F473830

General Info

Members Datasets Scaffolds Average Seq Length
667 263 1334 139

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1045700|Ga0081540_10457002
Length 146
Sequence MDDWVLWLIAAVVFGIGEIATTGFFLAPFAGGALLAALVAALGVGAAASWIVFIVVSVALLLALRPVARRMRRMPAHLRTGTAALVGKQAMVLERIANDEGVGCVRIDGEVWTARAYDEDEVIEAGRRVHVVEIRGATALVSELGG

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 9.45
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1045700 3300005983 Bacteria 2220
2 JGI24737J22298_10026853 3300001990 Bacteria 1817
3 JGI25406J46586_10003979 3300003203 Bacteria 6913
4 JGI25407J50210_10000402 3300003373 Bacteria 8328
5 JGI25407J50210_10010573 3300003373 Bacteria 2350
6 JGI25407J50210_10037589 3300003373 Bacteria 1244
7 JGI25407J50210_10092040 3300003373 Bacteria 750
8 JGI25407J50210_10119504 3300003373 Bacteria 649
9 JGI25407J50210_10123656 3300003373 Bacteria 637
10 Ga0070658_11003207 3300005327 Bacteria 726
11 Ga0070683_100106668 3300005329 Bacteria 2641
12 Ga0070683_100119386 3300005329 Bacteria 2490
13 Ga0070683_100540968 3300005329 Bacteria 1113
14 Ga0070683_100890055 3300005329 Bacteria 854
15 Ga0070683_101263559 3300005329 Bacteria 710
16 Ga0070670_100785793 3300005331 Bacteria 859
17 Ga0070680_100731506 3300005336 Bacteria 852
18 Ga0070682_100005415 3300005337 Bacteria 7108
19 Ga0070682_100054576 3300005337 Bacteria 2508
20 Ga0068868_100005015 3300005338 Bacteria 9302
21 Ga0068868_100066404 3300005338 Bacteria 2868
22 Ga0068868_100166484 3300005338 Bacteria 1823
23 Ga0068868_100362525 3300005338 Bacteria 1244
24 Ga0070660_100024690 3300005339 Bacteria 4461
25 Ga0070660_100089699 3300005339 Bacteria 2423
26 Ga0070660_100707387 3300005339 Bacteria 845
27 Ga0070689_100216461 3300005340 Bacteria 1570
28 Ga0070691_10040257 3300005341 Bacteria 2209
29 Ga0070691_10147796 3300005341 Bacteria 1202
30 Ga0070687_100418921 3300005343 Bacteria 883
31 Ga0070687_100615505 3300005343 Bacteria 748
32 Ga0070687_101172273 3300005343 Bacteria 565
33 Ga0070661_100109928 3300005344 Bacteria 2057
34 Ga0070661_100756164 3300005344 Bacteria 795
35 Ga0070692_10085428 3300005345 Bacteria 1707
36 Ga0070692_10389631 3300005345 Bacteria 876
37 Ga0070692_10697340 3300005345 Unclassified 683
38 Ga0070668_100003276 3300005347 Bacteria 11939
39 Ga0070668_101181198 3300005347 Bacteria 693
40 Ga0070668_101816343 3300005347 Unclassified 561
41 Ga0070669_100256596 3300005353 Bacteria 1394
42 Ga0070675_100036996 3300005354 Bacteria 3974
43 Ga0070671_100530832 3300005355 Bacteria 1014
44 Ga0070674_100395212 3300005356 Bacteria 1128
45 Ga0070674_101645741 3300005356 Bacteria 580
46 Ga0070673_100398079 3300005364 Bacteria 1231
47 Ga0070688_100043652 3300005365 Bacteria 2763
48 Ga0070688_100196115 3300005365 Bacteria 1410
49 Ga0070659_100000013 3300005366 Bacteria 178795
50 Ga0070659_100067281 3300005366 Bacteria 2841
51 Ga0070659_100109890 3300005366 Bacteria 2225
52 Ga0070659_100128872 3300005366 Bacteria 2053
53 Ga0070659_100667861 3300005366 Bacteria 897
54 Ga0070659_101550531 3300005366 Bacteria 591
55 Ga0070709_10795584 3300005434 Bacteria 742
56 Ga0070709_10944427 3300005434 Bacteria 684
57 Ga0070709_11089035 3300005434 Bacteria 639
58 Ga0070714_100000321 3300005435 Bacteria 36232
59 Ga0070714_100024377 3300005435 Bacteria 4981
60 Ga0070714_100288458 3300005435 Bacteria 1527
61 Ga0070714_100364803 3300005435 Bacteria 1359
62 Ga0070714_101351683 3300005435 Bacteria 695
63 Ga0070713_100097877 3300005436 Bacteria 2536
64 Ga0070710_10000005 3300005437 Bacteria 238049
65 Ga0070710_10376368 3300005437 Bacteria 946
66 Ga0070701_10144129 3300005438 Bacteria 1365
67 Ga0070701_10164934 3300005438 Bacteria 1286
68 Ga0070701_10208233 3300005438 Bacteria 1160
69 Ga0070711_100100593 3300005439 Bacteria 2103
70 Ga0070711_100473747 3300005439 Bacteria 1028
71 Ga0070705_100000913 3300005440 Bacteria 16532
72 Ga0070705_101270243 3300005440 Bacteria 609
73 Ga0070700_100000208 3300005441 Bacteria 32739
74 Ga0070700_100045504 3300005441 Bacteria 2707
75 Ga0070700_100137601 3300005441 Bacteria 1656
76 Ga0070700_100387905 3300005441 Bacteria 1046
77 Ga0070708_100671258 3300005445 Bacteria 976
78 Ga0070663_100118053 3300005455 Bacteria 2001
79 Ga0070663_100152366 3300005455 Bacteria 1774
80 Ga0070663_100267667 3300005455 Bacteria 1358
81 Ga0070678_100013850 3300005456 Bacteria 5070
82 Ga0070678_100257199 3300005456 Bacteria 1467
83 Ga0070678_100965366 3300005456 Bacteria 782
84 Ga0070662_100003740 3300005457 Bacteria 9520
85 Ga0070662_100395558 3300005457 Bacteria 1140
86 Ga0070662_100532845 3300005457 Bacteria 982
87 Ga0068867_100568731 3300005459 Bacteria 984
88 Ga0070685_10379521 3300005466 Bacteria 974
89 Ga0070685_10488628 3300005466 Bacteria 869
90 Ga0070699_101935790 3300005518 Bacteria 539
91 Ga0070684_100013531 3300005535 Bacteria 6582
92 Ga0070684_100094198 3300005535 Bacteria 2667
93 Ga0070684_100974333 3300005535 Bacteria 796
94 Ga0070684_101526610 3300005535 Bacteria 630
95 Ga0068853_101240568 3300005539 Bacteria 720
96 Ga0070686_100090823 3300005544 Bacteria 2042
97 Ga0070695_100689538 3300005545 Bacteria 810
98 Ga0070695_100795641 3300005545 Bacteria 757
99 Ga0070696_100675459 3300005546 Bacteria 840
100 Ga0070696_100687868 3300005546 Bacteria 833
101 Ga0070696_101199614 3300005546 Bacteria 641
102 Ga0070693_100415437 3300005547 Bacteria 936
103 Ga0070665_100372110 3300005548 Bacteria 1436
104 Ga0070665_100592953 3300005548 Bacteria 1121
105 Ga0068855_100439070 3300005563 Bacteria 1426
106 Ga0068855_100572203 3300005563 Bacteria 1221
107 Ga0070664_100015629 3300005564 Bacteria 6211
108 Ga0070664_100025038 3300005564 Bacteria 4944
109 Ga0070664_100096987 3300005564 Bacteria 2559
110 Ga0070664_100130570 3300005564 Bacteria 2206
111 Ga0070664_100899793 3300005564 Bacteria 830
112 Ga0070664_100984476 3300005564 Bacteria 792
113 Ga0068857_100313502 3300005577 Bacteria 1447
114 Ga0068854_100354115 3300005578 Bacteria 1202
115 Ga0068856_100051257 3300005614 Bacteria 4069
116 Ga0068856_100110654 3300005614 Bacteria 2744
117 Ga0068856_101083678 3300005614 Bacteria 819
118 Ga0070702_100020044 3300005615 Bacteria 3497
119 Ga0070702_100037406 3300005615 Bacteria 2696
120 Ga0070702_100052535 3300005615 Bacteria 2337
