009504 | 3300048924 | Bacteria | 11156 |
| 581 | Ga0496121_0011641 | 3300048924 | Bacteria | 9727 |
| 582 | Ga0496124_0005346 | 3300048927 | Bacteria | 14493 |
| 583 | Ga0496125_0000112 | 3300048928 | Bacteria | 188192 |
| 584 | Ga0496125_0027039 | 3300048928 | Bacteria | 5210 |
| 585 | Ga0496126_0002920 | 3300048929 | Bacteria | 22234 |
| 586 | Ga0496126_0003855 | 3300048929 | Bacteria | 18532 |
| 587 | Ga0496126_0009185 | 3300048929 | Bacteria | 10546 |
| 588 | Ga0496126_0045173 | 3300048929 | Bacteria | 4051 |
| 589 | Ga0496126_0064500 | 3300048929 | Bacteria | 3281 |
| 590 | Ga0501299_016954 | 3300049522 | Bacteria | 1295 |
| 591 | Ga0501033_0012309 | 3300049570 | Bacteria | 6530 |
| 592 | Ga0501033_0046837 | 3300049570 | Bacteria | 3215 |
| 593 | Ga0501034_0023505 | 3300049571 | Bacteria | 6281 |
| 594 | Ga0501036_0298441 | 3300049572 | Bacteria | 1348 |
| 595 | Ga0501036_0311051 | 3300049572 | Bacteria | 1317 |
| 596 | Ga0501038_0270058 | 3300049574 | Bacteria | 1341 |
| 597 | Ga0501041_0085994 | 3300049577 | Bacteria | 1940 |
| 598 | Ga0501042_0108676 | 3300049578 | Bacteria | 1997 |
| 599 | Ga0501042_0381242 | 3300049578 | Bacteria | 1021 |
| 600 | Ga0501046_0063072 | 3300049580 | Bacteria | 2894 |
| 601 | Ga0501047_0000618 | 3300049581 | Bacteria | 37530 |
| 602 | Ga0501047_0075687 | 3300049581 | Bacteria | 3239 |
| 603 | Ga0501048_0077144 | 3300049582 | Bacteria | 2352 |
| 604 | Ga0501070_0042982 | 3300049586 | Bacteria | 3762 |
| 605 | Ga0501071_0147652 | 3300049587 | Bacteria | 1753 |
| 606 | Ga0501072_0352717 | 3300049588 | Bacteria | 1168 |
| 607 | Ga0501073_0074078 | 3300049589 | Bacteria | 2371 |
| 608 | Ga0501075_0142808 | 3300049591 | Bacteria | 1825 |
| 609 | Ga0501076_0186284 | 3300049592 | Bacteria | 1693 |
| 610 | Ga0501044_0032978 | 3300049823 | Bacteria | 5443 |
| 611 | Ga0501044_0456593 | 3300049823 | Bacteria | 1183 |
| 612 | Ga0501044_0470633 | 3300049823 | Bacteria | 1161 |
| 613 | Ga0501226_000005 | 3300049853 | Bacteria | 271019 |
| 614 | nmdc:mga05p37_15071_c1 | 3300050507 | Bacteria | 9282 |
| 615 | nmdc:mga05p37_419090_c1 | 3300050507 | Bacteria | 1558 |
| 616 | nmdc:mga09592_1068_c1 | 3300050508 | Bacteria | 21776 |
| 617 | nmdc:mga09592_32074_c1 | 3300050508 | Bacteria | 4379 |
| 618 | nmdc:mga0qj67_1805_c1 | 3300050509 | Bacteria | 15127 |
| 619 | nmdc:mga0qj67_239275_c1 | 3300050509 | Bacteria | 1473 |
| 620 | nmdc:mga0qj67_2664_c1 | 3300050509 | Bacteria | 12788 |
| 621 | nmdc:mga0qj67_351273_c1 | 3300050509 | Bacteria | 1192 |
| 622 | nmdc:mga0qj67_41338_c1 | 3300050509 | Bacteria | 3626 |
| 623 | nmdc:mga0qj67_50623_c1 | 3300050509 | Bacteria | 3285 |
| 624 | nmdc:mga06r32_111861_c1 | 3300050510 | Bacteria | 2687 |
| 625 | nmdc:mga06r32_294_c1 | 3300050510 | Bacteria | 41509 |
| 626 | nmdc:mga06r32_4213_c1 | 3300050510 | Bacteria | 12884 |
| 627 | nmdc:mga08y16_123023_c1 | 3300050511 | Bacteria | 2700 |
| 628 | nmdc:mga0n895_33474_c1 | 3300050512 | Bacteria | 4940 |
| 629 | nmdc:mga0n895_404788_c1 | 3300050512 | Bacteria | 1380 |
| 630 | nmdc:mga0n895_71599_c1 | 3300050512 | Bacteria | 3438 |
| 631 | nmdc:mga0rr50_485618_c1 | 3300050513 | Bacteria | 1049 |
| 632 | nmdc:mga0rr50_8286_c1 | 3300050513 | Bacteria | 4957 |
| 633 | nmdc:mga08x19_100_c1 | 3300050514 | Bacteria | 76036 |
| 634 | nmdc:mga08x19_23616_c1 | 3300050514 | Bacteria | 3815 |
| 635 | Ga0495619_0034228 | 3300053085 | Bacteria | 3303 |
| 636 | Ga0500644_0047545 | 3300053088 | Bacteria | 1456 |
| 637 | Ga0500583_0012417 | 3300053092 | Bacteria | 3249 |
| 638 | Ga0500583_0022380 | 3300053092 | Bacteria | 2646 |
| 639 | Ga0500583_0062805 | 3300053092 | Bacteria | 1757 |
| 640 | Ga0500641_0075097 | 3300053096 | Bacteria | 1428 |
| 641 | Ga0500650_0046612 | 3300053098 | Bacteria | 2009 |
| 642 | Ga0500556_0068801 | 3300053104 | Bacteria | 1319 |
| 643 | Ga0500591_085117 | 3300053115 | Bacteria | 1395 |
| 644 | Ga0500614_067344 | 3300053123 | Bacteria | 976 |
| 645 | Ga0500617_005236 | 3300053124 | Bacteria | 4937 |
| 646 | Ga0500617_059969 | 3300053124 | Bacteria | 1686 |
| 647 | Ga0500658_0034738 | 3300053134 | Bacteria | 1992 |
| 648 | Ga0500568_0036113 | 3300053139 | Bacteria | 2013 |
| 649 | Ga0500568_0056190 | 3300053139 | Bacteria | 1534 |
| 650 | Ga0500568_0117369 | 3300053139 | Bacteria | 992 |
| 651 | Ga0500588_0004209 | 3300053146 | Bacteria | 3102 |
| 652 | Ga0500588_0008613 | 3300053146 | Bacteria | 2391 |
| 653 | Ga0500589_082919 | 3300053147 | Bacteria | 1428 |
| 654 | Ga0500622_0001895 | 3300053156 | Bacteria | 15796 |
| 655 | Ga0500622_0011421 | 3300053156 | Bacteria | 4837 |
| 656 | Ga0500622_0028001 | 3300053156 | Bacteria | 2968 |
| 657 | Ga0500630_064737 | 3300053159 | Bacteria | 1741 |
| 658 | Ga0500636_0167225 | 3300053177 | Bacteria | 1193 |
| 659 | Ga0500637_0001099 | 3300053178 | Bacteria | 11152 |
| 660 | Ga0500637_0050556 | 3300053178 | Bacteria | 2369 |
| 661 | Ga0500637_0063113 | 3300053178 | Bacteria | 2124 |
| 662 | Ga0500637_0078151 | 3300053178 | Bacteria | 1909 |
| 663 | Ga0501084_0000106 | 3300054114 | Bacteria | 62239 |
| 664 | Ga0501084_0108946 | 3300054114 | Bacteria | 2327 |
| 665 | Ga0501084_0250959 | 3300054114 | Bacteria | 1494 |
| 666 | Ga0501082_0138390 | 3300060353 | Bacteria | 2113 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0456567 | Ga0496100_0456567_352_963 | 203 |
| 2 | 3300005547 | Ga0070693_100046047 | Ga0070693_1000460472 | 211 |
| 3 | 3300009098 | Ga0105245_10027245 | Ga0105245_100272452 | 212 |
| 4 | 3300025927 | Ga0207687_10016415 | Ga0207687_100164155 | 212 |
| 5 | 3300028577 | Ga0265318_10001660 | Ga0265318_1000166011 | 213 |
| 6 | 3300031240 | Ga0265320_10089932 | Ga0265320_100899322 | 213 |
| 7 | 3300031250 | Ga0265331_10045023 | Ga0265331_100450232 | 213 |
| 8 | 3300031595 | Ga0265313_10011807 | Ga0265313_100118073 | 213 |
| 9 | 3300035086 | Ga0373934_0143455 | Ga0373934_0143455_282_959 | 213 |
| 10 | 3300027512 | Ga0209179_1024902 | Ga0209179_10249022 | 214 |
| 11 | 3300035692 | Ga0373935_0033430 | Ga0373935_0033430_2336_3067 | 214 |
| 12 | 3300039437 | Ga0436365_0991661 | Ga0436365_0991661_846_1571 | 214 |
| 13 | 3300050512 | nmdc:mga0n895_71599_c1 | nmdc:mga0n895_71599_c1_861_1595 | 214 |
| 14 | 3300046507 | Ga0495606_0440343 | Ga0495606_0440343_12_659 | 215 |
| 15 | 3300005434 | Ga0070709_10001572 | Ga0070709_100015725 | 216 |
| 16 | 3300005435 | Ga0070714_100030694 | Ga0070714_1000306942 | 216 |
| 17 | 3300005436 | Ga0070713_100000866 | Ga0070713_10000086613 | 216 |
| 18 | 3300005437 | Ga0070710_10059059 | Ga0070710_100590592 | 216 |
| 19 | 3300005439 | Ga0070711_100561413 | Ga0070711_1005614131 | 216 |
| 20 | 3300005546 | Ga0070696_100186177 | Ga0070696_1001861772 | 216 |
| 21 | 3300005614 | Ga0068856_100002253 | Ga0068856_1000022535 | 216 |
| 22 | 3300006173 | Ga0070716_100062491 | Ga0070716_1000624912 | 216 |
| 23 | 3300006175 | Ga0070712_100000181 | Ga0070712_10000018110 | 216 |