121 Ga0070702_100212889 3300005615 Bacteria 1287
122 Ga0070702_101349198 3300005615 Bacteria 581
123 Ga0070702_101349454 3300005615 Bacteria 581
124 Ga0070702_101350757 3300005615 Bacteria 581
125 Ga0068852_100101978 3300005616 Bacteria 2592
126 Ga0068852_101031780 3300005616 Bacteria 842
127 Ga0068852_101802519 3300005616 Unclassified 634
128 Ga0068864_100019651 3300005618 Bacteria 5650
129 Ga0068864_100252413 3300005618 Bacteria 1638
130 Ga0068866_10495971 3300005718 Bacteria 807
131 Ga0068861_100160404 3300005719 Bacteria 1854
132 Ga0068861_100851115 3300005719 Bacteria 860
133 Ga0068870_10210972 3300005840 Bacteria 1183
134 Ga0068870_10341839 3300005840 Bacteria 957
135 Ga0068863_100486163 3300005841 Bacteria 1215
136 Ga0068863_101325958 3300005841 Bacteria 727
137 Ga0068858_100527757 3300005842 Bacteria 1142
138 Ga0068860_100258201 3300005843 Bacteria 1698
139 Ga0068860_100388512 3300005843 Bacteria 1379
140 Ga0068862_100253813 3300005844 Bacteria 1603
141 Ga0081455_10061461 3300005937 Bacteria 3161
142 Ga0081455_10256402 3300005937 Bacteria 1276
143 Ga0081538_10000039 3300005981 Bacteria 118810
144 Ga0081538_10000176 3300005981 Bacteria 69195
145 Ga0081538_10001077 3300005981 Bacteria 29016
146 Ga0081538_10001753 3300005981 Bacteria 22008
147 Ga0081538_10004551 3300005981 Bacteria 12765
148 Ga0081538_10004873 3300005981 Bacteria 12223
149 Ga0081538_10014301 3300005981 Bacteria 6220
150 Ga0081538_10022616 3300005981 Bacteria 4550
151 Ga0081538_10041254 3300005981 Bacteria 2931
152 Ga0081538_10056187 3300005981 Bacteria 2308
153 Ga0081538_10068180 3300005981 Bacteria 1980
154 Ga0081538_10076628 3300005981 Bacteria 1806
155 Ga0081538_10107275 3300005981 Bacteria 1383
156 Ga0081538_10162501 3300005981 Bacteria 990
157 Ga0081538_10205169 3300005981 Bacteria 803
158 Ga0081538_10227156 3300005981 Bacteria 733
159 Ga0081540_1056230 3300005983 Bacteria 1911
160 Ga0081539_10000479 3300005985 Bacteria 84481
161 Ga0081539_10021377 3300005985 Bacteria 4325
162 Ga0070717_10000004 3300006028 Bacteria 365525
163 Ga0070717_10126936 3300006028 Bacteria 2190
164 Ga0075365_10359951 3300006038 Bacteria 1026
165 Ga0075363_100146789 3300006048 Bacteria 1330
166 Ga0075363_100339351 3300006048 Bacteria 876
167 Ga0075432_10078120 3300006058 Bacteria 1197
168 Ga0075432_10080304 3300006058 Bacteria 1182
169 Ga0075432_10121719 3300006058 Bacteria 981
170 Ga0070716_100347111 3300006173 Bacteria 1049
171 Ga0070716_100838022 3300006173 Bacteria 715
172 Ga0070712_100648609 3300006175 Bacteria 897
173 Ga0075367_10363764 3300006178 Bacteria 913
174 Ga0075428_100019910 3300006844 Bacteria 7430
175 Ga0075428_100062288 3300006844 Bacteria 4084
176 Ga0075428_100475500 3300006844 Bacteria 1337
177 Ga0075428_100500207 3300006844 Bacteria 1300
178 Ga0075430_100005776 3300006846 Bacteria 10442
179 Ga0075430_100167431 3300006846 Bacteria 1828
180 Ga0075430_100932680 3300006846 Bacteria 715
181 Ga0075430_101043233 3300006846 Bacteria 673
182 Ga0075430_101459123 3300006846 Bacteria 562
183 Ga0075431_100001288 3300006847 Bacteria 22906
184 Ga0075431_100147830 3300006847 Bacteria 2420
185 Ga0075431_100173069 3300006847 Bacteria 2218
186 Ga0075431_100308175 3300006847 Bacteria 1599
187 Ga0075431_101278221 3300006847 Bacteria 695
188 Ga0075433_10047635 3300006852 Bacteria 3729
189 Ga0075433_10308580 3300006852 Bacteria 1400
190 Ga0075433_10345256 3300006852 Bacteria 1316
191 Ga0075434_100291299 3300006871 Bacteria 1652
192 Ga0075429_100072438 3300006880 Bacteria 3001
193 Ga0075429_100110009 3300006880 Bacteria 2409
194 Ga0075429_100179753 3300006880 Bacteria 1854
195 Ga0075429_100294216 3300006880 Bacteria 1422
196 Ga0075429_100502039 3300006880 Bacteria 1063
197 Ga0075429_100801623 3300006880 Bacteria 825
198 Ga0068865_100019379 3300006881 Bacteria 4403
199 Ga0068865_100057751 3300006881 Bacteria 2708
200 Ga0068865_100376677 3300006881 Bacteria 1157
201 Ga0068865_101111184 3300006881 Bacteria 697
202 Ga0068865_101295043 3300006881 Unclassified 648
203 Ga0075436_100063918 3300006914 Bacteria 2543
204 Ga0075436_100588941 3300006914 Bacteria 819
205 Ga0075435_100655214 3300007076 Bacteria 911
206 Ga0075435_101740421 3300007076 Bacteria 547
207 Ga0105244_10528156 3300009036 Bacteria 544
208 Ga0105240_10013077 3300009093 Bacteria 11423
209 Ga0105240_10071805 3300009093 Bacteria 4280
210 Ga0111539_10065958 3300009094 Bacteria 4276
211 Ga0111539_10069628 3300009094 Bacteria 4154
212 Ga0111539_10074021 3300009094 Bacteria 4014
213 Ga0111539_10189507 3300009094 Bacteria 2400
214 Ga0111539_10262511 3300009094 Bacteria 2010
215 Ga0111539_10547153 3300009094 Bacteria 1348
216 Ga0111539_10814414 3300009094 Bacteria 1087
217 Ga0111539_11350247 3300009094 Bacteria 827
218 Ga0105245_10004192 3300009098 Bacteria 12800
219 Ga0105245_10166815 3300009098 Bacteria 2094
220 Ga0105245_10502986 3300009098 Bacteria 1228
221 Ga0105245_10505672 3300009098 Bacteria 1225
222 Ga0105245_10704089 3300009098 Bacteria 1043
223 Ga0105245_10836907 3300009098 Bacteria 960
224 Ga0105245_12229783 3300009098 Bacteria 601
225 Ga0105247_10122327 3300009101 Bacteria 1688
226 Ga0114129_10022764 3300009147 Bacteria 8884
227 Ga0114129_10112985 3300009147 Bacteria 3746
228 Ga0114129_10306880 3300009147 Bacteria 2113
229 Ga0114129_10350669 3300009147 Bacteria 1955
230 Ga0114129_10800956 3300009147 Bacteria 1202
231 Ga0114129_11102515 3300009147 Bacteria 994
232 Ga0114129_11213317 3300009147 Bacteria 939
233 Ga0105243_10222795 3300009148 Bacteria 1668
234 Ga0105243_10495920 3300009148 Bacteria 1156
235 Ga0105243_10945796 3300009148 Bacteria 860
236 Ga0105243_11314388 3300009148 Bacteria 741
237 Ga0105241_10584959 3300009174 Bacteria 1007
238 Ga0105242_10257966 3300009176 Bacteria 1573
239 Ga0105242_11048302 3300009176 Bacteria 826
240 Ga0105242_11930289 3300009176 Bacteria 631
241 Ga0105248_10339808 3300009177 Bacteria 1690
242 Ga0105248_10480502 3300009177 Bacteria 1400
243 Ga0105238_11950070 3300009551 Bacteria 620
244 Ga0105249_10004994 3300009553 Bacteria 11449
245 Ga0105249_10129845 3300009553 Bacteria 2404
246 Ga0105249_10644626 3300009553 Bacteria 1117
247 Ga0105249_10880303 3300009553 Bacteria 962
248 Ga0105239_10356868 3300010375 Bacteria 1651
249 Ga0105239_10470039 3300010375 Bacteria 1428