| 24 | 3300006237 | Ga0097621_100433079 | Ga0097621_1004330792 | 216 |
| 25 | 3300006914 | Ga0075436_100000796 | Ga0075436_10000079615 | 216 |
| 26 | 3300007076 | Ga0075435_100021729 | Ga0075435_1000217292 | 216 |
| 27 | 3300014968 | Ga0157379_10026449 | Ga0157379_100264494 | 216 |
| 28 | 3300025906 | Ga0207699_10000104 | Ga0207699_1000010432 | 216 |
| 29 | 3300025915 | Ga0207693_10003070 | Ga0207693_1000307011 | 216 |
| 30 | 3300025928 | Ga0207700_10000335 | Ga0207700_100003356 | 216 |
| 31 | 3300025929 | Ga0207664_10015253 | Ga0207664_100152537 | 216 |
| 32 | 3300025939 | Ga0207665_10090135 | Ga0207665_100901352 | 216 |
| 33 | 3300026078 | Ga0207702_10000045 | Ga0207702_1000004588 | 216 |
| 34 | 3300050512 | nmdc:mga0n895_33474_c1 | nmdc:mga0n895_33474_c1_2014_2748 | 216 |
| 35 | 3300050513 | nmdc:mga0rr50_8286_c1 | nmdc:mga0rr50_8286_c1_744_1478 | 216 |
| 36 | 3300050514 | nmdc:mga08x19_100_c1 | nmdc:mga08x19_100_c1_38393_39127 | 216 |
| 37 | 3300021384 | Ga0213876_10025821 | Ga0213876_100258213 | 217 |
| 38 | 3300013104 | Ga0157370_10421304 | Ga0157370_104213042 | 218 |
| 39 | 3300049570 | Ga0501033_0012309 | Ga0501033_0012309_3032_3766 | 218 |
| 40 | 3300049586 | Ga0501070_0042982 | Ga0501070_0042982_910_1644 | 218 |
| 41 | 3300035121 | Ga0373960_0055800 | Ga0373960_0055800_491_1153 | 220 |
| 42 | 3300042461 | Ga0439460_0033412 | Ga0439460_0033412_684_1418 | 222 |
| 43 | 3300048907 | Ga0496104_0089374 | Ga0496104_0089374_2261_2929 | 222 |
| 44 | 3300007265 | Ga0099794_10009212 | Ga0099794_100092122 | 226 |
| 45 | 3300009177 | Ga0105248_10000013 | Ga0105248_10000013143 | 226 |
| 46 | 3300021388 | Ga0213875_10077555 | Ga0213875_100775552 | 226 |
| 47 | 3300025941 | Ga0207711_10000003 | Ga0207711_10000003143 | 226 |
| 48 | 3300027671 | Ga0209588_1028331 | Ga0209588_10283312 | 226 |
| 49 | 3300039450 | Ga0436363_0209315 | Ga0436363_0209315_233_967 | 226 |
| 50 | 3300048910 | Ga0496107_0228677 | Ga0496107_0228677_386_1135 | 226 |
| 51 | 3300048913 | Ga0496110_0184964 | Ga0496110_0184964_1127_1876 | 226 |
| 52 | 3300050513 | nmdc:mga0rr50_485618_c1 | nmdc:mga0rr50_485618_c1_299_1021 | 226 |
| 53 | 3300006028 | Ga0070717_10076653 | Ga0070717_100766532 | 227 |
| 54 | 3300010159 | Ga0099796_10048797 | Ga0099796_100487972 | 227 |
| 55 | 3300035170 | Ga0373943_0012543 | Ga0373943_0012543_920_1654 | 227 |
| 56 | 3300035695 | Ga0373927_0040298 | Ga0373927_0040298_580_1314 | 227 |
| 57 | 3300037068 | Ga0373925_0281495 | Ga0373925_0281495_260_994 | 227 |
| 58 | 3300048904 | Ga0496101_0184979 | Ga0496101_0184979_564_1313 | 227 |
| 59 | 3300048907 | Ga0496104_0006495 | Ga0496104_0006495_9396_10145 | 227 |
| 60 | 3300048912 | Ga0496109_0229342 | Ga0496109_0229342_946_1695 | 227 |
| 61 | 3300048917 | Ga0496114_0560386 | Ga0496114_0560386_222_971 | 227 |
| 62 | 3300048918 | Ga0496115_0018696 | Ga0496115_0018696_4387_5136 | 227 |
| 63 | 3300054114 | Ga0501084_0108946 | Ga0501084_0108946_1578_2312 | 227 |
| 64 | 3300006175 | Ga0070712_100034312 | Ga0070712_1000343125 | 228 |
| 65 | 3300013297 | Ga0157378_10229724 | Ga0157378_102297242 | 228 |
| 66 | 3300025915 | Ga0207693_10288170 | Ga0207693_102881702 | 228 |
| 67 | 3300035170 | Ga0373943_0173100 | Ga0373943_0173100_75_809 | 228 |
| 68 | 3300035725 | Ga0373947_0014193 | Ga0373947_0014193_62_796 | 228 |
| 69 | 3300037068 | Ga0373925_0005045 | Ga0373925_0005045_1503_2237 | 228 |
| 70 | 3300046533 | Ga0495640_0006768 | Ga0495640_0006768_7518_8252 | 228 |
| 71 | 3300046642 | Ga0495634_0191876 | Ga0495634_0191876_451_1185 | 228 |
| 72 | 3300047471 | Ga0495684_0130141 | Ga0495684_0130141_73_807 | 228 |
| 73 | 3300048917 | Ga0496114_0375658 | Ga0496114_0375658_281_1015 | 228 |
| 74 | 3300007788 | Ga0099795_10000673 | Ga0099795_100006736 | 229 |
| 75 | 3300010159 | Ga0099796_10000179 | Ga0099796_100001797 | 229 |
| 76 | 3300027512 | Ga0209179_1010003 | Ga0209179_10100032 | 229 |
| 77 | 3300053156 | Ga0500622_0011421 | Ga0500622_0011421_3274_4008 | 229 |
| 78 | 3300009176 | Ga0105242_10688117 | Ga0105242_106881172 | 230 |
| 79 | 3300025934 | Ga0207686_10364428 | Ga0207686_103644282 | 230 |
| 80 | 3300037853 | Ga0436364_0227708 | Ga0436364_0227708_108_842 | 230 |
| 81 | 3300037853 | Ga0436364_0486989 | Ga0436364_0486989_13_747 | 230 |
| 82 | 3300039438 | Ga0436360_0326253 | Ga0436360_0326253_167_901 | 230 |
| 83 | 3300005336 | Ga0070680_100037681 | Ga0070680_1000376813 | 231 |
| 84 | 3300005336 | Ga0070680_100102832 | Ga0070680_1001028322 | 231 |
| 85 | 3300005339 | Ga0070660_100242406 | Ga0070660_1002424062 | 231 |
| 86 | 3300005345 | Ga0070692_10080580 | Ga0070692_100805802 | 231 |
| 87 | 3300005347 | Ga0070668_100045493 | Ga0070668_1000454932 | 231 |
| 88 | 3300005353 | Ga0070669_100007529 | Ga0070669_1000075297 | 231 |
| 89 | 3300005438 | Ga0070701_10487304 | Ga0070701_104873041 | 231 |
| 90 | 3300005441 | Ga0070700_100041276 | Ga0070700_1000412761 | 231 |
| 91 | 3300005455 | Ga0070663_100796645 | Ga0070663_1007966451 | 231 |
| 92 | 3300005457 | Ga0070662_100078592 | Ga0070662_1000785922 | 231 |
| 93 | 3300005458 | Ga0070681_10129381 | Ga0070681_101293812 | 231 |
| 94 | 3300005530 | Ga0070679_100088281 | Ga0070679_1000882812 | 231 |
| 95 | 3300005719 | Ga0068861_100089702 | Ga0068861_1000897022 | 231 |
| 96 | 3300005844 | Ga0068862_100015763 | Ga0068862_1000157635 | 231 |
| 97 | 3300006880 | Ga0075429_100031359 | Ga0075429_1000313594 | 231 |
| 98 | 3300009094 | Ga0111539_10022128 | Ga0111539_100221284 | 231 |
| 99 | 3300009174 | Ga0105241_10471341 | Ga0105241_104713412 | 231 |
| 100 | 3300009553 | Ga0105249_10080123 | Ga0105249_100801232 | 231 |
| 101 | 3300010375 | Ga0105239_10382350 | Ga0105239_103823502 | 231 |
| 102 | 3300014326 | Ga0157380_10642912 | Ga0157380_106429122 | 231 |
| 103 | 3300025907 | Ga0207645_10037462 | Ga0207645_100374622 | 231 |
| 104 | 3300025912 | Ga0207707_10285609 | Ga0207707_102856092 | 231 |
| 105 | 3300025917 | Ga0207660_10088885 | Ga0207660_100888853 | 231 |
| 106 | 3300025919 | Ga0207657_10218018 | Ga0207657_102180182 | 231 |
| 107 | 3300025921 | Ga0207652_10231444 | Ga0207652_102314442 | 231 |
| 108 | 3300025923 | Ga0207681_10054586 | Ga0207681_100545862 | 231 |
| 109 | 3300025933 | Ga0207706_10010097 | Ga0207706_100100978 | 231 |
| 110 | 3300025972 | Ga0207668_10022023 | Ga0207668_100220232 | 231 |
| 111 | 3300026067 | Ga0207678_10349626 | Ga0207678_103496262 | 231 |
| 112 | 3300026075 | Ga0207708_10159685 | Ga0207708_101596852 | 231 |
| 113 | 3300026095 | Ga0207676_10164863 | Ga0207676_101648632 | 231 |
| 114 | 3300026118 | Ga0207675_100046089 | Ga0207675_1000460894 | 231 |
| 115 | 3300026121 | Ga0207683_10467184 | Ga0207683_104671842 | 231 |
| 116 | 3300027907 | Ga0207428_10070656 | Ga0207428_100706563 | 231 |
| 117 | 3300028380 | Ga0268265_10001867 | Ga0268265_1000186714 | 231 |
| 118 | 3300031250 | Ga0265331_10021786 | Ga0265331_100217862 | 231 |
| 119 | 3300031712 | Ga0265342_10113422 | Ga0265342_101134222 | 231 |
| 120 | 3300032005 | Ga0307411_10522313 | Ga0307411_105223132 | 231 |
| 121 | 3300048088 | Ga0495602_0142475 | Ga0495602_0142475_751_1485 | 231 |
| 122 | 3300049570 | Ga0501033_0046837 | Ga0501033_0046837_2356_3105 | 231 |
| 123 | 3300049572 | Ga0501036_0298441 | Ga0501036_0298441_391_1140 | 231 |
| 124 | 3300049580 | Ga0501046_0063072 | Ga0501046_0063072_339_1073 | 231 |
| 125 | 3300049581 | Ga0501047_0000618 | Ga0501047_0000618_10665_11399 | 231 |
| 126 | 3300049581 | Ga0501047_0075687 | Ga0501047_0075687_325_1074 | 231 |
| 127 | 3300049582 | Ga0501048_0077144 | Ga0501048_0077144_1407_2156 | 231 |
| 128 | 3300049589 | Ga0501073_0074078 | Ga0501073_0074078_738_1472 | 231 |
| 129 | 3300049823 | Ga0501044_0032978 | Ga0501044_0032978_2792_3526 | 231 |
| 130 | 3300049823 | Ga0501044_0456593 | Ga0501044_0456593_175_924 | 231 |
| 131 | 3300050510 | nmdc:mga06r32_111861_c1 | nmdc:mga06r32_111861_c1_1587_2333 | 231 |
| 132 | 3300050511 | nmdc:mga08y16_123023_c1 | nmdc:mga08y16_123023_c1_326_1072 | 231 |
| 133 | 3300005341 | Ga0070691_10000119 | Ga0070691_100001198 | 232 |
| 134 | 3300005345 | Ga0070692_10079488 | Ga0070692_100794882 | 232 |
| 135 | 3300005434 | Ga0070709_10092457 | Ga0070709_100924572 | 232 |
| 136 | 3300005436 | Ga0070713_100034919 | Ga0070713_1000349192 | 232 |
| 137 | 3300005545 | Ga0070695_100027998 | Ga0070695_1000279982 | 232 |
| 138 | 3300005564 | Ga0070664_100238064 | Ga0070664_1002380642 | 232 |
| 139 | 3300005577 | Ga0068857_100000836 | Ga0068857_1000008365 | 232 |
| 140 | 3300005578 | Ga0068854_100104576 | Ga0068854_1001045762 | 232 |
| 141 | 3300005614 | Ga0068856_100004043 | Ga0068856_1000040437 | 232 |
| 142 | 3300006871 | Ga0075434_100033051 | Ga0075434_1000330514 | 232 |
| 143 | 3300006914 | Ga0075436_100029672 | Ga0075436_1000296723 | 232 |
| 144 | 3300009093 | Ga0105240_10002206 | Ga0105240_1000220616 | 232 |
| 145 | 3300009174 | Ga0105241_10016150 | Ga0105241_100161502 | 232 |
| 146 | 3300009545 | Ga0105237_10002725 | Ga0105237_100027259 | 232 |
| 147 | 3300009551 | Ga0105238_10000461 | Ga0105238_1000046117 | 232 |
| 148 | 3300010375 | Ga0105239_10152220 | Ga0105239_101522202 | 232 |
| 149 | 3300013100 | Ga0157373_10003066 | Ga0157373_100030665 | 232 |
| 150 | 3300013104 | Ga0157370_10006819 | Ga0157370_100068195 | 232 |
| 151 | 3300013105 | Ga0157369_10005690 | Ga0157369_100056907 | 232 |
| 152 | 3300013296 | Ga0157374_10074134 | Ga0157374_100741342 | 232 |
| 153 | 3300014968 | Ga0157379_10017027 | Ga0157379_100170274 | 232 |
| 154 | 3300025906 | Ga0207699_10103833 | Ga0207699_101038332 | 232 |
| 155 | 3300025911 | Ga0207654_10030759 | Ga0207654_100307592 | 232 |
| 156 | 3300025913 | Ga0207695_10034537 | Ga0207695_100345372 | 232 |
| 157 | 3300025914 | Ga0207671_10165061 | Ga0207671_101650612 | 232 |
| 158 | 3300025924 | Ga0207694_10295280 | Ga0207694_102952802 | 232 |
| 159 | 3300025949 | Ga0207667_10029961 | Ga0207667_100299612 | 232 |
| 160 | 3300026078 | Ga0207702_10049989 | Ga0207702_100499892 | 232 |
| 161 | 3300026116 | Ga0207674_10000026 | Ga0207674_10000026121 | 232 |
| 162 | 3300028379 | Ga0268266_10451342 | Ga0268266_104513422 | 232 |
| 163 | 3300035724 | Ga0373933_0051341 | Ga0373933_0051341_147_881 | 232 |
| 164 | 3300036401 | Ga0373937_0208674 | Ga0373937_0208674_545_1279 | 232 |
| 165 | 3300049578 | Ga0501042_0381242 | Ga0501042_0381242_106_843 | 232 |
| 166 | 3300049571 | Ga0501034_0023505 | Ga0501034_0023505_5367_6101 | 233 |
| 167 | 3300005455 | Ga0070663_100549712 | Ga0070663_1005497122 | 234 |
| 168 | 3300013308 | Ga0157375_10032542 | Ga0157375_100325422 | 235 |
| 169 | 3300005336 | Ga0070680_100065109 | Ga0070680_1000651094 | 236 |
| 170 | 3300005458 | Ga0070681_10142044 | Ga0070681_101420442 | 236 |
| 171 | 3300005530 | Ga0070679_100290487 | Ga0070679_1002904872 | 236 |
| 172 | 3300025912 | Ga0207707_10000094 | Ga0207707_1000009468 | 236 |
| 173 | 3300025914 | Ga0207671_10217537 | Ga0207671_102175372 | 236 |
| 174 | 3300025917 | Ga0207660_10056250 | Ga0207660_100562502 | 236 |
| 175 | 3300025919 | Ga0207657_10114611 | Ga0207657_101146112 | 236 |
| 176 | 3300025921 | Ga0207652_10003121 | Ga0207652_100031215 | 236 |
| 177 | 3300025924 | Ga0207694_10011442 | Ga0207694_100114423 | 236 |
| 178 | 3300025949 | Ga0207667_10103023 | Ga0207667_101030233 | 236 |
| 179 | 3300025981 | Ga0207640_10136532 | Ga0207640_101365322 | 236 |
| 180 | 3300044656 | Ga0466969_0039567 | Ga0466969_0039567_1053_1787 | 236 |
| 181 | 3300053092 | Ga0500583_0022380 | Ga0500583_0022380_819_1553 | 236 |
| 182 | 3300053104 | Ga0500556_0068801 | Ga0500556_0068801_173_907 | 236 |
| 183 | 3300053124 | Ga0500617_005236 | Ga0500617_005236_1134_1868 | 236 |
| 184 | 3300053134 | Ga0500658_0034738 | Ga0500658_0034738_257_991 | 236 |
| 185 | 3300053146 | Ga0500588_0008613 | Ga0500588_0008613_197_931 | 236 |
| 186 | 3300046660 | Ga0495625_0124535 | Ga0495625_0124535_654_1400 | 237 |
| 187 | 3300031727 | Ga0316576_10108570 | Ga0316576_101085703 | 238 |
| 188 | 3300035398 | Ga0316574_0250414 | Ga0316574_0250414_54_788 | 238 |
| 189 | 3300025906 | Ga0207699_10232692 | Ga0207699_102326922 | 239 |
| 190 | iso_pu_bacteria | 2808606373 | 2808904865 | 239 |
| 191 | 3300050509 | nmdc:mga0qj67_239275_c1 | nmdc:mga0qj67_239275_c1_504_1238 | 240 |
| 192 | iso_pu_bacteria | 2808606379 | 2808939487 | 240 |
| 193 | 3300005563 | Ga0068855_100588233 | Ga0068855_1005882332 | 241 |
| 194 | 3300009093 | Ga0105240_10099290 | Ga0105240_100992902 | 241 |
| 195 | 3300009093 | Ga0105240_10099462 | Ga0105240_100994624 | 241 |
| 196 | 3300009545 | Ga0105237_10196296 | Ga0105237_101962962 | 241 |
| 197 | 3300009551 | Ga0105238_10058599 | Ga0105238_100585995 | 241 |
| 198 | 3300013104 | Ga0157370_10044127 | Ga0157370_100441275 | 241 |
| 199 | 3300013307 | Ga0157372_10091442 | Ga0157372_100914423 | 241 |
| 200 | 3300025912 | Ga0207707_10066336 | Ga0207707_100663362 | 241 |
| 201 | 3300025913 | Ga0207695_10085650 | Ga0207695_100856504 | 241 |
| 202 | 3300049823 | Ga0501044_0470633 | Ga0501044_0470633_212_937 | 241 |
| 203 | 3300005530 | Ga0070679_100011761 | Ga0070679_1000117618 | 242 |
| 204 | 3300025921 | Ga0207652_10038059 | Ga0207652_100380595 | 242 |
| 205 | 3300005290 | Ga0065712_10208499 | Ga0065712_102084992 | 243 |
| 206 | 3300005435 | Ga0070714_100060690 | Ga0070714_1000606902 | 243 |
| 207 | 3300005458 | Ga0070681_10062197 | Ga0070681_100621973 | 243 |
| 208 | 3300005518 | Ga0070699_100112466 | Ga0070699_1001124662 | 243 |
| 209 | 3300005530 | Ga0070679_100146197 | Ga0070679_1001461972 | 243 |
| 210 | 3300005545 | Ga0070695_100006694 | Ga0070695_1000066947 | 243 |
| 211 | 3300006844 | Ga0075428_100307598 | Ga0075428_1003075982 | 243 |
| 212 | 3300007265 | Ga0099794_10010013 | Ga0099794_100100132 | 243 |
| 213 | 3300010159 | Ga0099796_10002198 | Ga0099796_100021983 | 243 |
| 214 | 3300025912 | Ga0207707_10018500 | Ga0207707_100185003 | 243 |