250 Ga0105239_10473613 3300010375 Bacteria 1422
251 Ga0105239_10608134 3300010375 Bacteria 1247
252 Ga0105246_10040487 3300011119 Bacteria 3145
253 Ga0105246_10116879 3300011119 Bacteria 1969
254 Ga0105246_10356034 3300011119 Bacteria 1201
255 Ga0105246_11116457 3300011119 Bacteria 721
256 Ga0157371_10248428 3300013102 Bacteria 1280
257 Ga0157374_10012906 3300013296 Bacteria 7278
258 Ga0157378_11306999 3300013297 Bacteria 766
259 Ga0163162_10113893 3300013306 Bacteria 2803
260 Ga0163162_10190877 3300013306 Bacteria 2176
261 Ga0163162_10276540 3300013306 Bacteria 1811
262 Ga0163162_10816127 3300013306 Bacteria 1049
263 Ga0157372_10014117 3300013307 Bacteria 8532
264 Ga0157372_10761145 3300013307 Bacteria 1126
265 Ga0157375_10239292 3300013308 Bacteria 1975
266 Ga0157375_11056640 3300013308 Bacteria 949
267 Ga0163163_10398657 3300014325 Bacteria 1434
268 Ga0163163_10411282 3300014325 Bacteria 1411
269 Ga0157380_10196800 3300014326 Bacteria 1785
270 Ga0157380_10395514 3300014326 Bacteria 1309
271 Ga0157380_10445720 3300014326 Bacteria 1242
272 Ga0157377_10053480 3300014745 Bacteria 2283
273 Ga0157377_10123153 3300014745 Bacteria 1574
274 Ga0157377_10694507 3300014745 Bacteria 738
275 Ga0157379_10747094 3300014968 Bacteria 921
276 Ga0157379_10837210 3300014968 Bacteria 870
277 Ga0157376_10312467 3300014969 Bacteria 1491
278 Ga0157376_10608222 3300014969 Bacteria 1089
279 Ga0163161_10296244 3300017792 Bacteria 1273
280 Ga0207656_10207633 3300025321 Bacteria 948
281 Ga0207692_10000009 3300025898 Bacteria 159859
282 Ga0207692_10122973 3300025898 Bacteria 1455
283 Ga0207642_10077896 3300025899 Bacteria 1600
284 Ga0207710_10132924 3300025900 Bacteria 1196
285 Ga0207688_10000173 3300025901 Bacteria 28587
286 Ga0207688_10051861 3300025901 Bacteria 2298
287 Ga0207688_10396461 3300025901 Bacteria 855
288 Ga0207647_10082645 3300025904 Bacteria 1924
289 Ga0207647_10107251 3300025904 Bacteria 1653
290 Ga0207645_10197128 3300025907 Bacteria 1324
291 Ga0207643_10235399 3300025908 Bacteria 1124
292 Ga0207643_10648765 3300025908 Unclassified 681
293 Ga0207705_10050734 3300025909 Bacteria 2987
294 Ga0207695_10008385 3300025913 Bacteria 12945
295 Ga0207693_10034417 3300025915 Bacteria 3995
296 Ga0207693_10096940 3300025915 Bacteria 2312
297 Ga0207693_10225744 3300025915 Bacteria 1471
298 Ga0207663_10031505 3300025916 Bacteria 3139
299 Ga0207663_10282246 3300025916 Bacteria 1234
300 Ga0207663_10685250 3300025916 Bacteria 811
301 Ga0207662_10054679 3300025918 Bacteria 2381
302 Ga0207662_10418747 3300025918 Bacteria 911
303 Ga0207662_10539300 3300025918 Bacteria 807
304 Ga0207657_10076660 3300025919 Bacteria 2820
305 Ga0207657_10077259 3300025919 Bacteria 2806
306 Ga0207657_10126359 3300025919 Bacteria 2100
307 Ga0207652_10479955 3300025921 Bacteria 1120
308 Ga0207652_10853355 3300025921 Bacteria 806
309 Ga0207681_10003194 3300025923 Bacteria 10281
310 Ga0207681_10096635 3300025923 Bacteria 2121
311 Ga0207650_10270985 3300025925 Bacteria 1379
312 Ga0207687_10022588 3300025927 Bacteria 4188
313 Ga0207687_10049740 3300025927 Bacteria 2916
314 Ga0207687_10241389 3300025927 Bacteria 1432
315 Ga0207687_10246853 3300025927 Bacteria 1417
316 Ga0207687_10348479 3300025927 Bacteria 1206
317 Ga0207687_10589547 3300025927 Bacteria 936
318 Ga0207700_10012007 3300025928 Bacteria 5559
319 Ga0207700_10059752 3300025928 Bacteria 2884
320 Ga0207664_10000006 3300025929 Bacteria 408702
321 Ga0207664_10001067 3300025929 Bacteria 18284
322 Ga0207664_10037086 3300025929 Bacteria 3771
323 Ga0207664_10041715 3300025929 Bacteria 3576
324 Ga0207664_10362238 3300025929 Bacteria 1285
325 Ga0207664_11739188 3300025929 Bacteria 546
326 Ga0207644_10833007 3300025931 Bacteria 772
327 Ga0207690_10000017 3300025932 Bacteria 243513
328 Ga0207690_10040931 3300025932 Bacteria 3033
329 Ga0207690_10357230 3300025932 Bacteria 1156
330 Ga0207690_10479209 3300025932 Bacteria 1004
331 Ga0207690_11090631 3300025932 Bacteria 665
332 Ga0207706_10002121 3300025933 Bacteria 19428
333 Ga0207706_10148131 3300025933 Bacteria 2065
334 Ga0207706_10227908 3300025933 Bacteria 1631
335 Ga0207706_10942917 3300025933 Bacteria 727
336 Ga0207686_10218807 3300025934 Bacteria 1374
337 Ga0207686_10677730 3300025934 Bacteria 818
338 Ga0207709_10025915 3300025935 Bacteria 3362
339 Ga0207709_10079506 3300025935 Bacteria 2109
340 Ga0207709_10196154 3300025935 Bacteria 1438
341 Ga0207709_11221342 3300025935 Unclassified 620
342 Ga0207670_10160744 3300025936 Bacteria 1676
343 Ga0207669_10158103 3300025937 Bacteria 1597
344 Ga0207669_10460177 3300025937 Bacteria 1010
345 Ga0207669_11041550 3300025937 Bacteria 689
346 Ga0207704_10128959 3300025938 Bacteria 1747
347 Ga0207704_10184656 3300025938 Bacteria 1510
348 Ga0207704_10587971 3300025938 Bacteria 910
349 Ga0207704_11010172 3300025938 Bacteria 704
350 Ga0207704_11216624 3300025938 Unclassified 642
351 Ga0207665_10380428 3300025939 Bacteria 1071
352 Ga0207691_10246616 3300025940 Bacteria 1543
353 Ga0207711_10413077 3300025941 Bacteria 1255
354 Ga0207689_10018466 3300025942 Bacteria 5884
355 Ga0207661_10085225 3300025944 Bacteria 2618
356 Ga0207661_10132991 3300025944 Bacteria 2133
357 Ga0207661_10403168 3300025944 Bacteria 1240
358 Ga0207661_10522040 3300025944 Bacteria 1086
359 Ga0207661_10530348 3300025944 Bacteria 1077
360 Ga0207661_10567101 3300025944 Bacteria 1041
361 Ga0207661_10818977 3300025944 Bacteria 857
362 Ga0207661_11709657 3300025944 Bacteria 574
363 Ga0207679_10022403 3300025945 Bacteria 4301
364 Ga0207679_10047284 3300025945 Bacteria 3125
365 Ga0207679_10076261 3300025945 Bacteria 2547
366 Ga0207679_10155804 3300025945 Bacteria 1865
367 Ga0207679_10582627 3300025945 Bacteria 1006
368 Ga0207667_10334539 3300025949 Bacteria 1546
369 Ga0207667_11654257 3300025949 Unclassified 608
370 Ga0207651_10018221 3300025960 Bacteria 4172
371 Ga0207651_10197026 3300025960 Bacteria 1611
372 Ga0207712_10018732 3300025961 Bacteria 4513
373 Ga0207712_10019147 3300025961 Bacteria 4466
374 Ga0207668_10015827 3300025972 Bacteria 4695
375 Ga0207668_10201489 3300025972 Bacteria 1585
376 Ga0207668_10361196 3300025972 Bacteria 1217
377 Ga0207668_11637200 3300025972 Unclassified 581
378 Ga0207640_10116242 3300025981 Bacteria 1906