| 215 | 3300025916 | Ga0207663_10269537 | Ga0207663_102695371 | 243 |
| 216 | 3300025921 | Ga0207652_10119697 | Ga0207652_101196972 | 243 |
| 217 | 3300042000 | Ga0439437_001170 | Ga0439437_001170_122_853 | 243 |
| 218 | 3300042012 | Ga0439455_0028446 | Ga0439455_0028446_388_1119 | 243 |
| 219 | 3300042115 | Ga0450911_000008 | Ga0450911_000008_138708_139439 | 243 |
| 220 | 3300042137 | Ga0450902_032557 | Ga0450902_032557_60_791 | 243 |
| 221 | 3300042139 | Ga0450904_000004 | Ga0450904_000004_2502_3233 | 243 |
| 222 | 3300042156 | Ga0439446_0012537 | Ga0439446_0012537_184_915 | 243 |
| 223 | 3300042438 | Ga0439459_0024299 | Ga0439459_0024299_69_800 | 243 |
| 224 | 3300042532 | Ga0450893_0000346 | Ga0450893_0000346_1108_1839 | 243 |
| 225 | 3300046692 | Ga0495671_0026581 | Ga0495671_0026581_1793_2536 | 243 |
| 226 | 3300049853 | Ga0501226_000005 | Ga0501226_000005_142824_143555 | 243 |
| 227 | 3300053124 | Ga0500617_059969 | Ga0500617_059969_827_1558 | 243 |
| 228 | 3300053146 | Ga0500588_0004209 | Ga0500588_0004209_2012_2743 | 243 |
| 229 | 3300003316 | rootH1_10063715 | rootH1_100637156 | 244 |
| 230 | 3300003320 | rootH2_10014765 | rootH2_100147652 | 244 |
| 231 | 3300003322 | rootL2_10154988 | rootL2_101549882 | 244 |
| 232 | 3300005293 | Ga0065715_10146578 | Ga0065715_101465782 | 244 |
| 233 | 3300005295 | Ga0065707_10187323 | Ga0065707_101873232 | 244 |
| 234 | 3300005327 | Ga0070658_10039060 | Ga0070658_100390604 | 244 |
| 235 | 3300005327 | Ga0070658_10149939 | Ga0070658_101499391 | 244 |
| 236 | 3300005330 | Ga0070690_100021236 | Ga0070690_1000212362 | 244 |
| 237 | 3300005331 | Ga0070670_100018560 | Ga0070670_1000185605 | 244 |
| 238 | 3300005331 | Ga0070670_100061369 | Ga0070670_1000613693 | 244 |
| 239 | 3300005334 | Ga0068869_100092396 | Ga0068869_1000923961 | 244 |
| 240 | 3300005335 | Ga0070666_10019045 | Ga0070666_100190454 | 244 |
| 241 | 3300005335 | Ga0070666_10038837 | Ga0070666_100388372 | 244 |
| 242 | 3300005335 | Ga0070666_10044901 | Ga0070666_100449012 | 244 |
| 243 | 3300005336 | Ga0070680_100039466 | Ga0070680_1000394662 | 244 |
| 244 | 3300005336 | Ga0070680_100425877 | Ga0070680_1004258772 | 244 |
| 245 | 3300005337 | Ga0070682_100050639 | Ga0070682_1000506392 | 244 |
| 246 | 3300005339 | Ga0070660_100003339 | Ga0070660_1000033399 | 244 |
| 247 | 3300005341 | Ga0070691_10001304 | Ga0070691_100013042 | 244 |
| 248 | 3300005343 | Ga0070687_100002796 | Ga0070687_1000027965 | 244 |
| 249 | 3300005344 | Ga0070661_100006893 | Ga0070661_1000068934 | 244 |
| 250 | 3300005347 | Ga0070668_100148690 | Ga0070668_1001486902 | 244 |
| 251 | 3300005354 | Ga0070675_100002577 | Ga0070675_1000025776 | 244 |
| 252 | 3300005355 | Ga0070671_100000891 | Ga0070671_10000089112 | 244 |
| 253 | 3300005355 | Ga0070671_100068719 | Ga0070671_1000687192 | 244 |
| 254 | 3300005355 | Ga0070671_100148038 | Ga0070671_1001480382 | 244 |
| 255 | 3300005356 | Ga0070674_100027736 | Ga0070674_1000277363 | 244 |
| 256 | 3300005356 | Ga0070674_100305969 | Ga0070674_1003059691 | 244 |
| 257 | 3300005364 | Ga0070673_100000445 | Ga0070673_1000004453 | 244 |
| 258 | 3300005364 | Ga0070673_100308371 | Ga0070673_1003083712 | 244 |
| 259 | 3300005365 | Ga0070688_100002973 | Ga0070688_1000029732 | 244 |
| 260 | 3300005366 | Ga0070659_100018792 | Ga0070659_1000187924 | 244 |
| 261 | 3300005367 | Ga0070667_100002761 | Ga0070667_10000276110 | 244 |
| 262 | 3300005367 | Ga0070667_100081782 | Ga0070667_1000817822 | 244 |
| 263 | 3300005367 | Ga0070667_100089774 | Ga0070667_1000897742 | 244 |
| 264 | 3300005367 | Ga0070667_100300210 | Ga0070667_1003002102 | 244 |
| 265 | 3300005367 | Ga0070667_100405690 | Ga0070667_1004056902 | 244 |
| 266 | 3300005434 | Ga0070709_10150510 | Ga0070709_101505102 | 244 |
| 267 | 3300005435 | Ga0070714_100001876 | Ga0070714_1000018763 | 244 |
| 268 | 3300005435 | Ga0070714_100536205 | Ga0070714_1005362052 | 244 |
| 269 | 3300005436 | Ga0070713_100168600 | Ga0070713_1001686002 | 244 |
| 270 | 3300005438 | Ga0070701_10067762 | Ga0070701_100677622 | 244 |
| 271 | 3300005439 | Ga0070711_100075513 | Ga0070711_1000755132 | 244 |
| 272 | 3300005455 | Ga0070663_100084100 | Ga0070663_1000841002 | 244 |
| 273 | 3300005456 | Ga0070678_100039011 | Ga0070678_1000390114 | 244 |
| 274 | 3300005456 | Ga0070678_100080711 | Ga0070678_1000807112 | 244 |
| 275 | 3300005457 | Ga0070662_100066899 | Ga0070662_1000668993 | 244 |
| 276 | 3300005458 | Ga0070681_10042175 | Ga0070681_100421752 | 244 |
| 277 | 3300005458 | Ga0070681_10327918 | Ga0070681_103279181 | 244 |
| 278 | 3300005459 | Ga0068867_100211038 | Ga0068867_1002110382 | 244 |
| 279 | 3300005459 | Ga0068867_100323836 | Ga0068867_1003238362 | 244 |
| 280 | 3300005466 | Ga0070685_10018483 | Ga0070685_100184832 | 244 |
| 281 | 3300005530 | Ga0070679_100178214 | Ga0070679_1001782142 | 244 |
| 282 | 3300005535 | Ga0070684_100017546 | Ga0070684_1000175464 | 244 |
| 283 | 3300005539 | Ga0068853_100356014 | Ga0068853_1003560141 | 244 |
| 284 | 3300005539 | Ga0068853_100356844 | Ga0068853_1003568442 | 244 |
| 285 | 3300005543 | Ga0070672_100045680 | Ga0070672_1000456801 | 244 |
| 286 | 3300005543 | Ga0070672_100820945 | Ga0070672_1008209451 | 244 |
| 287 | 3300005544 | Ga0070686_100048477 | Ga0070686_1000484772 | 244 |
| 288 | 3300005544 | Ga0070686_100147087 | Ga0070686_1001470872 | 244 |
| 289 | 3300005548 | Ga0070665_100010311 | Ga0070665_1000103115 | 244 |
| 290 | 3300005548 | Ga0070665_100012783 | Ga0070665_1000127839 | 244 |
| 291 | 3300005548 | Ga0070665_100014489 | Ga0070665_1000144896 | 244 |
| 292 | 3300005548 | Ga0070665_100019765 | Ga0070665_1000197655 | 244 |
| 293 | 3300005548 | Ga0070665_100033526 | Ga0070665_1000335262 | 244 |
| 294 | 3300005548 | Ga0070665_100056141 | Ga0070665_1000561413 | 244 |
| 295 | 3300005548 | Ga0070665_100105036 | Ga0070665_1001050362 | 244 |
| 296 | 3300005549 | Ga0070704_100564881 | Ga0070704_1005648811 | 244 |
| 297 | 3300005563 | Ga0068855_100001501 | Ga0068855_1000015018 | 244 |
| 298 | 3300005563 | Ga0068855_100002250 | Ga0068855_10000225018 | 244 |
| 299 | 3300005563 | Ga0068855_100110676 | Ga0068855_1001106762 | 244 |
| 300 | 3300005563 | Ga0068855_100381880 | Ga0068855_1003818802 | 244 |
| 301 | 3300005564 | Ga0070664_100000661 | Ga0070664_10000066117 | 244 |
| 302 | 3300005577 | Ga0068857_100035280 | Ga0068857_1000352802 | 244 |
| 303 | 3300005578 | Ga0068854_100177284 | Ga0068854_1001772842 | 244 |
| 304 | 3300005614 | Ga0068856_100008954 | Ga0068856_1000089546 | 244 |
| 305 | 3300005614 | Ga0068856_100184039 | Ga0068856_1001840392 | 244 |
| 306 | 3300005614 | Ga0068856_100565361 | Ga0068856_1005653612 | 244 |
| 307 | 3300005615 | Ga0070702_100022138 | Ga0070702_1000221382 | 244 |
| 308 | 3300005617 | Ga0068859_100005026 | Ga0068859_1000050269 | 244 |
| 309 | 3300005617 | Ga0068859_100034295 | Ga0068859_1000342951 | 244 |
| 310 | 3300005617 | Ga0068859_100035905 | Ga0068859_1000359053 | 244 |
| 311 | 3300005617 | Ga0068859_100488510 | Ga0068859_1004885102 | 244 |
| 312 | 3300005618 | Ga0068864_100003379 | Ga0068864_10000337913 | 244 |
| 313 | 3300005719 | Ga0068861_100003461 | Ga0068861_10000346110 | 244 |
| 314 | 3300005719 | Ga0068861_100004925 | Ga0068861_10000492510 | 244 |
| 315 | 3300005719 | Ga0068861_100242702 | Ga0068861_1002427022 | 244 |
| 316 | 3300005841 | Ga0068863_100000741 | Ga0068863_1000007412 | 244 |
| 317 | 3300005841 | Ga0068863_100000781 | Ga0068863_1000007815 | 244 |
| 318 | 3300005841 | Ga0068863_100035610 | Ga0068863_1000356104 | 244 |
| 319 | 3300005842 | Ga0068858_100003988 | Ga0068858_1000039889 | 244 |
| 320 | 3300005842 | Ga0068858_100011296 | Ga0068858_1000112966 | 244 |
| 321 | 3300005842 | Ga0068858_100044466 | Ga0068858_1000444662 | 244 |
| 322 | 3300005842 | Ga0068858_100227728 | Ga0068858_1002277282 | 244 |
| 323 | 3300005842 | Ga0068858_100354326 | Ga0068858_1003543262 | 244 |
| 324 | 3300005842 | Ga0068858_100500430 | Ga0068858_1005004301 | 244 |
| 325 | 3300005843 | Ga0068860_100002939 | Ga0068860_10000293912 | 244 |
| 326 | 3300005843 | Ga0068860_100017032 | Ga0068860_1000170323 | 244 |
| 327 | 3300005843 | Ga0068860_100355087 | Ga0068860_1003550872 | 244 |
| 328 | 3300005844 | Ga0068862_100052283 | Ga0068862_1000522832 | 244 |
| 329 | 3300005844 | Ga0068862_100276834 | Ga0068862_1002768342 | 244 |
| 330 | 3300005985 | Ga0081539_10000123 | Ga0081539_10000123121 | 244 |
| 331 | 3300006028 | Ga0070717_10004672 | Ga0070717_100046727 | 244 |
| 332 | 3300006173 | Ga0070716_100038995 | Ga0070716_1000389952 | 244 |
| 333 | 3300006175 | Ga0070712_100433241 | Ga0070712_1004332412 | 244 |
| 334 | 3300006237 | Ga0097621_100034303 | Ga0097621_1000343032 | 244 |
| 335 | 3300006358 | Ga0068871_100093094 | Ga0068871_1000930942 | 244 |
| 336 | 3300006358 | Ga0068871_100337226 | Ga0068871_1003372262 | 244 |
| 337 | 3300006844 | Ga0075428_100011010 | Ga0075428_1000110107 | 244 |
| 338 | 3300006844 | Ga0075428_100269154 | Ga0075428_1002691542 | 244 |
| 339 | 3300006846 | Ga0075430_100001590 | Ga0075430_1000015908 | 244 |
| 340 | 3300006846 | Ga0075430_100030395 | Ga0075430_1000303954 | 244 |
| 341 | 3300006846 | Ga0075430_100064703 | Ga0075430_1000647033 | 244 |
| 342 | 3300006846 | Ga0075430_100089766 | Ga0075430_1000897662 | 244 |
| 343 | 3300006846 | Ga0075430_100123739 | Ga0075430_1001237392 | 244 |
| 344 | 3300006846 | Ga0075430_100628627 | Ga0075430_1006286272 | 244 |
| 345 | 3300006847 | Ga0075431_100001092 | Ga0075431_1000010928 | 244 |
| 346 | 3300006847 | Ga0075431_100328334 | Ga0075431_1003283342 | 244 |
| 347 | 3300006847 | Ga0075431_100354503 | Ga0075431_1003545032 | 244 |
| 348 | 3300006852 | Ga0075433_10232829 | Ga0075433_102328292 | 244 |
| 349 | 3300006871 | Ga0075434_100530756 | Ga0075434_1005307562 | 244 |
| 350 | 3300006880 | Ga0075429_100000286 | Ga0075429_10000028619 | 244 |
| 351 | 3300006881 | Ga0068865_100137397 | Ga0068865_1001373972 | 244 |
| 352 | 3300006914 | Ga0075436_100189269 | Ga0075436_1001892692 | 244 |
| 353 | 3300006931 | Ga0097620_100005026 | Ga0097620_1000050269 | 244 |
| 354 | 3300006931 | Ga0097620_100034299 | Ga0097620_1000342991 | 244 |
| 355 | 3300006931 | Ga0097620_100035904 | Ga0097620_1000359043 | 244 |
| 356 | 3300006931 | Ga0097620_100488520 | Ga0097620_1004885201 | 244 |
| 357 | 3300009093 | Ga0105240_10003739 | Ga0105240_100037398 | 244 |
| 358 | 3300009093 | Ga0105240_10010425 | Ga0105240_100104258 | 244 |
| 359 | 3300009093 | Ga0105240_10012887 | Ga0105240_1001288711 | 244 |
| 360 | 3300009093 | Ga0105240_10036236 | Ga0105240_100362365 | 244 |
| 361 | 3300009093 | Ga0105240_10101015 | Ga0105240_101010152 | 244 |
| 362 | 3300009093 | Ga0105240_10115948 | Ga0105240_101159482 | 244 |
| 363 | 3300009093 | Ga0105240_10261817 | Ga0105240_102618172 | 244 |
| 364 | 3300009093 | Ga0105240_10353810 | Ga0105240_103538102 | 244 |
| 365 | 3300009093 | Ga0105240_10612283 | Ga0105240_106122831 | 244 |
| 366 | 3300009098 | Ga0105245_10732330 | Ga0105245_107323302 | 244 |
| 367 | 3300009101 | Ga0105247_10000647 | Ga0105247_1000064718 | 244 |
| 368 | 3300009101 | Ga0105247_10080790 | Ga0105247_100807902 | 244 |
| 369 | 3300009101 | Ga0105247_10343576 | Ga0105247_103435761 | 244 |
| 370 | 3300009147 | Ga0114129_10002253 | Ga0114129_1000225318 | 244 |
| 371 | 3300009176 | Ga0105242_10089934 | Ga0105242_100899342 | 244 |
| 372 | 3300009176 | Ga0105242_10690215 | Ga0105242_106902152 | 244 |
| 373 | 3300009177 | Ga0105248_10005642 | Ga0105248_100056425 | 244 |
| 374 | 3300009177 | Ga0105248_10276665 | Ga0105248_102766651 | 244 |
| 375 | 3300009545 | Ga0105237_10066395 | Ga0105237_100663953 | 244 |
| 376 | 3300009545 | Ga0105237_10449591 | Ga0105237_104495912 | 244 |
| 377 | 3300009545 | Ga0105237_10611015 | Ga0105237_106110151 | 244 |
| 378 | 3300009551 | Ga0105238_10040400 | Ga0105238_100404003 | 244 |
| 379 | 3300009551 | Ga0105238_10050294 | Ga0105238_100502942 | 244 |
| 380 | 3300009551 | Ga0105238_10087038 | Ga0105238_100870382 | 244 |
| 381 | 3300009551 | Ga0105238_10155360 | Ga0105238_101553602 | 244 |
| 382 | 3300009551 | Ga0105238_10289440 | Ga0105238_102894402 | 244 |
| 383 | 3300009553 | Ga0105249_10009919 | Ga0105249_100099194 | 244 |
| 384 | 3300009553 | Ga0105249_10020093 | Ga0105249_100200934 | 244 |
| 385 | 3300009553 | Ga0105249_10025047 | Ga0105249_100250474 | 244 |
| 386 | 3300009553 | Ga0105249_10035160 | Ga0105249_100351602 | 244 |
| 387 | 3300009553 | Ga0105249_10514829 | Ga0105249_105148292 | 244 |
| 388 | 3300010375 | Ga0105239_10022924 | Ga0105239_100229247 | 244 |
| 389 | 3300010375 | Ga0105239_10447548 | Ga0105239_104475481 | 244 |
| 390 | 3300010375 | Ga0105239_10543619 | Ga0105239_105436192 | 244 |
| 391 | 3300013104 | Ga0157370_10037443 | Ga0157370_100374432 | 244 |
| 392 | 3300013105 | Ga0157369_10314084 | Ga0157369_103140842 | 244 |
| 393 | 3300013296 | Ga0157374_10034539 | Ga0157374_100345393 | 244 |
| 394 | 3300013296 | Ga0157374_10169643 | Ga0157374_101696432 | 244 |
| 395 | 3300013296 | Ga0157374_10494389 | Ga0157374_104943892 | 244 |
| 396 | 3300013306 | Ga0163162_10068152 | Ga0163162_100681523 | 244 |
| 397 | 3300013306 | Ga0163162_10165803 | Ga0163162_101658032 | 244 |
| 398 | 3300013307 | Ga0157372_10025789 | Ga0157372_100257896 | 244 |
| 399 | 3300013308 | Ga0157375_10072895 | Ga0157375_100728952 | 244 |
| 400 | 3300014325 | Ga0163163_10000224 | Ga0163163_1000022427 | 244 |
| 401 | 3300014325 | Ga0163163_10060146 | Ga0163163_100601463 | 244 |
| 402 | 3300014325 | Ga0163163_10388959 | Ga0163163_103889592 | 244 |
| 403 | 3300014326 | Ga0157380_10009519 | Ga0157380_100095195 | 244 |
| 404 | 3300014745 | Ga0157377_10029000 | Ga0157377_100290003 | 244 |
| 405 | 3300014968 | Ga0157379_10008268 | Ga0157379_100082683 | 244 |
| 406 | 3300014968 | Ga0157379_10760097 | Ga0157379_107600972 | 244 |
| 407 | 3300014969 | Ga0157376_10245155 | Ga0157376_102451552 | 244 |