379 Ga0207640_11066477 3300025981 Bacteria 713
380 Ga0207658_10203438 3300025986 Bacteria 1655
381 Ga0207677_10040429 3300026023 Bacteria 3074
382 Ga0207677_10054838 3300026023 Bacteria 2722
383 Ga0207677_10064036 3300026023 Bacteria 2558
384 Ga0207677_10385214 3300026023 Bacteria 1184
385 Ga0207677_11558312 3300026023 Bacteria 611
386 Ga0207703_11941385 3300026035 Bacteria 565
387 Ga0207639_10275187 3300026041 Bacteria 1478
388 Ga0207678_10026049 3300026067 Bacteria 5102
389 Ga0207678_10188002 3300026067 Bacteria 1764
390 Ga0207678_10247365 3300026067 Bacteria 1527
391 Ga0207678_10423939 3300026067 Bacteria 1154
392 Ga0207708_10000372 3300026075 Bacteria 35094
393 Ga0207708_10058786 3300026075 Bacteria 2933
394 Ga0207708_10116092 3300026075 Bacteria 2082
395 Ga0207708_10496805 3300026075 Bacteria 1022
396 Ga0207708_10867309 3300026075 Unclassified 780
397 Ga0207702_10079890 3300026078 Bacteria 2836
398 Ga0207641_10381592 3300026088 Bacteria 1350
399 Ga0207641_11666249 3300026088 Bacteria 640
400 Ga0207648_10062690 3300026089 Bacteria 3241
401 Ga0207676_10141366 3300026095 Bacteria 2061
402 Ga0207676_10995103 3300026095 Bacteria 826
403 Ga0207676_11589461 3300026095 Unclassified 651
404 Ga0207674_10049576 3300026116 Bacteria 4294
405 Ga0207674_10566323 3300026116 Bacteria 1097
406 Ga0207675_100023988 3300026118 Bacteria 5670
407 Ga0207675_100040564 3300026118 Bacteria 4348
408 Ga0207675_100046907 3300026118 Bacteria 4036
409 Ga0207675_100249761 3300026118 Bacteria 1716
410 Ga0207675_101552507 3300026118 Bacteria 683
411 Ga0207683_10018981 3300026121 Bacteria 5867
412 Ga0207683_10289473 3300026121 Bacteria 1498
413 Ga0207683_10617190 3300026121 Bacteria 1004
414 Ga0207698_10334894 3300026142 Bacteria 1423
415 Ga0207428_10009623 3300027907 Bacteria 8657
416 Ga0207428_10032641 3300027907 Bacteria 4280
417 Ga0207428_10141889 3300027907 Bacteria 1833
418 Ga0207428_10259007 3300027907 Bacteria 1296
419 Ga0207428_10355987 3300027907 Bacteria 1076
420 Ga0268266_10132550 3300028379 Bacteria 2230
421 Ga0268265_10512146 3300028380 Bacteria 1133
422 Ga0268265_10524319 3300028380 Bacteria 1120
423 Ga0265326_10000060 3300028558 Bacteria 64091
424 Ga0265319_1010068 3300028563 Bacteria 3965
425 Ga0265334_10000012 3300028573 Bacteria 174358
426 Ga0265336_10031358 3300028666 Bacteria 1651
427 Ga0265338_10007865 3300028800 Bacteria 13093
428 Ga0265324_10007415 3300029957 Bacteria 4448
429 Ga0307405_10083670 3300031731 Bacteria 2092
430 Ga0307413_10076513 3300031824 Bacteria 2127
431 Ga0307413_10279591 3300031824 Unclassified 1255
432 Ga0307413_11483040 3300031824 Bacteria 599
433 Ga0307410_10074993 3300031852 Bacteria 2357
434 Ga0307410_10482840 3300031852 Bacteria 1017
435 Ga0307410_10579624 3300031852 Bacteria 933
436 Ga0307406_10995410 3300031901 Bacteria 719
437 Ga0307407_10154050 3300031903 Bacteria 1497
438 Ga0307407_10393058 3300031903 Bacteria 993
439 Ga0307407_10650987 3300031903 Bacteria 789
440 Ga0307407_11152740 3300031903 Bacteria 604
441 Ga0307412_10135479 3300031911 Bacteria 1796
442 Ga0307412_10337516 3300031911 Bacteria 1205
443 Ga0307409_100101232 3300031995 Bacteria 2390
444 Ga0307409_100193180 3300031995 Bacteria 1814
445 Ga0307409_100222819 3300031995 Bacteria 1704
446 Ga0307409_100406428 3300031995 Bacteria 1302
447 Ga0307409_100461410 3300031995 Bacteria 1228
448 Ga0307409_101213439 3300031995 Bacteria 778
449 Ga0307409_101431483 3300031995 Bacteria 718
450 Ga0307409_101441596 3300031995 Bacteria 715
451 Ga0307409_101554839 3300031995 Bacteria 689
452 Ga0307416_100550012 3300032002 Bacteria 1227
453 Ga0307416_100551814 3300032002 Bacteria 1226
454 Ga0307416_100834118 3300032002 Bacteria 1019
455 Ga0307416_101533678 3300032002 Bacteria 772
456 Ga0307416_103289050 3300032002 Bacteria 541
457 Ga0307414_10377908 3300032004 Bacteria 1224
458 Ga0307414_10975318 3300032004 Bacteria 779
459 Ga0307414_11105894 3300032004 Bacteria 732
460 Ga0307411_10091717 3300032005 Bacteria 2123
461 Ga0307411_10150244 3300032005 Bacteria 1730
462 Ga0307411_11348886 3300032005 Bacteria 651
463 Ga0307415_100045901 3300032126 Bacteria 2932
464 Ga0307415_100145537 3300032126 Bacteria 1816
465 Ga0307415_100155828 3300032126 Bacteria 1764
466 Ga0307415_100290278 3300032126 Bacteria 1350
467 Ga0307415_100378148 3300032126 Bacteria 1202
468 Ga0307415_100530063 3300032126 Bacteria 1035
469 Ga0307415_100830484 3300032126 Bacteria 846
470 Ga0307415_101461331 3300032126 Bacteria 653
471 Ga0307415_102159173 3300032126 Bacteria 544
472 Ga0373958_0060392 3300034819 Bacteria 820
473 Ga0373961_0359585 3300035241 Unclassified 551
474 Ga0373931_0034206 3300035691 Bacteria 2637
475 Ga0373931_0139212 3300035691 Bacteria 1404
476 Ga0373935_1308372 3300035692 Bacteria 541
477 Ga0395900_0370588 3300037418 Bacteria 1402
478 Ga0395900_0725704 3300037418 Bacteria 926
479 Ga0395898_0220697 3300037466 Bacteria 1808
480 Ga0395898_0340495 3300037466 Bacteria 1430
481 Ga0395898_0403470 3300037466 Bacteria 1303
482 Ga0395905_0384324 3300037471 Bacteria 1298
483 Ga0395905_1056784 3300037471 Bacteria 715
484 Ga0395901_0014215 3300038443 Bacteria 8104
485 Ga0395901_0279669 3300038443 Bacteria 1734
486 Ga0395901_1175289 3300038443 Bacteria 734
487 Ga0451793_0121453 3300041452 Bacteria 663
488 Ga0451853_0883447 3300041512 Bacteria 937
489 Ga0451853_2752564 3300041512 Bacteria 802
490 Ga0450888_006390 3300042126 Bacteria 1280
491 Ga0450888_007652 3300042126 Bacteria 1201
492 Ga0439460_0139490 3300042461 Bacteria 803
493 Ga0439440_0090986 3300042993 Bacteria 819
494 Ga0466964_0320213 3300044706 Bacteria 788
495 Ga0466957_0007196 3300044842 Bacteria 6292
496 Ga0466967_0052798 3300045976 Bacteria 3570
497 Ga0466967_0190376 3300045976 Bacteria 1938
498 Ga0495653_0360059 3300046463 Bacteria 934
499 Ga0495596_0054617 3300046500 Bacteria 1562
500 Ga0495596_0221495 3300046500 Bacteria 735
501 Ga0495620_0094475 3300046515 Bacteria 1197
502 Ga0495628_1155647 3300046516 Unclassified 527
503 Ga0495637_0357095 3300046520 Unclassified 512
504 Ga0495652_0279555 3300046529 Bacteria 1223
505 Ga0495656_0089865 3300046615 Bacteria 1403
506 Ga0495668_0542860 3300046616 Unclassified 641
507 Ga0495657_0113935 3300046675 Bacteria 1710
508 Ga0495658_0619636 3300046683 Bacteria 693
509 Ga0495624_0679140 3300046690 Bacteria 612
510 Ga0495589_0108216 3300046794 Bacteria 1343
511 Ga0495589_0192354 3300046794 Bacteria 965
512 Ga0495589_0236178 3300046794 Bacteria 856
513 Ga0495679_178790 3300047446 Unclassified 563
514 Ga0495626_0310055 3300048091 Bacteria 622
515 Ga0496100_0059769 3300048903 Bacteria 2506
516 Ga0496100_0463756 3300048903 Bacteria 972
517 Ga0496101_0059654 3300048904 Bacteria 2766
518 Ga0496101_0260169 3300048904 Bacteria 1353
519 Ga0496101_0296646 3300048904 Bacteria 1265
520 Ga0496102_0433603 3300048905 Bacteria 1234
521 Ga0496102_0496801 3300048905 Bacteria 1142
522 Ga0496102_1500822 3300048905 Bacteria 593
523 Ga0496103_0040710 3300048906 Bacteria 2855
524 Ga0496103_0124361 3300048906 Bacteria 1644
525 Ga0496103_0206768 3300048906 Bacteria 1262
526 Ga0496103_0408192 3300048906 Bacteria 872
527 Ga0496104_0000037 3300048907 Bacteria 178518
528 Ga0496104_0001651 3300048907 Bacteria 19253
529 Ga0496104_0057372 3300048907 Bacteria 3684
530 Ga0496105_0009484 3300048908 Bacteria 7616
531 Ga0496105_0017311 3300048908 Bacteria 5775
532 Ga0496105_0072906 3300048908 Bacteria 2837
533 Ga0496106_0017378 3300048909 Bacteria 5323
534 Ga0496106_0113316 3300048909 Bacteria 2113
535 Ga0496106_0248318 3300048909 Bacteria 1422
536 Ga0496106_0282832 3300048909 Bacteria 1329
537 Ga0496107_0007168 3300048910 Bacteria 7683
538 Ga0496107_0128371 3300048910 Bacteria 1871
539 Ga0496108_0000841 3300048911 Bacteria 23910
540 Ga0496108_0027775 3300048911 Bacteria 4677
541 Ga0496108_0467328 3300048911 Bacteria 1102
542 Ga0496108_0997415 3300048911 Bacteria 715
543 Ga0496108_1333387 3300048911 Bacteria 602
544 Ga0496109_0084534 3300048912 Bacteria 2928
545 Ga0496109_0097251 3300048912 Bacteria 2728
546 Ga0496109_0424176 3300048912 Bacteria 1256
547 Ga0496109_0446822 3300048912 Bacteria 1221
548 Ga0496109_0500217 3300048912 Bacteria 1147
549 Ga0496109_0515868 3300048912 Bacteria 1128
550 Ga0496109_0533613 3300048912 Bacteria 1107
551 Ga0496109_0872840 3300048912 Bacteria 837
552 Ga0496109_0957471 3300048912 Bacteria 794
553 Ga0496110_0000266 3300048913 Bacteria 33831
554 Ga0496110_0009814 3300048913 Bacteria 7754
555 Ga0496110_0036546 3300048913 Bacteria 4265
556 Ga0496110_0140280 3300048913 Bacteria 2185
557 Ga0496110_0838266 3300048913 Bacteria 824
558 Ga0496110_1335235 3300048913 Unclassified 626
559 Ga0496110_1471787 3300048913 Bacteria 591
560 Ga0496111_0000672 3300048914 Bacteria 17962
561 Ga0496111_0010361 3300048914 Bacteria 6252
562 Ga0496111_0147870 3300048914 Bacteria 1742
563 Ga0496111_0180292 3300048914 Bacteria 1570
564 Ga0496111_0957403 3300048914 Bacteria 615
565 Ga0496112_0008450 3300048915 Bacteria 9224
566 Ga0496112_0094815 3300048915 Bacteria 2955
567 Ga0496112_0236786 3300048915 Bacteria 1779
568 Ga0496112_1482047 3300048915 Unclassified 592
569 Ga0496113_0005095 3300048916 Bacteria 8163
570 Ga0496113_0274666 3300048916 Bacteria 1347
571 Ga0496113_0756484 3300048916 Bacteria 773
572 Ga0496114_0206457 3300048917 Bacteria 1722
573 Ga0496114_0695556 3300048917 Bacteria 892
574 Ga0496115_0000012 3300048918 Bacteria 215509
575 Ga0496115_0000017 3300048918 Bacteria 185702
576 Ga0496115_0069179 3300048918 Bacteria 2859
577 Ga0501031_0245954 3300049568 Bacteria 1163
578 Ga0501036_0112735 3300049572 Bacteria 2298
579 Ga0501039_0731884 3300049575 Bacteria 773
580 Ga0501039_0797987 3300049575 Bacteria 737
581 Ga0501040_0021991 3300049576 Bacteria 4264
582 Ga0501040_0650020 3300049576 Bacteria 762
583 Ga0501041_0186469 3300049577 Bacteria 1299
584 Ga0501046_0597922 3300049580 Bacteria 783
585 Ga0501046_0995872 3300049580 Bacteria 582
586 Ga0501048_0376752 3300049582 Bacteria 1013
587 Ga0501067_0157581 3300049583 Bacteria 1265
588 Ga0501069_0346373 3300049585 Bacteria 875
589 Ga0501069_0645211 3300049585 Unclassified 637
590 Ga0501071_0045681 3300049587 Bacteria 3144
591 Ga0501071_0472949 3300049587 Bacteria 960
592 Ga0501071_0681235 3300049587 Bacteria 791
593 Ga0501072_0300418 3300049588 Bacteria 1276
594 Ga0501072_0515802 3300049588 Bacteria 945
595 Ga0501072_0533206 3300049588 Bacteria 928
596 Ga0501074_0726063 3300049590 Bacteria 701
597 Ga0501074_0910909 3300049590 Bacteria 619
598 Ga0501075_0584986 3300049591 Bacteria 852
599 Ga0501076_0182254 3300049592 Bacteria 1712
600 Ga0501076_0676771 3300049592 Bacteria 852
601 Ga0501076_0933833 3300049592 Bacteria 715
602 Ga0501079_0085244 3300049741 Bacteria 2445
603 Ga0501079_0405155 3300049741 Bacteria 1070
604 Ga0501081_0090244 3300049743 Bacteria 2154
605 Ga0501081_0162874 3300049743 Bacteria 1608
606 Ga0501081_0554642 3300049743 Bacteria 858
607 Ga0501081_0709571 3300049743 Bacteria 755
608 Ga0501035_0505134 3300049822 Bacteria 995
609 Ga0501035_0613905 3300049822 Bacteria 885
610 Ga0501035_0995506 3300049822 Bacteria 659
611 Ga0501044_1268627 3300049823 Bacteria 604
612 Ga0501045_0204771 3300049824 Bacteria 1470
613 Ga0501045_0662039 3300049824 Bacteria 771
614 nmdc:mga03n38_118070_c1 3300050490 Bacteria 1300
615 nmdc:mga03n38_388145_c1 3300050490 Unclassified 766
616 nmdc:mga03n38_758463_c1 3300050490 Bacteria 562
617 nmdc:mga0yw44_99343_c1 3300050492 Bacteria 1851
618 nmdc:mga05p37_1239002_c1 3300050507 Bacteria 767
619 nmdc:mga05p37_139912_c1 3300050507 Bacteria 2966
620 nmdc:mga05p37_212594_c1 3300050507 Bacteria 2337
621 nmdc:mga05p37_460255_c1 3300050507 Bacteria 1470
622 nmdc:mga05p37_470817_c1 3300050507 Bacteria 1450
623 nmdc:mga05p37_577580_c1 3300050507 Bacteria 1274
624 nmdc:mga05p37_69764_c1 3300050507 Bacteria 4323
625 nmdc:mga05p37_864573_c1 3300050507 Bacteria 980
626 nmdc:mga09592_19275_c1 3300050508 Bacteria 5601
627 nmdc:mga09592_281622_c1 3300050508 Bacteria 1442
628 nmdc:mga09592_40273_c1 3300050508 Bacteria 3924
629 nmdc:mga09592_90965_c1 3300050508 Bacteria 2607
630 nmdc:mga0qj67_1044192_c1 3300050509 Bacteria 640
631 nmdc:mga0qj67_139126_c1 3300050509 Bacteria 1968
632 nmdc:mga0qj67_162391_c1 3300050509 Bacteria 1813
633 nmdc:mga0qj67_17317_c1 3300050509 Bacteria 5478
634 nmdc:mga0qj67_20849_c1 3300050509 Bacteria 5021
635 nmdc:mga0qj67_562330_c1 3300050509 Bacteria 914
636 nmdc:mga06r32_18930_c1 3300050510 Bacteria 6314
637 nmdc:mga06r32_245180_c1 3300050510 Bacteria 1779
638 nmdc:mga06r32_2638_c1 3300050510 Bacteria 16015