| 408 | 3300021377 | Ga0213874_10016451 | Ga0213874_100164512 | 244 |
| 409 | 3300021377 | Ga0213874_10031242 | Ga0213874_100312422 | 244 |
| 410 | 3300025899 | Ga0207642_10059297 | Ga0207642_100592972 | 244 |
| 411 | 3300025900 | Ga0207710_10000933 | Ga0207710_100009335 | 244 |
| 412 | 3300025900 | Ga0207710_10217357 | Ga0207710_102173571 | 244 |
| 413 | 3300025901 | Ga0207688_10067867 | Ga0207688_100678672 | 244 |
| 414 | 3300025903 | Ga0207680_10071994 | Ga0207680_100719942 | 244 |
| 415 | 3300025903 | Ga0207680_10088588 | Ga0207680_100885882 | 244 |
| 416 | 3300025906 | Ga0207699_10019784 | Ga0207699_100197843 | 244 |
| 417 | 3300025909 | Ga0207705_10000418 | Ga0207705_1000041816 | 244 |
| 418 | 3300025912 | Ga0207707_10003808 | Ga0207707_1000380812 | 244 |
| 419 | 3300025913 | Ga0207695_10030245 | Ga0207695_100302455 | 244 |
| 420 | 3300025913 | Ga0207695_10033954 | Ga0207695_100339542 | 244 |
| 421 | 3300025913 | Ga0207695_10042966 | Ga0207695_100429663 | 244 |
| 422 | 3300025913 | Ga0207695_10065688 | Ga0207695_100656883 | 244 |
| 423 | 3300025913 | Ga0207695_10081742 | Ga0207695_100817422 | 244 |
| 424 | 3300025913 | Ga0207695_10135105 | Ga0207695_101351052 | 244 |
| 425 | 3300025913 | Ga0207695_10186234 | Ga0207695_101862342 | 244 |
| 426 | 3300025913 | Ga0207695_10189005 | Ga0207695_101890052 | 244 |
| 427 | 3300025914 | Ga0207671_10038756 | Ga0207671_100387563 | 244 |
| 428 | 3300025914 | Ga0207671_10060225 | Ga0207671_100602252 | 244 |
| 429 | 3300025914 | Ga0207671_10579844 | Ga0207671_105798441 | 244 |
| 430 | 3300025915 | Ga0207693_10020163 | Ga0207693_100201636 | 244 |
| 431 | 3300025916 | Ga0207663_10059044 | Ga0207663_100590442 | 244 |
| 432 | 3300025917 | Ga0207660_10003683 | Ga0207660_1000368310 | 244 |
| 433 | 3300025917 | Ga0207660_10503604 | Ga0207660_105036042 | 244 |
| 434 | 3300025918 | Ga0207662_10005619 | Ga0207662_100056195 | 244 |
| 435 | 3300025919 | Ga0207657_10004952 | Ga0207657_100049525 | 244 |
| 436 | 3300025920 | Ga0207649_10080241 | Ga0207649_100802412 | 244 |
| 437 | 3300025921 | Ga0207652_10011314 | Ga0207652_100113144 | 244 |
| 438 | 3300025921 | Ga0207652_10294565 | Ga0207652_102945652 | 244 |
| 439 | 3300025924 | Ga0207694_10057032 | Ga0207694_100570324 | 244 |
| 440 | 3300025924 | Ga0207694_10247688 | Ga0207694_102476882 | 244 |
| 441 | 3300025924 | Ga0207694_10529201 | Ga0207694_105292012 | 244 |
| 442 | 3300025925 | Ga0207650_10049485 | Ga0207650_100494854 | 244 |
| 443 | 3300025926 | Ga0207659_10032545 | Ga0207659_100325452 | 244 |
| 444 | 3300025926 | Ga0207659_10319133 | Ga0207659_103191332 | 244 |
| 445 | 3300025928 | Ga0207700_10030158 | Ga0207700_100301583 | 244 |
| 446 | 3300025928 | Ga0207700_10363340 | Ga0207700_103633402 | 244 |
| 447 | 3300025929 | Ga0207664_10058745 | Ga0207664_100587453 | 244 |
| 448 | 3300025929 | Ga0207664_10087010 | Ga0207664_100870102 | 244 |
| 449 | 3300025931 | Ga0207644_10038265 | Ga0207644_100382654 | 244 |
| 450 | 3300025931 | Ga0207644_10197769 | Ga0207644_101977692 | 244 |
| 451 | 3300025932 | Ga0207690_10019811 | Ga0207690_100198113 | 244 |
| 452 | 3300025933 | Ga0207706_10028926 | Ga0207706_100289265 | 244 |
| 453 | 3300025934 | Ga0207686_10147679 | Ga0207686_101476792 | 244 |
| 454 | 3300025939 | Ga0207665_10055300 | Ga0207665_100553002 | 244 |
| 455 | 3300025939 | Ga0207665_10140055 | Ga0207665_101400552 | 244 |
| 456 | 3300025940 | Ga0207691_10027055 | Ga0207691_100270553 | 244 |
| 457 | 3300025940 | Ga0207691_10221902 | Ga0207691_102219021 | 244 |
| 458 | 3300025942 | Ga0207689_10107137 | Ga0207689_101071372 | 244 |
| 459 | 3300025944 | Ga0207661_10121207 | Ga0207661_101212072 | 244 |
| 460 | 3300025944 | Ga0207661_10188121 | Ga0207661_101881212 | 244 |
| 461 | 3300025945 | Ga0207679_10006329 | Ga0207679_100063292 | 244 |
| 462 | 3300025949 | Ga0207667_10001596 | Ga0207667_1000159610 | 244 |
| 463 | 3300025949 | Ga0207667_10003668 | Ga0207667_100036684 | 244 |
| 464 | 3300025960 | Ga0207651_10004330 | Ga0207651_100043304 | 244 |
| 465 | 3300025961 | Ga0207712_10007064 | Ga0207712_100070643 | 244 |
| 466 | 3300025961 | Ga0207712_10017096 | Ga0207712_100170963 | 244 |
| 467 | 3300025961 | Ga0207712_10042910 | Ga0207712_100429103 | 244 |
| 468 | 3300025972 | Ga0207668_10065206 | Ga0207668_100652063 | 244 |
| 469 | 3300025986 | Ga0207658_10004874 | Ga0207658_100048743 | 244 |
| 470 | 3300025986 | Ga0207658_10086116 | Ga0207658_100861162 | 244 |
| 471 | 3300025986 | Ga0207658_10244985 | Ga0207658_102449852 | 244 |
| 472 | 3300026023 | Ga0207677_10131743 | Ga0207677_101317432 | 244 |
| 473 | 3300026035 | Ga0207703_10000259 | Ga0207703_1000025961 | 244 |
| 474 | 3300026035 | Ga0207703_10006874 | Ga0207703_100068745 | 244 |
| 475 | 3300026035 | Ga0207703_10297289 | Ga0207703_102972892 | 244 |
| 476 | 3300026035 | Ga0207703_10353111 | Ga0207703_103531112 | 244 |
| 477 | 3300026041 | Ga0207639_10574293 | Ga0207639_105742931 | 244 |
| 478 | 3300026067 | Ga0207678_10032626 | Ga0207678_100326263 | 244 |
| 479 | 3300026075 | Ga0207708_10024029 | Ga0207708_100240294 | 244 |
| 480 | 3300026078 | Ga0207702_10175845 | Ga0207702_101758452 | 244 |
| 481 | 3300026088 | Ga0207641_10000196 | Ga0207641_1000019651 | 244 |
| 482 | 3300026088 | Ga0207641_10002905 | Ga0207641_100029058 | 244 |
| 483 | 3300026088 | Ga0207641_10006042 | Ga0207641_100060421 | 244 |
| 484 | 3300026089 | Ga0207648_10023272 | Ga0207648_100232723 | 244 |
| 485 | 3300026089 | Ga0207648_10140388 | Ga0207648_101403881 | 244 |
| 486 | 3300026095 | Ga0207676_10010514 | Ga0207676_100105144 | 244 |
| 487 | 3300026116 | Ga0207674_10040771 | Ga0207674_100407715 | 244 |
| 488 | 3300026118 | Ga0207675_100006173 | Ga0207675_10000617310 | 244 |
| 489 | 3300026118 | Ga0207675_100038632 | Ga0207675_1000386323 | 244 |
| 490 | 3300026118 | Ga0207675_100189057 | Ga0207675_1001890572 | 244 |
| 491 | 3300026118 | Ga0207675_100541579 | Ga0207675_1005415792 | 244 |
| 492 | 3300026121 | Ga0207683_10064816 | Ga0207683_100648162 | 244 |
| 493 | 3300026142 | Ga0207698_10909913 | Ga0207698_109099132 | 244 |
| 494 | 3300027665 | Ga0209983_1005372 | Ga0209983_10053722 | 244 |
| 495 | 3300028379 | Ga0268266_10000512 | Ga0268266_1000051225 | 244 |
| 496 | 3300028379 | Ga0268266_10009688 | Ga0268266_100096889 | 244 |
| 497 | 3300028379 | Ga0268266_10010214 | Ga0268266_100102148 | 244 |
| 498 | 3300028379 | Ga0268266_10090242 | Ga0268266_100902423 | 244 |
| 499 | 3300028379 | Ga0268266_10149071 | Ga0268266_101490713 | 244 |
| 500 | 3300028380 | Ga0268265_10027901 | Ga0268265_100279012 | 244 |
| 501 | 3300028380 | Ga0268265_10037669 | Ga0268265_100376692 | 244 |
| 502 | 3300028381 | Ga0268264_10000182 | Ga0268264_1000018288 | 244 |
| 503 | 3300028381 | Ga0268264_10025318 | Ga0268264_100253184 | 244 |
| 504 | 3300028381 | Ga0268264_10648480 | Ga0268264_106484801 | 244 |
| 505 | 3300028573 | Ga0265334_10023301 | Ga0265334_100233012 | 244 |
| 506 | 3300028794 | Ga0307515_10055442 | Ga0307515_100554422 | 244 |