639 nmdc:mga06r32_721079_c1 3300050510 Bacteria 962
640 nmdc:mga08y16_294753_c1 3300050511 Bacteria 1672
641 nmdc:mga08y16_405531_c1 3300050511 Bacteria 1395
642 nmdc:mga08y16_41296_c1 3300050511 Bacteria 4833
643 nmdc:mga08y16_778817_c1 3300050511 Bacteria 951
644 nmdc:mga08y16_813067_c1 3300050511 Bacteria 927
645 nmdc:mga0n895_19173_c1 3300050512 Bacteria 6352
646 nmdc:mga0n895_587623_c1 3300050512 Bacteria 1117
647 nmdc:mga0rr50_168850_c1 3300050513 Bacteria 1781
648 nmdc:mga0rr50_941133_c1 3300050513 Bacteria 736
649 nmdc:mga08x19_290852_c1 3300050514 Bacteria 1133
650 nmdc:mga08x19_759087_c1 3300050514 Bacteria 689
651 nmdc:mga0a205_1574687_c1 3300050515 Bacteria 505
652 nmdc:mga0a205_271193_c1 3300050515 Bacteria 1574
653 nmdc:mga0a205_28035_c1 3300050515 Bacteria 5381
654 nmdc:mga0a205_648637_c1 3300050515 Bacteria 907
655 Ga0495612_0136080 3300053078 Bacteria 1064
656 Ga0495655_0099377 3300053083 Bacteria 859
657 Ga0495619_0152934 3300053085 Bacteria 1592
658 Ga0495619_0230915 3300053085 Bacteria 1282
659 Ga0501084_0122947 3300054114 Bacteria 2183
660 Ga0501084_0339027 3300054114 Bacteria 1270
661 Ga0501084_0503020 3300054114 Bacteria 1024
662 Ga0501084_0672904 3300054114 Bacteria 873
663 Ga0590071_030886 3300059421 Bacteria 1277
664 Ga0501082_0103949 3300060353 Bacteria 2457
665 Ga0466962_0018478 3300061719 Bacteria 3353
666 Ga0530510_0310366 3300061734 Bacteria 1181
667 Ga0530510_0422724 3300061734 Bacteria 1006
668 Ga0081540_1045700
669 JGI24737J22298_10026853
670 JGI25406J46586_10003979
671 JGI25407J50210_10000402
672 JGI25407J50210_10010573
673 JGI25407J50210_10037589
674 JGI25407J50210_10092040
675 JGI25407J50210_10119504
676 JGI25407J50210_10123656
677 Ga0070658_11003207
678 Ga0070683_100106668
679 Ga0070683_100119386
680 Ga0070683_100540968
681 Ga0070683_100890055
682 Ga0070683_101263559
683 Ga0070670_100785793
684 Ga0070680_100731506
685 Ga0070682_100005415
686 Ga0070682_100054576
687 Ga0068868_100005015
688 Ga0068868_100066404
689 Ga0068868_100166484
690 Ga0068868_100362525
691 Ga0070660_100024690
692 Ga0070660_100089699
693 Ga0070660_100707387
694 Ga0070689_100216461
695 Ga0070691_10040257
696 Ga0070691_10147796
697 Ga0070687_100418921
698 Ga0070687_100615505
699 Ga0070687_101172273
700 Ga0070661_100109928
701 Ga0070661_100756164
702 Ga0070692_10085428
703 Ga0070692_10389631
704 Ga0070692_10697340
705 Ga0070668_100003276
706 Ga0070668_101181198
707 Ga0070668_101816343
708 Ga0070669_100256596
709 Ga0070675_100036996
710 Ga0070671_100530832
711 Ga0070674_100395212
712 Ga0070674_101645741
713 Ga0070673_100398079
714 Ga0070688_100043652
715 Ga0070688_100196115
716 Ga0070659_100000013
717 Ga0070659_100067281
718 Ga0070659_100109890
719 Ga0070659_100128872
720 Ga0070659_100667861
721 Ga0070659_101550531
722 Ga0070709_10795584
723 Ga0070709_10944427
724 Ga0070709_11089035
725 Ga0070714_100000321
726 Ga0070714_100024377
727 Ga0070714_100288458
728 Ga0070714_100364803
729 Ga0070714_101351683
730 Ga0070713_100097877
731 Ga0070710_10000005
732 Ga0070710_10376368
733 Ga0070701_10144129
734 Ga0070701_10164934
735 Ga0070701_10208233
736 Ga0070711_100100593
737 Ga0070711_100473747
738 Ga0070705_100000913
739 Ga0070705_101270243
740 Ga0070700_100000208
741 Ga0070700_100045504
742 Ga0070700_100137601
743 Ga0070700_100387905
744 Ga0070708_100671258
745 Ga0070663_100118053
746 Ga0070663_100152366
747 Ga0070663_100267667
748 Ga0070678_100013850
749 Ga0070678_100257199
750 Ga0070678_100965366
751 Ga0070662_100003740
752 Ga0070662_100395558
753 Ga0070662_100532845
754 Ga0068867_100568731
755 Ga0070685_10379521
756 Ga0070685_10488628
757 Ga0070699_101935790
758 Ga0070684_100013531
759 Ga0070684_100094198
760 Ga0070684_100974333
761 Ga0070684_101526610
762 Ga0068853_101240568
763 Ga0070686_100090823
764 Ga0070695_100689538
765 Ga0070695_100795641
766 Ga0070696_100675459
767 Ga0070696_100687868
768 Ga0070696_101199614
769 Ga0070693_100415437
770 Ga0070665_100372110
771 Ga0070665_100592953
772 Ga0068855_100439070
773 Ga0068855_100572203
774 Ga0070664_100015629
775 Ga0070664_100025038
776 Ga0070664_100096987
777 Ga0070664_100130570
778 Ga0070664_100899793
779 Ga0070664_100984476
780 Ga0068857_100313502
781 Ga0068854_100354115
782 Ga0068856_100051257
783 Ga0068856_100110654
784 Ga0068856_101083678
785 Ga0070702_100020044
786 Ga0070702_100037406
787 Ga0070702_100052535
788 Ga0070702_100212889
789 Ga0070702_101349198
790 Ga0070702_101349454
791 Ga0070702_101350757
792 Ga0068852_100101978
793 Ga0068852_101031780
794 Ga0068852_101802519
795 Ga0068864_100019651
796 Ga0068864_100252413
797 Ga0068866_10495971
798 Ga0068861_100160404
799 Ga0068861_100851115
800 Ga0068870_10210972
801 Ga0068870_10341839
802 Ga0068863_100486163
803 Ga0068863_101325958
804 Ga0068858_100527757
805 Ga0068860_100258201
806 Ga0068860_100388512
807 Ga0068862_100253813
808 Ga0081455_10061461
809 Ga0081455_10256402
810 Ga0081538_10000039
811 Ga0081538_10000176
812 Ga0081538_10001077
813 Ga0081538_10001753
814 Ga0081538_10004551
815 Ga0081538_10004873
816 Ga0081538_10014301
817 Ga0081538_10022616
818 Ga0081538_10041254
819 Ga0081538_10056187
820 Ga0081538_10068180
821 Ga0081538_10076628
822 Ga0081538_10107275
823 Ga0081538_10162501
824 Ga0081538_10205169
825 Ga0081538_10227156
826 Ga0081540_1056230
827 Ga0081539_10000479
828 Ga0081539_10021377
829 Ga0070717_10000004
830 Ga0070717_10126936
831 Ga0075365_10359951
832 Ga0075363_100146789
833 Ga0075363_100339351
834 Ga0075432_10078120
835 Ga0075432_10080304
836 Ga0075432_10121719
837 Ga0070716_100347111
838 Ga0070716_100838022
839 Ga0070712_100648609
840 Ga0075367_10363764
841 Ga0075428_100019910
842 Ga0075428_100062288
843 Ga0075428_100475500
844 Ga0075428_100500207
845 Ga0075430_100005776
846 Ga0075430_100167431
847 Ga0075430_100932680
848 Ga0075430_101043233
849 Ga0075430_101459123
850 Ga0075431_100001288
851 Ga0075431_100147830
852 Ga0075431_100173069
853 Ga0075431_100308175
854 Ga0075431_101278221
855 Ga0075433_10047635
856 Ga0075433_10308580
857 Ga0075433_10345256
858 Ga0075434_100291299
859 Ga0075429_100072438
860 Ga0075429_100110009
861 Ga0075429_100179753
862 Ga0075429_100294216
863 Ga0075429_100502039
864 Ga0075429_100801623
865 Ga0068865_100019379
866 Ga0068865_100057751
867 Ga0068865_100376677
868 Ga0068865_101111184
869 Ga0068865_101295043
870 Ga0075436_100063918
871 Ga0075436_100588941
872 Ga0075435_100655214
873 Ga0075435_101740421
874 Ga0105244_10528156
875 Ga0105240_10013077
876 Ga0105240_10071805
877 Ga0111539_10065958
878 Ga0111539_10069628
879 Ga0111539_10074021
880 Ga0111539_10189507
881 Ga0111539_10262511
882 Ga0111539_10547153
883 Ga0111539_10814414
884 Ga0111539_11350247
885 Ga0105245_10004192
886 Ga0105245_10166815
887 Ga0105245_10502986
888 Ga0105245_10505672
889 Ga0105245_10704089
890 Ga0105245_10836907
891 Ga0105245_12229783
892 Ga0105247_10122327
893 Ga0114129_10022764
894 Ga0114129_10112985
895 Ga0114129_10306880
896 Ga0114129_10350669
897 Ga0114129_10800956
898 Ga0114129_11102515
899 Ga0114129_11213317
900 Ga0105243_10222795
901 Ga0105243_10495920
902 Ga0105243_10945796
903 Ga0105243_11314388
904 Ga0105241_10584959
905 Ga0105242_10257966
906 Ga0105242_11048302
907 Ga0105242_11930289
908 Ga0105248_10339808
909 Ga0105248_10480502
910 Ga0105238_11950070
911 Ga0105249_10004994
912 Ga0105249_10129845
913 Ga0105249_10644626
914 Ga0105249_10880303
915 Ga0105239_10356868
916 Ga0105239_10470039
917 Ga0105239_10473613
918 Ga0105239_10608134
919 Ga0105246_10040487
920 Ga0105246_10116879
921 Ga0105246_10356034
922 Ga0105246_11116457
923 Ga0157371_10248428
924 Ga0157374_10012906
925 Ga0157378_11306999
926 Ga0163162_10113893
927 Ga0163162_10190877
928 Ga0163162_10276540
929 Ga0163162_10816127
930 Ga0157372_10014117
931 Ga0157372_10761145
932 Ga0157375_10239292
933 Ga0157375_11056640
934 Ga0163163_10398657
935 Ga0163163_10411282
936 Ga0157380_10196800
937 Ga0157380_10395514
938 Ga0157380_10445720
939 Ga0157377_10053480
940 Ga0157377_10123153
941 Ga0157377_10694507
942 Ga0157379_10747094
943 Ga0157379_10837210
944 Ga0157376_10312467
945 Ga0157376_10608222
946 Ga0163161_10296244
947 Ga0207656_10207633
948 Ga0207692_10000009
949 Ga0207692_10122973
950 Ga0207642_10077896
951 Ga0207710_10132924
952 Ga0207688_10000173
953 Ga0207688_10051861
954 Ga0207688_10396461
955 Ga0207647_10082645
956 Ga0207647_10107251
957 Ga0207645_10197128
958 Ga0207643_10235399
959 Ga0207643_10648765
960 Ga0207705_10050734
961 Ga0207695_10008385
962 Ga0207693_10034417
963 Ga0207693_10096940
964 Ga0207693_10225744
965 Ga0207663_10031505
966 Ga0207663_10282246
967 Ga0207663_10685250
968 Ga0207662_10054679
969 Ga0207662_10418747
970 Ga0207662_10539300
971 Ga0207657_10076660
972 Ga0207657_10077259
973 Ga0207657_10126359
974 Ga0207652_10479955
975 Ga0207652_10853355
976 Ga0207681_10003194
977 Ga0207681_10096635
978 Ga0207650_10270985
979 Ga0207687_10022588
980 Ga0207687_10049740
981 Ga0207687_10241389
982 Ga0207687_10246853
983 Ga0207687_10348479
984 Ga0207687_10589547
985 Ga0207700_10012007
986 Ga0207700_10059752
987 Ga0207664_10000006
988 Ga0207664_10001067
989 Ga0207664_10037086
990 Ga0207664_10041715
991 Ga0207664_10362238
992 Ga0207664_11739188
993 Ga0207644_10833007
994 Ga0207690_10000017
995 Ga0207690_10040931
996 Ga0207690_10357230
997 Ga0207690_10479209
998 Ga0207690_11090631
999 Ga0207706_10002121
1000 Ga0207706_10148131
1001 Ga0207706_10227908
1002 Ga0207706_10942917
1003 Ga0207686_10218807
1004 Ga0207686_10677730
1005 Ga0207709_10025915
1006 Ga0207709_10079506
1007 Ga0207709_10196154
1008 Ga0207709_11221342
1009 Ga0207670_10160744
1010 Ga0207669_10158103
1011 Ga0207669_10460177
1012 Ga0207669_11041550
1013 Ga0207704_10128959
1014 Ga0207704_10184656
1015 Ga0207704_10587971
1016 Ga0207704_11010172
1017 Ga0207704_11216624
1018 Ga0207665_10380428
1019 Ga0207691_10246616
1020 Ga0207711_10413077
1021 Ga0207689_10018466
1022 Ga0207661_10085225
1023 Ga0207661_10132991
1024 Ga0207661_10403168
1025 Ga0207661_10522040
1026 Ga0207661_10530348
1027 Ga0207661_10567101
1028 Ga0207661_10818977
1029 Ga0207661_11709657
1030 Ga0207679_10022403
1031 Ga0207679_10047284
1032 Ga0207679_10076261
1033 Ga0207679_10155804
1034 Ga0207679_10582627
1035 Ga0207667_10334539
1036 Ga0207667_11654257
1037 Ga0207651_10018221
1038 Ga0207651_10197026
1039 Ga0207712_10018732
1040 Ga0207712_10019147
1041 Ga0207668_10015827
1042 Ga0207668_10201489
1043 Ga0207668_10361196
1044 Ga0207668_11637200
1045 Ga0207640_10116242
1046 Ga0207640_11066477
1047 Ga0207658_10203438
1048 Ga0207677_10040429
1049 Ga0207677_10054838
1050 Ga0207677_10064036
1051 Ga0207677_10385214
1052 Ga0207677_11558312
1053 Ga0207703_11941385
1054 Ga0207639_10275187
1055 Ga0207678_10026049
1056 Ga0207678_10188002
1057 Ga0207678_10247365
1058 Ga0207678_10423939
1059 Ga0207708_10000372
1060 Ga0207708_10058786
1061 Ga0207708_10116092
1062 Ga0207708_10496805
1063 Ga0207708_10867309
1064 Ga0207702_10079890
1065 Ga0207641_10381592
1066 Ga0207641_11666249
1067 Ga0207648_10062690
1068 Ga0207676_10141366
1069 Ga0207676_10995103
1070 Ga0207676_11589461
1071 Ga0207674_10049576
1072 Ga0207674_10566323
1073 Ga0207675_100023988
1074 Ga0207675_100040564
1075 Ga0207675_100046907
1076 Ga0207675_100249761
1077 Ga0207675_101552507
1078 Ga0207683_10018981
1079 Ga0207683_10289473
1080 Ga0207683_10617190
1081 Ga0207698_10334894
1082 Ga0207428_10009623
1083 Ga0207428_10032641
1084 Ga0207428_10141889
1085 Ga0207428_10259007
1086 Ga0207428_10355987
1087 Ga0268266_10132550
1088 Ga0268265_10512146
1089 Ga0268265_10524319
1090 Ga0265326_10000060
1091 Ga0265319_1010068
1092 Ga0265334_10000012
1093 Ga0265336_10031358
1094 Ga0265338_10007865
1095 Ga0265324_10007415
1096 Ga0307405_10083670
1097 Ga0307413_10076513
1098 Ga0307413_10279591
1099 Ga0307413_11483040
1100 Ga0307410_10074993
1101 Ga0307410_10482840
1102 Ga0307410_10579624
1103 Ga0307406_10995410
1104 Ga0307407_10154050
1105 Ga0307407_10393058
1106 Ga0307407_10650987
1107 Ga0307407_11152740
1108 Ga0307412_10135479
1109 Ga0307412_10337516
1110 Ga0307409_100101232
1111 Ga0307409_100193180
1112 Ga0307409_100222819
1113 Ga0307409_100406428
1114 Ga0307409_100461410
1115 Ga0307409_101213439
1116 Ga0307409_101431483
1117 Ga0307409_101441596
1118 Ga0307409_101554839
1119 Ga0307416_100550012
1120 Ga0307416_100551814
1121 Ga0307416_100834118
1122 Ga0307416_101533678
1123 Ga0307416_103289050
1124 Ga0307414_10377908
1125 Ga0307414_10975318
1126 Ga0307414_11105894
1127 Ga0307411_10091717
1128 Ga0307411_10150244
1129 Ga0307411_11348886
1130 Ga0307415_100045901
1131 Ga0307415_100145537
1132 Ga0307415_100155828
1133 Ga0307415_100290278
1134 Ga0307415_100378148
1135 Ga0307415_100530063
1136 Ga0307415_100830484
1137 Ga0307415_101461331
1138 Ga0307415_102159173
1139 Ga0373958_0060392
1140 Ga0373961_0359585
1141 Ga0373931_0034206
1142 Ga0373931_0139212
1143 Ga0373935_1308372
1144 Ga0395900_0370588
1145 Ga0395900_0725704
1146 Ga0395898_0220697
1147 Ga0395898_0340495
1148 Ga0395898_0403470
1149 Ga0395905_0384324
1150 Ga0395905_1056784
1151 Ga0395901_0014215
1152 Ga0395901_0279669
1153 Ga0395901_1175289
1154 Ga0451793_0121453
1155 Ga0451853_0883447
1156 Ga0451853_2752564
1157 Ga0450888_006390
1158 Ga0450888_007652
1159 Ga0439460_0139490
1160 Ga0439440_0090986
1161 Ga0466964_0320213
1162 Ga0466957_0007196
1163 Ga0466967_0052798
1164 Ga0466967_0190376
1165 Ga0495653_0360059
1166 Ga0495596_0054617
1167 Ga0495596_0221495
1168 Ga0495620_0094475
1169 Ga0495628_1155647
1170 Ga0495637_0357095
1171 Ga0495652_0279555
1172 Ga0495656_0089865
1173 Ga0495668_0542860
1174 Ga0495657_0113935
1175 Ga0495658_0619636
1176 Ga0495624_0679140
1177 Ga0495589_0108216
1178 Ga0495589_0192354
1179 Ga0495589_0236178
1180 Ga0495679_178790
1181 Ga0495626_0310055
1182 Ga0496100_0059769
1183 Ga0496100_0463756
1184 Ga0496101_0059654
1185 Ga0496101_0260169
1186 Ga0496101_0296646
1187 Ga0496102_0433603
1188 Ga0496102_0496801
1189 Ga0496102_1500822
1190 Ga0496103_0040710
1191 Ga0496103_0124361
1192 Ga0496103_0206768
1193 Ga0496103_0408192
1194 Ga0496104_0000037
1195 Ga0496104_0001651
1196 Ga0496104_0057372
1197 Ga0496105_0009484
1198 Ga0496105_0017311
1199 Ga0496105_0072906
1200 Ga0496106_0017378
1201 Ga0496106_0113316
1202 Ga0496106_0248318
1203 Ga0496106_0282832
1204 Ga0496107_0007168
1205 Ga0496107_0128371
1206 Ga0496108_0000841
1207 Ga0496108_0027775
1208 Ga0496108_0467328
1209 Ga0496108_0997415
1210 Ga0496108_1333387
1211 Ga0496109_0084534
1212 Ga0496109_0097251
1213 Ga0496109_0424176
1214 Ga0496109_0446822
1215 Ga0496109_0500217
1216 Ga0496109_0515868
1217 Ga0496109_0533613
1218 Ga0496109_0872840
1219 Ga0496109_0957471
1220 Ga0496110_0000266
1221 Ga0496110_0009814
1222 Ga0496110_0036546
1223 Ga0496110_0140280
1224 Ga0496110_0838266
1225 Ga0496110_1335235
1226 Ga0496110_1471787
1227 Ga0496111_0000672
1228 Ga0496111_0010361
1229 Ga0496111_0147870
1230 Ga0496111_0180292
1231 Ga0496111_0957403
1232 Ga0496112_0008450
1233 Ga0496112_0094815
1234 Ga0496112_0236786
1235 Ga0496112_1482047
1236 Ga0496113_0005095
1237 Ga0496113_0274666
1238 Ga0496113_0756484
1239 Ga0496114_0206457
1240 Ga0496114_0695556
1241 Ga0496115_0000012
1242 Ga0496115_0000017
1243 Ga0496115_0069179
1244 Ga0501031_0245954
1245 Ga0501036_0112735
1246 Ga0501039_0731884
1247 Ga0501039_0797987
1248 Ga0501040_0021991
1249 Ga0501040_0650020
1250 Ga0501041_0186469
1251 Ga0501046_0597922
1252 Ga0501046_0995872
1253 Ga0501048_0376752
1254 Ga0501067_0157581
1255 Ga0501069_0346373
1256 Ga0501069_0645211
1257 Ga0501071_0045681
1258 Ga0501071_0472949
1259 Ga0501071_0681235
1260 Ga0501072_0300418
1261 Ga0501072_0515802
1262 Ga0501072_0533206
1263 Ga0501074_0726063
1264 Ga0501074_0910909
1265 Ga0501075_0584986
1266 Ga0501076_0182254
1267 Ga0501076_0676771
1268 Ga0501076_0933833
1269 Ga0501079_0085244
1270 Ga0501079_0405155
1271 Ga0501081_0090244
1272 Ga0501081_0162874
1273 Ga0501081_0554642
1274 Ga0501081_0709571
1275 Ga0501035_0505134
1276 Ga0501035_0613905
1277 Ga0501035_0995506
1278 Ga0501044_1268627
1279 Ga0501045_0204771
1280 Ga0501045_0662039
1281 nmdc:mga03n38_118070_c1
1282 nmdc:mga03n38_388145_c1
1283 nmdc:mga03n38_758463_c1
1284 nmdc:mga0yw44_99343_c1
1285 nmdc:mga05p37_1239002_c1
1286 nmdc:mga05p37_139912_c1
1287 nmdc:mga05p37_212594_c1
1288 nmdc:mga05p37_460255_c1
1289 nmdc:mga05p37_470817_c1
1290 nmdc:mga05p37_577580_c1
1291 nmdc:mga05p37_69764_c1
1292 nmdc:mga05p37_864573_c1
1293 nmdc:mga09592_19275_c1
1294 nmdc:mga09592_281622_c1
1295 nmdc:mga09592_40273_c1
1296 nmdc:mga09592_90965_c1
1297 nmdc:mga0qj67_1044192_c1
1298 nmdc:mga0qj67_139126_c1
1299 nmdc:mga0qj67_162391_c1
1300 nmdc:mga0qj67_17317_c1
1301 nmdc:mga0qj67_20849_c1
1302 nmdc:mga0qj67_562330_c1
1303 nmdc:mga06r32_18930_c1
1304 nmdc:mga06r32_245180_c1
1305 nmdc:mga06r32_2638_c1
1306 nmdc:mga06r32_721079_c1
1307 nmdc:mga08y16_294753_c1
1308 nmdc:mga08y16_405531_c1
1309 nmdc:mga08y16_41296_c1
1310 nmdc:mga08y16_778817_c1
1311 nmdc:mga08y16_813067_c1
1312 nmdc:mga0n895_19173_c1
1313 nmdc:mga0n895_587623_c1
1314 nmdc:mga0rr50_168850_c1
1315 nmdc:mga0rr50_941133_c1
1316 nmdc:mga08x19_290852_c1
1317 nmdc:mga08x19_759087_c1
1318 nmdc:mga0a205_1574687_c1
1319 nmdc:mga0a205_271193_c1
1320 nmdc:mga0a205_28035_c1
1321 nmdc:mga0a205_648637_c1
1322 Ga0495612_0136080
1323 Ga0495655_0099377
1324 Ga0495619_0152934
1325 Ga0495619_0230915
1326 Ga0501084_0122947
1327 Ga0501084_0339027
1328 Ga0501084_0503020
1329 Ga0501084_0672904
1330 Ga0590071_030886
1331 Ga0501082_0103949
1332 Ga0466962_0018478
1333 Ga0530510_0310366
1334 Ga0530510_0422724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

52

143

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.9241 81 144
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.9102 81 144
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.8576 79 144
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.8207 79 144
2k5h-assembly1.cif.gz_A solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a 0.808 73 141
ID Description Score Start End Superfamily
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9871 84 144 2.40.50.140
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9249 84 144 2.40.50.140
3cp0A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9226 81 144 2.40.50.140
3cp0A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9086 81 144 2.40.50.140
1un8B02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8789 30 62 1.25.40.340
ID Description Score Start End GO Terms
AF-A0A7G1IET6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.976 80 144
AF-K1RW40-F1-model_v4 Nodulation efficiency, NfeD 0.9589 86 144
AF-A0A256BNP3-F1-model_v4 Uncharacterized protein 0.9474 85 142
AF-A0A7G1IET6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9464 80 144
AF-A0A256BL57-F1-model_v4 Uncharacterized protein 0.9398 85 144

Map