| 507 | 3300028800 | Ga0265338_10000017 | Ga0265338_10000017100 | 244 |
| 508 | 3300028800 | Ga0265338_10426543 | Ga0265338_104265432 | 244 |
| 509 | 3300030521 | Ga0307511_10000008 | Ga0307511_1000000836 | 244 |
| 510 | 3300031235 | Ga0265330_10010677 | Ga0265330_100106774 | 244 |
| 511 | 3300031239 | Ga0265328_10010751 | Ga0265328_100107512 | 244 |
| 512 | 3300031241 | Ga0265325_10000008 | Ga0265325_100000086 | 244 |
| 513 | 3300031242 | Ga0265329_10013556 | Ga0265329_100135562 | 244 |
| 514 | 3300031247 | Ga0265340_10000054 | Ga0265340_1000005420 | 244 |
| 515 | 3300031247 | Ga0265340_10013729 | Ga0265340_100137293 | 244 |
| 516 | 3300031249 | Ga0265339_10001599 | Ga0265339_1000159919 | 244 |
| 517 | 3300031250 | Ga0265331_10035413 | Ga0265331_100354132 | 244 |
| 518 | 3300031344 | Ga0265316_10008009 | Ga0265316_100080095 | 244 |
| 519 | 3300031344 | Ga0265316_10026388 | Ga0265316_100263884 | 244 |
| 520 | 3300031344 | Ga0265316_10321874 | Ga0265316_103218742 | 244 |
| 521 | 3300031456 | Ga0307513_10129833 | Ga0307513_101298332 | 244 |
| 522 | 3300031456 | Ga0307513_10129948 | Ga0307513_101299482 | 244 |
| 523 | 3300031507 | Ga0307509_10000099 | Ga0307509_10000099108 | 244 |
| 524 | 3300031507 | Ga0307509_10000154 | Ga0307509_1000015455 | 244 |
| 525 | 3300031548 | Ga0307408_100007916 | Ga0307408_1000079164 | 244 |
| 526 | 3300031548 | Ga0307408_100032300 | Ga0307408_1000323002 | 244 |
| 527 | 3300031548 | Ga0307408_100176127 | Ga0307408_1001761272 | 244 |
| 528 | 3300031595 | Ga0265313_10002014 | Ga0265313_1000201416 | 244 |
| 529 | 3300031595 | Ga0265313_10012307 | Ga0265313_100123072 | 244 |
| 530 | 3300031595 | Ga0265313_10107543 | Ga0265313_101075432 | 244 |
| 531 | 3300031712 | Ga0265342_10003097 | Ga0265342_100030972 | 244 |
| 532 | 3300031712 | Ga0265342_10011102 | Ga0265342_100111025 | 244 |
| 533 | 3300031824 | Ga0307413_10017158 | Ga0307413_100171583 | 244 |
| 534 | 3300031824 | Ga0307413_10526681 | Ga0307413_105266811 | 244 |
| 535 | 3300031995 | Ga0307409_100233820 | Ga0307409_1002338202 | 244 |
| 536 | 3300032002 | Ga0307416_100005410 | Ga0307416_1000054103 | 244 |
| 537 | 3300032005 | Ga0307411_10109890 | Ga0307411_101098902 | 244 |
| 538 | 3300032126 | Ga0307415_100261549 | Ga0307415_1002615492 | 244 |
| 539 | 3300033180 | Ga0307510_10000003 | Ga0307510_1000000388 | 244 |
| 540 | 3300033180 | Ga0307510_10004142 | Ga0307510_100041429 | 244 |
| 541 | 3300034819 | Ga0373958_0022342 | Ga0373958_0022342_10_744 | 244 |
| 542 | 3300035113 | Ga0373936_0029807 | Ga0373936_0029807_1148_1882 | 244 |
| 543 | 3300035114 | Ga0373939_0112563 | Ga0373939_0112563_45_779 | 244 |
| 544 | 3300035118 | Ga0373954_0136292 | Ga0373954_0136292_28_762 | 244 |
| 545 | 3300035691 | Ga0373931_0028615 | Ga0373931_0028615_238_987 | 244 |
| 546 | 3300035692 | Ga0373935_0333695 | Ga0373935_0333695_262_996 | 244 |
| 547 | 3300035724 | Ga0373933_0010033 | Ga0373933_0010033_3207_3941 | 244 |
| 548 | 3300036401 | Ga0373937_0019319 | Ga0373937_0019319_2229_2963 | 244 |
| 549 | 3300036401 | Ga0373937_0476545 | Ga0373937_0476545_424_1158 | 244 |
| 550 | 3300037471 | Ga0395905_0767652 | Ga0395905_0767652_21_755 | 244 |
| 551 | 3300039437 | Ga0436365_1473558 | Ga0436365_1473558_2445_3179 | 244 |
| 552 | 3300039438 | Ga0436360_0624728 | Ga0436360_0624728_149_883 | 244 |
| 553 | 3300039447 | Ga0436361_0132850 | Ga0436361_0132850_1074_1808 | 244 |
| 554 | 3300039450 | Ga0436363_0517558 | Ga0436363_0517558_2895_3629 | 244 |
| 555 | 3300039450 | Ga0436363_1409576 | Ga0436363_1409576_451_1185 | 244 |
| 556 | 3300039450 | Ga0436363_1476208 | Ga0436363_1476208_1234_1968 | 244 |
| 557 | 3300039453 | Ga0436362_0524883 | Ga0436362_0524883_82_816 | 244 |
| 558 | 3300041411 | Ga0439466_0024021 | Ga0439466_0024021_887_1621 | 244 |
| 559 | 3300042013 | Ga0439456_053821 | Ga0439456_053821_85_819 | 244 |
| 560 | 3300042132 | Ga0450895_002243 | Ga0450895_002243_636_1370 | 244 |
| 561 | 3300042145 | Ga0450906_027675 | Ga0450906_027675_101_835 | 244 |
| 562 | 3300042156 | Ga0439446_0000721 | Ga0439446_0000721_4752_5486 | 244 |
| 563 | 3300042436 | Ga0439435_0103729 | Ga0439435_0103729_103_837 | 244 |
| 564 | 3300042532 | Ga0450893_0026708 | Ga0450893_0026708_62_796 | 244 |
| 565 | 3300042876 | Ga0451577_0007135 | Ga0451577_0007135_6863_7597 | 244 |
| 566 | 3300042876 | Ga0451577_0311205 | Ga0451577_0311205_271_1005 | 244 |
| 567 | 3300044656 | Ga0466969_0018357 | Ga0466969_0018357_247_981 | 244 |
| 568 | 3300044656 | Ga0466969_0140916 | Ga0466969_0140916_140_874 | 244 |
| 569 | 3300045049 | Ga0466959_0040445 | Ga0466959_0040445_577_1311 | 244 |
| 570 | 3300045051 | Ga0451576_0003293 | Ga0451576_0003293_6264_7013 | 244 |
| 571 | 3300045051 | Ga0451576_0078101 | Ga0451576_0078101_2104_2838 | 244 |
| 572 | 3300046460 | Ga0495638_0001409 | Ga0495638_0001409_8129_8878 | 244 |
| 573 | 3300046460 | Ga0495638_0017538 | Ga0495638_0017538_1606_2343 | 244 |
| 574 | 3300046462 | Ga0495651_0092349 | Ga0495651_0092349_1192_1926 | 244 |
| 575 | 3300046471 | Ga0495650_0026413 | Ga0495650_0026413_1054_1788 | 244 |
| 576 | 3300046472 | Ga0495580_0419786 | Ga0495580_0419786_123_857 | 244 |
| 577 | 3300046507 | Ga0495606_0032078 | Ga0495606_0032078_2887_3621 | 244 |
| 578 | 3300046543 | Ga0495645_0265094 | Ga0495645_0265094_88_822 | 244 |
| 579 | 3300046660 | Ga0495625_0079278 | Ga0495625_0079278_644_1393 | 244 |
| 580 | 3300046664 | Ga0495659_0073761 | Ga0495659_0073761_382_1116 | 244 |
| 581 | 3300046679 | Ga0495623_0027113 | Ga0495623_0027113_849_1583 | 244 |
| 582 | 3300046694 | Ga0495649_0117893 | Ga0495649_0117893_256_990 | 244 |
| 583 | 3300047317 | Ga0495604_0243713 | Ga0495604_0243713_22_756 | 244 |
| 584 | 3300047320 | Ga0495672_0008659 | Ga0495672_0008659_4578_5312 | 244 |
| 585 | 3300047320 | Ga0495672_0018987 | Ga0495672_0018987_3177_3914 | 244 |
| 586 | 3300047320 | Ga0495672_0094644 | Ga0495672_0094644_612_1346 | 244 |
| 587 | 3300047443 | Ga0495687_082743 | Ga0495687_082743_310_1044 | 244 |
| 588 | 3300047444 | Ga0495675_0099446 | Ga0495675_0099446_516_1250 | 244 |
| 589 | 3300048903 | Ga0496100_0232163 | Ga0496100_0232163_58_792 | 244 |
| 590 | 3300048904 | Ga0496101_0163715 | Ga0496101_0163715_59_793 | 244 |
| 591 | 3300048905 | Ga0496102_0004416 | Ga0496102_0004416_1897_2631 | 244 |
| 592 | 3300048905 | Ga0496102_0014849 | Ga0496102_0014849_4156_4890 | 244 |
| 593 | 3300048906 | Ga0496103_0089733 | Ga0496103_0089733_631_1365 | 244 |
| 594 | 3300048908 | Ga0496105_0130713 | Ga0496105_0130713_900_1634 | 244 |
| 595 | 3300048909 | Ga0496106_0225072 | Ga0496106_0225072_609_1358 | 244 |
| 596 | 3300048909 | Ga0496106_0718481 | Ga0496106_0718481_32_766 | 244 |
| 597 | 3300048911 | Ga0496108_0042139 | Ga0496108_0042139_365_1114 | 244 |
| 598 | 3300048912 | Ga0496109_0492969 | Ga0496109_0492969_70_819 | 244 |
| 599 | 3300048914 | Ga0496111_0301357 | Ga0496111_0301357_357_1106 | 244 |
| 600 | 3300048915 | Ga0496112_0066496 | Ga0496112_0066496_1611_2360 | 244 |
| 601 | 3300048915 | Ga0496112_0200136 | Ga0496112_0200136_178_912 | 244 |
| 602 | 3300048916 | Ga0496113_0026120 | Ga0496113_0026120_2408_3157 | 244 |
| 603 | 3300048918 | Ga0496115_0155234 | Ga0496115_0155234_752_1486 | 244 |
| 604 | 3300048919 | Ga0496116_0003291 | Ga0496116_0003291_4165_4899 | 244 |
| 605 | 3300048920 | Ga0496117_0000095 | Ga0496117_0000095_108497_109231 | 244 |
| 606 | 3300048921 | Ga0496118_0000003 | Ga0496118_0000003_69013_69747 | 244 |
| 607 | 3300048921 | Ga0496118_0088844 | Ga0496118_0088844_213_947 | 244 |
| 608 | 3300048921 | Ga0496118_0116563 | Ga0496118_0116563_454_1188 | 244 |
| 609 | 3300048922 | Ga0496119_0009520 | Ga0496119_0009520_4916_5650 | 244 |
| 610 | 3300048922 | Ga0496119_0020125 | Ga0496119_0020125_3935_4669 | 244 |
| 611 | 3300048922 | Ga0496119_0138697 | Ga0496119_0138697_489_1223 | 244 |
| 612 | 3300048923 | Ga0496120_0000693 | Ga0496120_0000693_18012_18746 | 244 |
| 613 | 3300048923 | Ga0496120_0117155 | Ga0496120_0117155_558_1292 | 244 |
| 614 | 3300048924 | Ga0496121_0009504 | Ga0496121_0009504_8090_8824 | 244 |
| 615 | 3300048924 | Ga0496121_0011641 | Ga0496121_0011641_8538_9272 | 244 |
| 616 | 3300048927 | Ga0496124_0005346 | Ga0496124_0005346_12330_13064 | 244 |
| 617 | 3300048928 | Ga0496125_0000112 | Ga0496125_0000112_63979_64713 | 244 |
| 618 | 3300048928 | Ga0496125_0027039 | Ga0496125_0027039_925_1659 | 244 |
| 619 | 3300048929 | Ga0496126_0002920 | Ga0496126_0002920_4210_4944 | 244 |
| 620 | 3300048929 | Ga0496126_0003855 | Ga0496126_0003855_12947_13681 | 244 |
| 621 | 3300048929 | Ga0496126_0009185 | Ga0496126_0009185_21_755 | 244 |
| 622 | 3300048929 | Ga0496126_0045173 | Ga0496126_0045173_2002_2736 | 244 |
| 623 | 3300048929 | Ga0496126_0064500 | Ga0496126_0064500_484_1218 | 244 |
| 624 | 3300049522 | Ga0501299_016954 | Ga0501299_016954_147_881 | 244 |
| 625 | 3300049572 | Ga0501036_0311051 | Ga0501036_0311051_445_1179 | 244 |
| 626 | 3300049574 | Ga0501038_0270058 | Ga0501038_0270058_298_1032 | 244 |
| 627 | 3300049577 | Ga0501041_0085994 | Ga0501041_0085994_605_1339 | 244 |
| 628 | 3300049578 | Ga0501042_0108676 | Ga0501042_0108676_157_891 | 244 |
| 629 | 3300049587 | Ga0501071_0147652 | Ga0501071_0147652_302_1036 | 244 |
| 630 | 3300049588 | Ga0501072_0352717 | Ga0501072_0352717_65_799 | 244 |
| 631 | 3300049591 | Ga0501075_0142808 | Ga0501075_0142808_495_1229 | 244 |
| 632 | 3300049592 | Ga0501076_0186284 | Ga0501076_0186284_572_1306 | 244 |
| 633 | 3300050507 | nmdc:mga05p37_15071_c1 | nmdc:mga05p37_15071_c1_1194_1928 | 244 |
| 634 | 3300050507 | nmdc:mga05p37_419090_c1 | nmdc:mga05p37_419090_c1_753_1487 | 244 |
| 635 | 3300050508 | nmdc:mga09592_1068_c1 | nmdc:mga09592_1068_c1_18390_19124 | 244 |
| 636 | 3300050508 | nmdc:mga09592_32074_c1 | nmdc:mga09592_32074_c1_1129_1863 | 244 |
| 637 | 3300050509 | nmdc:mga0qj67_1805_c1 | nmdc:mga0qj67_1805_c1_8312_9046 | 244 |
| 638 | 3300050509 | nmdc:mga0qj67_2664_c1 | nmdc:mga0qj67_2664_c1_6475_7209 | 244 |
| 639 | 3300050509 | nmdc:mga0qj67_351273_c1 | nmdc:mga0qj67_351273_c1_83_817 | 244 |
| 640 | 3300050509 | nmdc:mga0qj67_41338_c1 | nmdc:mga0qj67_41338_c1_2699_3433 | 244 |
| 641 | 3300050509 | nmdc:mga0qj67_50623_c1 | nmdc:mga0qj67_50623_c1_819_1553 | 244 |
| 642 | 3300050510 | nmdc:mga06r32_294_c1 | nmdc:mga06r32_294_c1_17609_18343 | 244 |
| 643 | 3300050510 | nmdc:mga06r32_4213_c1 | nmdc:mga06r32_4213_c1_5202_5936 | 244 |
| 644 | 3300050512 | nmdc:mga0n895_404788_c1 | nmdc:mga0n895_404788_c1_92_826 | 244 |
| 645 | 3300050514 | nmdc:mga08x19_23616_c1 | nmdc:mga08x19_23616_c1_2669_3403 | 244 |
| 646 | 3300053085 | Ga0495619_0034228 | Ga0495619_0034228_423_1157 | 244 |
| 647 | 3300053088 | Ga0500644_0047545 | Ga0500644_0047545_698_1432 | 244 |
| 648 | 3300053092 | Ga0500583_0012417 | Ga0500583_0012417_1401_2138 | 244 |
| 649 | 3300053092 | Ga0500583_0062805 | Ga0500583_0062805_210_944 | 244 |
| 650 | 3300053096 | Ga0500641_0075097 | Ga0500641_0075097_202_936 | 244 |
| 651 | 3300053098 | Ga0500650_0046612 | Ga0500650_0046612_142_876 | 244 |
| 652 | 3300053115 | Ga0500591_085117 | Ga0500591_085117_349_1083 | 244 |
| 653 | 3300053123 | Ga0500614_067344 | Ga0500614_067344_158_892 | 244 |
| 654 | 3300053139 | Ga0500568_0036113 | Ga0500568_0036113_480_1214 | 244 |
| 655 | 3300053139 | Ga0500568_0056190 | Ga0500568_0056190_712_1446 | 244 |
| 656 | 3300053139 | Ga0500568_0117369 | Ga0500568_0117369_89_823 | 244 |
| 657 | 3300053147 | Ga0500589_082919 | Ga0500589_082919_482_1216 | 244 |
| 658 | 3300053156 | Ga0500622_0001895 | Ga0500622_0001895_8074_8808 | 244 |
| 659 | 3300053156 | Ga0500622_0028001 | Ga0500622_0028001_228_962 | 244 |
| 660 | 3300053159 | Ga0500630_064737 | Ga0500630_064737_554_1288 | 244 |
| 661 | 3300053177 | Ga0500636_0167225 | Ga0500636_0167225_308_1042 | 244 |
| 662 | 3300053178 | Ga0500637_0001099 | Ga0500637_0001099_1617_2354 | 244 |
| 663 | 3300053178 | Ga0500637_0050556 | Ga0500637_0050556_1229_1963 | 244 |
| 664 | 3300053178 | Ga0500637_0063113 | Ga0500637_0063113_747_1481 | 244 |
| 665 | 3300053178 | Ga0500637_0078151 | Ga0500637_0078151_951_1685 | 244 |
| 666 | 3300054114 | Ga0501084_0000106 | Ga0501084_0000106_19353_20087 | 244 |
| 667 | 3300054114 | Ga0501084_0250959 | Ga0501084_0250959_369_1103 | 244 |
| 668 | 3300060353 | Ga0501082_0138390 | Ga0501082_0138390_1289_2023 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o12-assembly1.cif.gz_E | abc transporter nosdfy, amppnp-bound in gdn | 0.7924 | 4 | 239 |
| 7o17-assembly1.cif.gz_E | abc transporter nosdfy e154q, atp-bound in lipid nanodisc | 0.7899 | 4 | 239 |
| 7o0z-assembly1.cif.gz_E | abc transporter nosfy, nucleotide-free in gdn | 0.7891 | 4 | 239 |
| 7o0z-assembly1.cif.gz_D | abc transporter nosfy, nucleotide-free in gdn | 0.7804 | 4 | 239 |
| 7znq-assembly1.cif.gz_Y | abc transporter complex nosdfyl in gdn | 0.776 | 4 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7039 | 57 | 238 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6741 | 53 | 237 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6502 | 57 | 240 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5469 | 57 | 238 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5337 | 53 | 237 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D9PFV1-F1-model_v4 | ABC transporter, permease protein | 0.9943 | 56 | 240 |
GO:0005886
GO:0140359 |
| AF-A0A518BMA5-F1-model_v4 | ABC-2 family transporter protein | 0.9853 | 4 | 244 |
GO:0005886
GO:0140359 |
| AF-A0A1E5A0B5-F1-model_v4 | ABC transporter domain-containing protein | 0.9832 | 3 | 244 |
GO:0005524
GO:0005886 GO:0016887 GO:0140359 |
| AF-A0A450WF97-F1-model_v4 | ABC-2 type transport system permease protein | 0.9809 | 1 | 244 |
GO:0005886
GO:0140359 |
| AF-A0A2K2H7J0-F1-model_v4 | ABC transporter | 0.9805 | 1 | 243 |
GO:0005886
GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar