F473824

General Info

Members Datasets Scaffolds Average Seq Length
667 280 667 423

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100174372|Ga0068855_1001743722
Length 461
Sequence MKLAFVIQRYGAEVLGGSEQLCRLLAERLATQHEVDVLTTCARDYVTWKNEYPEGTDRVRGVTIRRFANALTRDIESFNRYSDWIFSNPHSRSDEMEWLKQQGPWCPPLIEYLRRNHQQYDVLIFFTYLYATTVQGIEVNPGRSVLVPTAHDEPAITLDIYKDVFTKAGALCYLTDSERRFVQEQFPDRPLLEELIGVGIDLPQQQPYPRMPERQDDDAAPAADAHVNTDVEGVGSAALAEASGNPGFSDRSEDTPTETADAPGDQEVARYPSHLLSRGSVFRRRHRLHGPFALYGGRIDPGKGCEELLEYFAGYVKEGGEATLALMGAKLMPLPEDPSVRFAGLLSDNERIQALEAATVVICPSPYESLSLLALEALSVGTPILVNARSEVLVEHCVRSNGGLWYADRDEFVECLNLLVRDARLRAMLGRNGRDYVRTNYRWDIVLGKYERMFAKVRNAR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
184 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 4.2
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001158 3300002459 Bacteria 5643
2 Ga0065712_10068848 3300005290 Bacteria 8802
3 Ga0065712_10069564 3300005290 Bacteria 7049
4 Ga0065712_10117712 3300005290 Bacteria 1716
5 Ga0065707_10001377 3300005295 Bacteria 8301
6 Ga0065707_10106896 3300005295 Bacteria 2576
7 Ga0065707_10117683 3300005295 Bacteria 2189
8 Ga0070676_10015175 3300005328 Bacteria 4247
9 Ga0070683_100002681 3300005329 Bacteria 14230
10 Ga0070690_100051254 3300005330 Bacteria 2634
11 Ga0070690_100057147 3300005330 Bacteria 2503
12 Ga0070670_100006560 3300005331 Bacteria 9857
13 Ga0070670_100032413 3300005331 Bacteria 4501
14 Ga0068869_100061753 3300005334 Bacteria 2749
15 Ga0068869_100103708 3300005334 Unclassified 2155
16 Ga0070666_10039811 3300005335 Unclassified 3135
17 Ga0070666_10049715 3300005335 Bacteria 2819
18 Ga0070666_10176202 3300005335 Bacteria 1499
19 Ga0068868_100055744 3300005338 Bacteria 3120
20 Ga0068868_100144699 3300005338 Bacteria 1954
21 Ga0070689_100004045 3300005340 Bacteria 9867
22 Ga0070689_100075720 3300005340 Bacteria 2635
23 Ga0070689_100181020 3300005340 Bacteria 1712
24 Ga0070691_10002086 3300005341 Bacteria 8838
25 Ga0070687_100021027 3300005343 Bacteria 3060
26 Ga0070668_100039083 3300005347 Bacteria 3629
27 Ga0070668_100133655 3300005347 Bacteria 1993
28 Ga0070668_100164549 3300005347 Bacteria 1802
29 Ga0070669_100000622 3300005353 Bacteria 26211
30 Ga0070669_100015230 3300005353 Bacteria 5477
31 Ga0070669_100049939 3300005353 Bacteria 3055
32 Ga0070669_100102880 3300005353 Bacteria 2157
33 Ga0070669_100188684 3300005353 Unclassified 1616
34 Ga0070675_100001360 3300005354 Bacteria 17903
35 Ga0070675_100068176 3300005354 Bacteria 2946
36 Ga0070675_100139288 3300005354 Bacteria 2073
37 Ga0070671_100024333 3300005355 Bacteria 4956
38 Ga0070674_100005846 3300005356 Bacteria 7151
39 Ga0070674_100021777 3300005356 Bacteria 4123
40 Ga0070673_100005813 3300005364 Bacteria 7946
41 Ga0070688_100039373 3300005365 Bacteria 2892
42 Ga0070688_100055951 3300005365 Bacteria 2476
43 Ga0070688_100078098 3300005365 Bacteria 2135
44 Ga0070659_100043785 3300005366 Bacteria 3502
45 Ga0070667_100033513 3300005367 Bacteria 4294
46 Ga0070667_100162568 3300005367 Unclassified 1967
47 Ga0070713_100006103 3300005436 Bacteria 8312
48 Ga0070701_10000954 3300005438 Bacteria 10486
49 Ga0070701_10028064 3300005438 Bacteria 2764
50 Ga0070705_100030206 3300005440 Bacteria 2989
51 Ga0070705_100054740 3300005440 Bacteria 2342
52 Ga0070694_100091885 3300005444 Bacteria 2131
53 Ga0070708_100149137 3300005445 Bacteria 2174
54 Ga0070678_100131329 3300005456 Bacteria 1990
55 Ga0070662_100040145 3300005457 Bacteria 3331
56 Ga0070681_10020649 3300005458 Bacteria 6599
57 Ga0068867_100003453 3300005459 Bacteria 11115
58 Ga0068867_100053704 3300005459 Bacteria 2976
59 Ga0068867_100130968 3300005459 Unclassified 1949
60 Ga0068867_100136177 3300005459 Unclassified 1915
61 Ga0070707_100066645 3300005468 Bacteria 3461
62 Ga0070707_100257523 3300005468 Bacteria 1698
63 Ga0070698_100056026 3300005471 Bacteria 3995
64 Ga0070698_100218919 3300005471 Unclassified 1838
65 Ga0070699_100000613 3300005518 Bacteria 33675
66 Ga0070699_100261693 3300005518 Unclassified 1547
67 Ga0070679_100100370 3300005530 Bacteria 2881
68 Ga0070684_100000296 3300005535 Bacteria 34560
69 Ga0070684_100049573 3300005535 Bacteria 3645
70 Ga0070697_100022134 3300005536 Bacteria 5043
71 Ga0070672_100004683 3300005543 Bacteria 8969
72 Ga0070686_100000398 3300005544 Bacteria 27472
73 Ga0070686_100138497 3300005544 Bacteria 1691
74 Ga0070695_100004151 3300005545 Bacteria 8466
75 Ga0070695_100037685 3300005545 Bacteria 3048
76 Ga0070696_100006167 3300005546 Bacteria 8009
77 Ga0070696_100101850 3300005546 Bacteria 2059
78 Ga0070693_100006549 3300005547 Bacteria 5649
79 Ga0070693_100021115 3300005547 Bacteria 3446
80 Ga0070665_100002176 3300005548 Bacteria 21848
81 Ga0070665_100022887 3300005548 Bacteria 6291
82 Ga0070665_100159982 3300005548 Unclassified 2254
83 Ga0070704_100004365 3300005549 Bacteria 8169
84 Ga0070704_100044031 3300005549 Bacteria 3099
85 Ga0068855_100039380 3300005563 Bacteria 5611
86 Ga0068855_100174372 3300005563 Bacteria 2434
87 Ga0068855_100297026 3300005563 Bacteria 1789
88 Ga0070664_100018420 3300005564 Bacteria 5736
89 Ga0070664_100097895 3300005564 Bacteria 2548
90 Ga0068857_100094445 3300005577 Unclassified 2678
91 Ga0068854_100004892 3300005578 Bacteria 8449
92 Ga0068854_100087739 3300005578 Bacteria 2308
93 Ga0070702_100021477 3300005615 Bacteria 3397
94 Ga0068859_100003307 3300005617 Bacteria 16387
95 Ga0068859_100023420 3300005617 Bacteria 6196
96 Ga0068859_100146147 3300005617 Bacteria 2439
97 Ga0068859_100281755 3300005617 Bacteria 1755
98 Ga0068864_100002493 3300005618 Bacteria 15218
99 Ga0068864_100021764 3300005618 Bacteria 5371
100 Ga0068866_10037558 3300005718 Bacteria 2379
101 Ga0068861_100000413 3300005719 Bacteria 24723
102 Ga0068861_100088694 3300005719 Bacteria 2436
103 Ga0068863_100004381 3300005841 Bacteria 13919
104 Ga0068863_100025405 3300005841 Bacteria 5648
105 Ga0068858_100001614 3300005842 Bacteria 22989
106 Ga0068858_100007374 3300005842 Bacteria 10643
107 Ga0068858_100021865 3300005842 Bacteria 5974
108 Ga0068858_100034888 3300005842 Bacteria 4666
109 Ga0068858_100177072 3300005842 Unclassified 2013
110 Ga0068858_100228784 3300005842 Bacteria 1762
111 Ga0068860_100025269 3300005843 Bacteria 5732
112 Ga0068860_100056083 3300005843 Bacteria 3747
113 Ga0068860_100116559 3300005843 Bacteria 2556
114 Ga0068860_100151713 3300005843 Bacteria 2231
115 Ga0068860_100223461 3300005843 Bacteria 1829
116 Ga0068860_100236808 3300005843 Unclassified 1775
117 Ga0068862_100092634 3300005844 Bacteria 2634
118 Ga0068862_100121508 3300005844 Bacteria 2302
119 Ga0081455_10017270 3300005937 Bacteria 6925
120 Ga0081455_10066961 3300005937 Bacteria 2995
121 Ga0081539_10010419 3300005985 Bacteria 7553
122 Ga0070717_10043490 3300006028 Bacteria 3667
123 Ga0075365_10006494 3300006038 Bacteria 6439
124 Ga0075364_10003347 3300006051 Bacteria 9094
125 Ga0075364_10004372 3300006051 Bacteria 8115
126 Ga0070715_10030456 3300006163 Bacteria 2182
127 Ga0075362_10000228 3300006177 Bacteria 15674
128 Ga0075367_10005874 3300006178 Bacteria 6152
129 Ga0075367_10006108 3300006178 Bacteria 6054
130 Ga0075367_10015401 3300006178 Bacteria 4155
131 Ga0075366_10003831 3300006195 Bacteria 8010
132 Ga0097621_100000956 3300006237 Bacteria 20258
133 Ga0097621_100001586 3300006237 Bacteria 15557
134 Ga0097621_100038470 3300006237 Bacteria 3839
135 Ga0097621_100154988 3300006237 Bacteria 1966
136 Ga0075370_10005896 3300006353 Bacteria 6127
137 Ga0068871_100001365 3300006358 Bacteria 16365
138 Ga0068871_100018930 3300006358 Bacteria 5247
139 Ga0068871_100107878 3300006358 Bacteria 2339
140 Ga0075428_100000034 3300006844 Bacteria 115982
141 Ga0075428_100002999 3300006844 Bacteria 18417
142 Ga0075428_100003031 3300006844 Bacteria 18347
143 Ga0075428_100004161 3300006844 Bacteria 15927
144 Ga0075428_100019276 3300006844 Bacteria 7548
145 Ga0075428_100054654 3300006844 Bacteria 4375
146 Ga0075428_100139456 3300006844 Bacteria 2636
147 Ga0075430_100003478 3300006846 Bacteria 13175
148 Ga0075430_100067543 3300006846 Bacteria 3001
149 Ga0075430_100072088 3300006846 Bacteria 2897
150 Ga0075431_100010127 3300006847 Bacteria 9474
151 Ga0075431_100022064 3300006847 Bacteria 6511
152 Ga0075431_100030339 3300006847 Bacteria 5568
153 Ga0075431_100032202 3300006847 Bacteria 5402
154 Ga0075431_100079221 3300006847 Bacteria 3391
155 Ga0075433_10022893 3300006852 Bacteria 5250
156 Ga0075433_10026243 3300006852 Bacteria 4930
157 Ga0075433_10030578 3300006852 Bacteria 4596
158 Ga0075433_10105219 3300006852 Bacteria 2500
159 Ga0075434_100000878 3300006871 Bacteria 24045
160 Ga0075434_100029094 3300006871 Bacteria 5433
161 Ga0075434_100036218 3300006871 Bacteria 4881
162 Ga0075434_100144130 3300006871 Bacteria 2402
163 Ga0075434_100196110 3300006871 Unclassified 2039
164 Ga0075429_100000822 3300006880 Bacteria 24352
165 Ga0075429_100002301 3300006880 Bacteria 16031
166 Ga0075429_100117818 3300006880 Bacteria 2321
167 Ga0075429_100132721 3300006880 Bacteria 2179
168 Ga0068865_100010765 3300006881 Bacteria 5703
169 Ga0075436_100006788 3300006914 Bacteria 7833
170 Ga0075436_100015343 3300006914 Bacteria 5248
171 Ga0075436_100023673 3300006914 Unclassified 4218
172 Ga0075436_100042574 3300006914 Bacteria 3132
173 Ga0097620_100003307 3300006931 Bacteria 16387
174 Ga0097620_100023420 3300006931 Bacteria 6196
175 Ga0097620_100146147 3300006931 Bacteria 2439
176 Ga0097620_100281756 3300006931 Bacteria 1755
177 Ga0075435_100000346 3300007076 Bacteria 28639
178 Ga0075435_100000679 3300007076 Bacteria 21089
179 Ga0075435_100002619 3300007076 Bacteria 11989
180 Ga0075435_100004536 3300007076 Bacteria 9548
181 Ga0075435_100005712 3300007076 Bacteria 8721
182 Ga0105240_10023069 3300009093 Bacteria 8242
183 Ga0111539_10000014 3300009094 Bacteria 307501
184 Ga0111539_10000341 3300009094 Bacteria 57424
185 Ga0111539_10002441 3300009094 Bacteria 24713
186 Ga0111539_10004791 3300009094 Bacteria 17654
187 Ga0111539_10011360 3300009094 Bacteria 11179
188 Ga0111539_10032816 3300009094 Bacteria 6305
189 Ga0111539_10065903 3300009094 Unclassified 4278
190 Ga0111539_10087941 3300009094 Bacteria 3650
191 Ga0111539_10172107 3300009094 Bacteria 2530
192 Ga0105245_10007142 3300009098 Bacteria 9796
193 Ga0105245_10017071 3300009098 Bacteria 6334
194 Ga0105245_10055351 3300009098 Bacteria 3563
195 Ga0105245_10261961 3300009098 Bacteria 1683
196 Ga0105247_10027016 3300009101 Bacteria 3470
197 Ga0105247_10053301 3300009101 Bacteria 2495
198 Ga0105247_10089183 3300009101 Bacteria 1955
199 Ga0114129_10000162 3300009147 Bacteria 71781
200 Ga0114129_10001494 3300009147 Bacteria 31640
201 Ga0114129_10001979 3300009147 Bacteria 28017
202 Ga0114129_10003915 3300009147 Bacteria 21010
203 Ga0114129_10004232 3300009147 Bacteria 20267
204 Ga0114129_10006811 3300009147 Bacteria 16229
205 Ga0114129_10009633 3300009147 Bacteria 13783
206 Ga0114129_10010441 3300009147 Bacteria 13244
207 Ga0114129_10013735 3300009147 Bacteria 11544
208 Ga0114129_10029670 3300009147 Bacteria 7745
209 Ga0114129_10052603 3300009147 Bacteria 5716
210 Ga0114129_10055038 3300009147 Bacteria 5576
211 Ga0114129_10078021 3300009147 Bacteria 4607
212 Ga0114129_10127174 3300009147 Bacteria 3503
213 Ga0114129_10198136 3300009147 Bacteria 2722
214 Ga0114129_10232177 3300009147 Bacteria 2484
215 Ga0105243_10006372 3300009148 Bacteria 9117
216 Ga0105241_10057507 3300009174 Bacteria 2984
217 Ga0105241_10191700 3300009174 Unclassified 1702
218 Ga0105242_10004909 3300009176 Bacteria 10351
219 Ga0105242_10017911 3300009176 Bacteria 5531
220 Ga0105242_10058986 3300009176 Bacteria 3148
221 Ga0105242_10141024 3300009176 Bacteria 2091
222 Ga0105242_10166578 3300009176 Unclassified 1934
223 Ga0105248_10009770 3300009177 Bacteria 10570
224 Ga0105248_10027721 3300009177 Bacteria 6307
225 Ga0105248_10036771 3300009177 Bacteria 5476
226 Ga0105248_10051860 3300009177 Bacteria 4603
227 Ga0105248_10253545 3300009177 Bacteria 1980
228 Ga0105248_10361829 3300009177 Unclassified 1633
229 Ga0105237_10358350 3300009545 Unclassified 1463
230 Ga0105249_10021108 3300009553 Bacteria 5829
231 Ga0105249_10041421 3300009553 Bacteria 4187
232 Ga0105249_10389112 3300009553 Bacteria 1422
233 Ga0157378_10030313 3300013297 Bacteria 4780
234 Ga0163162_10007328 3300013306 Bacteria 10721
235 Ga0163162_10265269 3300013306 Bacteria 1849
236 Ga0157375_10184391 3300013308 Unclassified 2240
237 Ga0157375_10246973 3300013308 Bacteria 1945
238 Ga0163163_10000042 3300014325 Bacteria 138794
239 Ga0163163_10006204 3300014325 Bacteria 10426
240 Ga0163163_10111182 3300014325 Bacteria 2769
241 Ga0163163_10269454 3300014325 Bacteria 1754
242 Ga0157380_10037082 3300014326 Bacteria 3776
243 Ga0157380_10081302 3300014326 Bacteria 2650
244 Ga0157380_10123434 3300014326 Bacteria 2197
245 Ga0157379_10041814 3300014968 Bacteria 4091
246 Ga0157379_10118462 3300014968 Bacteria 2382
247 Ga0157379_10130196 3300014968 Bacteria 2264
248 Ga0157379_10139997 3300014968 Unclassified 2181
249 Ga0157376_10063670 3300014969 Bacteria 3108
250 Ga0157376_10106949 3300014969 Bacteria 2455
251 Ga0157376_10252474 3300014969 Bacteria 1648
252 Ga0157376_10304445 3300014969 Bacteria 1510
253 Ga0207697_10000393 3300025315 Bacteria 24614
254 Ga0207682_10019050 3300025893 Unclassified 2686
255 Ga0207682_10030495 3300025893 Bacteria 2160
256 Ga0207710_10012971 3300025900 Bacteria 3511
257 Ga0207688_10024502 3300025901 Bacteria 3309
258 Ga0207688_10049866 3300025901 Unclassified 2341
259 Ga0207680_10057438 3300025903 Bacteria 2354
260 Ga0207647_10059036 3300025904 Bacteria 2348
261 Ga0207645_10003141 3300025907 Bacteria 12665
262 Ga0207645_10003173 3300025907 Bacteria 12589
263 Ga0207707_10021944 3300025912 Bacteria 5580
264 Ga0207707_10024587 3300025912 Bacteria 5272
265 Ga0207671_10320056 3300025914 Bacteria 1227
266 Ga0207662_10077793 3300025918 Bacteria 2018
267 Ga0207649_10102916 3300025920 Unclassified 1894
268 Ga0207652_10018502 3300025921 Bacteria 5717
269 Ga0207646_10223324 3300025922 Bacteria 1702
270 Ga0207681_10005978 3300025923 Bacteria 7464
271 Ga0207681_10071419 3300025923 Bacteria 2421
272 Ga0207681_10080522 3300025923 Bacteria 2297
273 Ga0207681_10102419 3300025923 Bacteria 2067
274 Ga0207650_10009788 3300025925 Bacteria 6553
275 Ga0207659_10074984 3300025926 Bacteria 2481
276 Ga0207700_10020049 3300025928 Bacteria 4531
277 Ga0207700_10121147 3300025928 Bacteria 2121
278 Ga0207644_10024422 3300025931 Bacteria 4149
279 Ga0207690_10101915 3300025932 Bacteria 2052
280 Ga0207706_10037640 3300025933 Bacteria 4295
281 Ga0207706_10149531 3300025933 Bacteria 2054
282 Ga0207686_10001273 3300025934 Bacteria 14490
283 Ga0207686_10071733 3300025934 Bacteria 2230
284 Ga0207709_10069011 3300025935 Bacteria 2236
285 Ga0207670_10016523 3300025936 Bacteria 4438
286 Ga0207669_10004136 3300025937 Bacteria 6360
287 Ga0207704_10002599 3300025938 Bacteria 8145
288 Ga0207704_10129605 3300025938 Bacteria 1744
289 Ga0207691_10002022 3300025940 Bacteria 19849
290 Ga0207711_10026403 3300025941 Bacteria 4873
291 Ga0207711_10043255 3300025941 Bacteria 3841
292 Ga0207711_10061858 3300025941 Bacteria 3228
293 Ga0207711_10102191 3300025941 Bacteria 2537
294 Ga0207661_10000429 3300025944 Bacteria 27131
295 Ga0207661_10104141 3300025944 Bacteria 2389
296 Ga0207679_10006877 3300025945 Bacteria 7210
297 Ga0207679_10029141 3300025945 Bacteria 3841
298 Ga0207679_10266354 3300025945 Bacteria 1464
299 Ga0207667_10306731 3300025949 Bacteria 1622
300 Ga0207651_10011390 3300025960 Bacteria 4979
301 Ga0207651_10025134 3300025960 Bacteria 3698
302 Ga0207712_10018526 3300025961 Bacteria 4536
303 Ga0207712_10089853 3300025961 Bacteria 2259
304 Ga0207668_10095231 3300025972 Bacteria 2197
305 Ga0207640_10011564 3300025981 Bacteria 5001
306 Ga0207658_10032995 3300025986 Bacteria 3690
307 Ga0207658_10137274 3300025986 Bacteria 1974
308 Ga0207677_10019524 3300026023 Bacteria 4095
309 Ga0207677_10050250 3300026023 Bacteria 2819
310 Ga0207677_10056134 3300026023 Bacteria 2696
311 Ga0207703_10004455 3300026035 Bacteria 11505
312 Ga0207703_10004637 3300026035 Bacteria 11231
313 Ga0207703_10048095 3300026035 Bacteria 3441
314 Ga0207703_10056825 3300026035 Bacteria 3189
315 Ga0207703_10071876 3300026035 Unclassified 2858
316 Ga0207703_10084295 3300026035 Bacteria 2657
317 Ga0207703_10286660 3300026035 Bacteria 1497
318 Ga0207678_10028860 3300026067 Bacteria 4844
319 Ga0207678_10050742 3300026067 Bacteria 3584
320 Ga0207708_10042030 3300026075 Bacteria 3485
321 Ga0207708_10094975 3300026075 Bacteria 2302
322 Ga0207641_10002396 3300026088 Bacteria 17302
323 Ga0207641_10024194 3300026088 Bacteria 5006
324 Ga0207641_10129657 3300026088 Bacteria 2263
325 Ga0207648_10005077 3300026089 Bacteria 13342
326 Ga0207648_10009859 3300026089 Bacteria 9109
327 Ga0207648_10033008 3300026089 Bacteria 4567
328 Ga0207648_10069175 3300026089 Bacteria 3076
329 Ga0207648_10087812 3300026089 Bacteria 2714
330 Ga0207676_10348754 3300026095 Bacteria 1368
331 Ga0207674_10034107 3300026116 Bacteria 5323
332 Ga0207674_10085973 3300026116 Bacteria 3139
333 Ga0207675_100000511 3300026118 Bacteria 37642
334 Ga0207675_100024641 3300026118 Bacteria 5594
335 Ga0207675_100058162 3300026118 Bacteria 3608
336 Ga0207675_100080110 3300026118 Bacteria 3061
337 Ga0207675_100120274 3300026118 Bacteria 2484
338 Ga0207675_100138244 3300026118 Bacteria 2313
339 Ga0207675_100152372 3300026118 Bacteria 2201
340 Ga0207675_100212155 3300026118 Bacteria 1863
341 Ga0207683_10047807 3300026121 Bacteria 3747
342 Ga0207683_10072146 3300026121 Bacteria 3054
343 Ga0207428_10000005 3300027907 Bacteria 520045
344 Ga0207428_10000816 3300027907 Bacteria 35146
345 Ga0207428_10000998 3300027907 Bacteria 31385
346 Ga0207428_10001623 3300027907 Bacteria 23347
347 Ga0207428_10025669 3300027907 Bacteria 4929
348 Ga0207428_10128369 3300027907 Unclassified 1941
349 Ga0268266_10002791 3300028379 Bacteria 18207
350 Ga0268266_10002943 3300028379 Bacteria 17587
351 Ga0268266_10069550 3300028379 Bacteria 3050
352 Ga0268265_10070434 3300028380 Bacteria 2719
353 Ga0268265_10088139 3300028380 Unclassified 2472
354 Ga0268264_10148062 3300028381 Bacteria 2102
355 Ga0268264_10219425 3300028381 Bacteria 1750
356 Ga0307408_100003522 3300031548 Bacteria 10656
357 Ga0307408_100042020 3300031548 Bacteria 3244
358 Ga0307408_100074645 3300031548 Bacteria 2517
359 Ga0307405_10010720 3300031731 Bacteria 4765
360 Ga0307405_10088012 3300031731 Bacteria 2048
361 Ga0307413_10162999 3300031824 Bacteria 1568
362 Ga0307410_10019796 3300031852 Bacteria 4102
363 Ga0307406_10030987 3300031901 Bacteria 3253
364 Ga0307406_10144779 3300031901 Bacteria 1687
365 Ga0307412_10089321 3300031911 Bacteria 2151
366 Ga0307409_100040993 3300031995 Bacteria 3454
367 Ga0307409_100065661 3300031995 Bacteria 2857
368 Ga0307416_100004129 3300032002 Bacteria 8700
369 Ga0307416_100025043 3300032002 Bacteria 4367
370 Ga0307416_100403871 3300032002 Unclassified 1405
371 Ga0307414_10121306 3300032004 Bacteria 2010
372 Ga0307411_10010050 3300032005 Bacteria 5020
373 Ga0307411_10016203 3300032005 Bacteria 4215
374 Ga0307411_10116247 3300032005 Bacteria 1925
375 Ga0307411_10211915 3300032005 Bacteria 1496
376 Ga0307415_100043427 3300032126 Bacteria 2999
377 Ga0307415_100159639 3300032126 Bacteria 1746
378 Ga0373928_0000525 3300035084 Bacteria 7474
379 Ga0373929_0004174 3300035085 Bacteria 2592
380 Ga0373934_0021084 3300035086 Bacteria 2509
381 Ga0373940_0000040 3300035088 Bacteria 13934
382 Ga0373944_0005125 3300035089 Bacteria 3444
383 Ga0373951_0001092 3300035091 Bacteria 7259
384 Ga0373952_0002000 3300035092 Bacteria 3683
385 Ga0373932_0000338 3300035112 Bacteria 14295
386 Ga0373936_0046050 3300035113 Bacteria 1758
387 Ga0373939_0000129 3300035114 Bacteria 22200
388 Ga0373939_0008652 3300035114 Bacteria 2501
389 Ga0373956_0001725 3300035119 Bacteria 9016
390 Ga0373960_0000070 3300035121 Bacteria 14646
391 Ga0373943_0011113 3300035170 Bacteria 4046
392 Ga0373946_0005220 3300035171 Bacteria 4682
393 Ga0373942_0000050 3300035207 Bacteria 23361
394 Ga0373942_0011074 3300035207 Bacteria 2133
395 Ga0373961_0000288 3300035241 Bacteria 22649
396 Ga0373961_0019233 3300035241 Bacteria 1792
397 Ga0373962_0000753 3300035242 Bacteria 7369
398 Ga0373935_0021161 3300035692 Bacteria 3981
399 Ga0373933_0013664 3300035724 Bacteria 4503
400 Ga0373933_0143171 3300035724 Bacteria 1510
401 Ga0373947_0024525 3300035725 Bacteria 3515
402 Ga0373947_0037563 3300035725 Bacteria 2874
403 Ga0373937_0000130 3300036401 Bacteria 72827
404 Ga0373937_0037893 3300036401 Bacteria 4394
405 Ga0373937_0103299 3300036401 Bacteria 2647
406 Ga0373937_0107582 3300036401 Bacteria 2593
407 Ga0373925_0104487 3300037068 Bacteria 2181
408 Ga0373925_0177187 3300037068 Bacteria 1685
409 Ga0439433_0012485 3300041999 Bacteria 1863
410 Ga0439450_001038 3300042008 Bacteria 3911
411 Ga0450923_005080 3300042125 Bacteria 2107
412 Ga0450895_000137 3300042132 Bacteria 3204
413 Ga0450896_001850 3300042133 Bacteria 2674
414 Ga0439446_0005323 3300042156 Bacteria 3307
415 Ga0439434_0029164 3300042435 Bacteria 1673
416 Ga0439435_0030656 3300042436 Bacteria 1459
417 Ga0439464_0000358 3300042439 Bacteria 8850
418 Ga0439460_0015942 3300042461 Unclassified 1996
419 Ga0451577_0023812 3300042876 Bacteria 5577
420 Ga0451577_0026012 3300042876 Bacteria 5303
421 Ga0451577_0032813 3300042876 Bacteria 4680
422 Ga0453684_0017361 3300044712 Bacteria 11153
423 Ga0451576_0029209 3300045051 Bacteria 5900
424 Ga0451576_0066935 3300045051 Bacteria 3739
425 Ga0495592_0103423 3300046454 Bacteria 2026
426 Ga0495629_0135150 3300046459 Bacteria 1717
427 Ga0495651_0113611 3300046462 Bacteria 1999
428 Ga0495628_0053130 3300046516 Bacteria 3199
429 Ga0495630_0005297 3300046517 Bacteria 9103
430 Ga0495586_0139750 3300046535 Bacteria 1359
431 Ga0495587_0031483 3300046536 Bacteria 3212
432 Ga0495587_0115732 3300046536 Bacteria 1538
433 Ga0495621_0025842 3300046539 Bacteria 1976
434 Ga0495645_0001908 3300046543 Bacteria 14162
435 Ga0495667_0138216 3300046559 Bacteria 1570
436 Ga0495647_0002504 3300046681 Bacteria 5823
437 Ga0495658_0020116 3300046683 Bacteria 3497
438 Ga0495658_0080835 3300046683 Bacteria 1907
439 Ga0495658_0096718 3300046683 Bacteria 1757
440 Ga0495669_0000451 3300046684 Bacteria 19317
441 Ga0495613_0009377 3300046689 Bacteria 7263
442 Ga0495604_0010365 3300047317 Bacteria 7382
443 Ga0495674_0117734 3300047319 Bacteria 2247
444 Ga0495684_0000549 3300047471 Bacteria 30432
445 Ga0495684_0253525 3300047471 Bacteria 1279
446 Ga0495593_0086771 3300047673 Bacteria 1614
447 Ga0496101_0001942 3300048904 Bacteria 12521
448 Ga0496101_0208576 3300048904 Unclassified 1513
449 Ga0496102_0020187 3300048905 Bacteria 5884
450 Ga0496102_0088111 3300048905 Unclassified 2869
451 Ga0496103_0048379 3300048906 Bacteria 2628
452 Ga0496104_0011320 3300048907 Bacteria 7986
453 Ga0496104_0068648 3300048907 Bacteria 3368
454 Ga0496104_0093056 3300048907 Bacteria 2883
455 Ga0496105_0010154 3300048908 Bacteria 7397
456 Ga0496106_0066413 3300048909 Bacteria 2747
457 Ga0496107_0062136 3300048910 Bacteria 2706
458 Ga0496108_0000908 3300048911 Bacteria 23090
459 Ga0496108_0019676 3300048911 Bacteria 5545
460 Ga0496108_0082563 3300048911 Bacteria 2725
461 Ga0496109_0001799 3300048912 Bacteria 17830
462 Ga0496109_0178448 3300048912 Unclassified 1994
463 Ga0496109_0256091 3300048912 Unclassified 1648
464 Ga0496110_0000066 3300048913 Bacteria 52504
465 Ga0496111_0023460 3300048914 Bacteria 4332
466 Ga0496112_0013877 3300048915 Bacteria 7453
467 Ga0496112_0055158 3300048915 Bacteria 3906
468 Ga0496112_0148779 3300048915 Bacteria 2309
469 Ga0496112_0234368 3300048915 Bacteria 1790
470 Ga0496113_0048883 3300048916 Bacteria 3148
471 Ga0496113_0187683 3300048916 Bacteria 1640
472 Ga0496114_0001859 3300048917 Bacteria 15987
473 Ga0496114_0068178 3300048917 Bacteria 2986
474 Ga0496114_0188124 3300048917 Bacteria 1805
475 Ga0501031_0002290 3300049568 Bacteria 12129
476 Ga0501031_0101901 3300049568 Bacteria 1873
477 Ga0501032_0003907 3300049569 Bacteria 11304
478 Ga0501032_0010633 3300049569 Bacteria 6626
479 Ga0501033_0006400 3300049570 Bacteria 9223
480 Ga0501033_0006968 3300049570 Bacteria 8824
481 Ga0501033_0027321 3300049570 Bacteria 4290
482 Ga0501033_0029228 3300049570 Bacteria 4141
483 Ga0501033_0089438 3300049570 Bacteria 2252
484 Ga0501034_0027751 3300049571 Bacteria 5756
485 Ga0501034_0042744 3300049571 Bacteria 4587
486 Ga0501034_0105193 3300049571 Bacteria 2815
487 Ga0501034_0107382 3300049571 Unclassified 2783
488 Ga0501034_0132882 3300049571 Bacteria 2471
489 Ga0501036_0001004 3300049572 Bacteria 21312
490 Ga0501036_0014950 3300049572 Bacteria 6475
491 Ga0501036_0060686 3300049572 Bacteria 3203
492 Ga0501036_0066581 3300049572 Bacteria 3048
493 Ga0501036_0146576 3300049572 Unclassified 1991
494 Ga0501037_0005576 3300049573 Bacteria 9176
495 Ga0501037_0048744 3300049573 Bacteria 3102
496 Ga0501037_0060364 3300049573 Bacteria 2766
497 Ga0501038_0009366 3300049574 Bacteria 8984
498 Ga0501038_0057631 3300049574 Bacteria 3334
499 Ga0501038_0104071 3300049574 Bacteria 2359
500 Ga0501039_0006831 3300049575 Bacteria 8681
501 Ga0501039_0013257 3300049575 Bacteria 6303
502 Ga0501039_0013896 3300049575 Bacteria 6159
503 Ga0501039_0085672 3300049575 Bacteria 2454
504 Ga0501040_0004306 3300049576 Bacteria 9245
505 Ga0501040_0004359 3300049576 Bacteria 9199
506 Ga0501040_0148663 3300049576 Bacteria 1652
507 Ga0501041_0031740 3300049577 Bacteria 3193
508 Ga0501041_0113125 3300049577 Bacteria 1684
509 Ga0501042_0021727 3300049578 Bacteria 4474
510 Ga0501042_0100062 3300049578 Bacteria 2084
511 Ga0501042_0117357 3300049578 Unclassified 1916
512 Ga0501043_0003533 3300049579 Bacteria 12847
513 Ga0501043_0004130 3300049579 Bacteria 11861
514 Ga0501043_0013100 3300049579 Bacteria 6481
515 Ga0501043_0015508 3300049579 Bacteria 5971
516 Ga0501046_0008447 3300049580 Bacteria 8984
517 Ga0501046_0011996 3300049580 Bacteria 7394
518 Ga0501046_0012166 3300049580 Bacteria 7335
519 Ga0501046_0019178 3300049580 Bacteria 5674
520 Ga0501046_0022214 3300049580 Bacteria 5228
521 Ga0501046_0111290 3300049580 Bacteria 2091
522 Ga0501047_0027143 3300049581 Bacteria 5515
523 Ga0501047_0039199 3300049581 Bacteria 4583
524 Ga0501047_0052128 3300049581 Bacteria 3954
525 Ga0501047_0056527 3300049581 Bacteria 3795
526 Ga0501047_0171434 3300049581 Bacteria 2038
527 Ga0501048_0006989 3300049582 Bacteria 8574
528 Ga0501048_0022176 3300049582 Bacteria 4646
529 Ga0501048_0065165 3300049582 Bacteria 2576
530 Ga0501048_0073412 3300049582 Bacteria 2414
531 Ga0501067_0002039 3300049583 Bacteria 11138
532 Ga0501067_0030261 3300049583 Bacteria 3003
533 Ga0501068_0007073 3300049584 Bacteria 6215
534 Ga0501068_0013818 3300049584 Bacteria 4600
535 Ga0501068_0030745 3300049584 Bacteria 3187
536 Ga0501069_0000895 3300049585 Bacteria 14204
537 Ga0501070_0014530 3300049586 Bacteria 6624
538 Ga0501071_0002561 3300049587 Bacteria 11088
539 Ga0501071_0011092 3300049587 Bacteria 6057
540 Ga0501071_0021206 3300049587 Bacteria 4524
541 Ga0501071_0027320 3300049587 Bacteria 4015
542 Ga0501071_0048111 3300049587 Bacteria 3065
543 Ga0501072_0001720 3300049588 Bacteria 16307
544 Ga0501072_0010573 3300049588 Bacteria 7028
545 Ga0501072_0024218 3300049588 Bacteria 4721
546 Ga0501072_0037419 3300049588 Bacteria 3806
547 Ga0501072_0043479 3300049588 Bacteria 3530
548 Ga0501072_0045151 3300049588 Bacteria 3464
549 Ga0501072_0084761 3300049588 Bacteria 2513
550 Ga0501072_0095071 3300049588 Bacteria 2368
551 Ga0501073_0000607 3300049589 Bacteria 25259
552 Ga0501073_0009602 3300049589 Bacteria 7134
553 Ga0501073_0029037 3300049589 Bacteria 3951
554 Ga0501074_0007919 3300049590 Bacteria 7695
555 Ga0501074_0054310 3300049590 Bacteria 2889
556 Ga0501075_0001836 3300049591 Bacteria 14012
557 Ga0501075_0004412 3300049591 Bacteria 9519
558 Ga0501075_0022260 3300049591 Bacteria 4627
559 Ga0501075_0052020 3300049591 Bacteria 3080
560 Ga0501075_0158146 3300049591 Bacteria 1728
561 Ga0501076_0008340 3300049592 Bacteria 7592
562 Ga0501076_0039574 3300049592 Bacteria 3701
563 Ga0501076_0042439 3300049592 Bacteria 3581
564 Ga0501076_0083065 3300049592 Bacteria 2572
565 Ga0501076_0087760 3300049592 Bacteria 2500
566 Ga0501077_0022163 3300049593 Bacteria 4023
567 Ga0501077_0041518 3300049593 Bacteria 2928
568 Ga0501079_0002271 3300049741 Bacteria 13876
569 Ga0501079_0008647 3300049741 Bacteria 7724
570 Ga0501079_0011149 3300049741 Bacteria 6855
571 Ga0501079_0049331 3300049741 Bacteria 3248
572 Ga0501079_0156979 3300049741 Bacteria 1773
573 Ga0501080_0002482 3300049742 Bacteria 16155
574 Ga0501080_0039499 3300049742 Bacteria 4404
575 Ga0501080_0072142 3300049742 Bacteria 3212
576 Ga0501080_0100981 3300049742 Bacteria 2676
577 Ga0501080_0197423 3300049742 Bacteria 1848
578 Ga0501081_0002262 3300049743 Bacteria 12114
579 Ga0501081_0022073 3300049743 Bacteria 4256
580 Ga0501081_0026929 3300049743 Bacteria 3879
581 Ga0501081_0062481 3300049743 Bacteria 2583
582 Ga0501081_0099433 3300049743 Bacteria 2055
583 Ga0501081_0186418 3300049743 Unclassified 1501
584 Ga0501083_0018068 3300049744 Bacteria 4915
585 Ga0501083_0026446 3300049744 Bacteria 4010
586 Ga0501083_0129353 3300049744 Bacteria 1655
587 Ga0501035_0017870 3300049822 Bacteria 6541
588 Ga0501035_0018426 3300049822 Bacteria 6433
589 Ga0501044_0006469 3300049823 Bacteria 12941
590 Ga0501044_0008738 3300049823 Bacteria 11086
591 Ga0501044_0012452 3300049823 Bacteria 9211
592 Ga0501044_0012562 3300049823 Bacteria 9172
593 Ga0501045_0007414 3300049824 Bacteria 7624
594 Ga0501045_0009378 3300049824 Bacteria 6843
595 Ga0501045_0015997 3300049824 Bacteria 5321
596 Ga0501045_0016504 3300049824 Bacteria 5247
597 nmdc:mga00v17_110226_c1 3300050491 Bacteria 1746
598 nmdc:mga00v17_19761_c1 3300050491 Bacteria 3851
599 nmdc:mga0yw44_109745_c1 3300050492 Bacteria 1767
600 nmdc:mga0k408_1720_c1 3300050493 Bacteria 11742
601 nmdc:mga06z11_2791_c1 3300050494 Bacteria 6692
602 nmdc:mga06z11_4578_c1 3300050494 Bacteria 5454
603 nmdc:mga07m45_14244_c1 3300050496 Bacteria 4232
604 nmdc:mga05p37_10810_c1 3300050507 Bacteria 10836
605 nmdc:mga05p37_11594_c1 3300050507 Bacteria 10504
606 nmdc:mga05p37_168627_c1 3300050507 Bacteria 2671
607 nmdc:mga05p37_25261_c1 3300050507 Bacteria 7225
608 nmdc:mga05p37_26005_c1 3300050507 Bacteria 7116
609 nmdc:mga05p37_3259_c1 3300050507 Bacteria 18905
610 nmdc:mga05p37_3329_c1 3300050507 Bacteria 18756
611 nmdc:mga05p37_42381_c1 3300050507 Bacteria 5592
612 nmdc:mga05p37_4435_c1 3300050507 Bacteria 16400
613 nmdc:mga05p37_53213_c1 3300050507 Unclassified 4978
614 nmdc:mga05p37_53_c1 3300050507 Bacteria 102685
615 nmdc:mga05p37_67575_c1 3300050507 Bacteria 4397
616 nmdc:mga05p37_8845_c1 3300050507 Bacteria 11897
617 nmdc:mga09592_2041_c1 3300050508 Bacteria 16282
618 nmdc:mga09592_29716_c1 3300050508 Bacteria 4544
619 nmdc:mga09592_49840_c1 3300050508 Bacteria 3531
620 nmdc:mga09592_61661_c1 3300050508 Bacteria 3172
621 nmdc:mga0qj67_2885_c1 3300050509 Bacteria 12341
622 nmdc:mga0qj67_7285_c1 3300050509 Bacteria 8175
623 nmdc:mga06r32_21282_c1 3300050510 Bacteria 5986
624 nmdc:mga06r32_4790_c1 3300050510 Bacteria 12175
625 nmdc:mga08y16_1010_c1 3300050511 Bacteria 27520
626 nmdc:mga08y16_12198_c1 3300050511 Bacteria 9034
627 nmdc:mga08y16_19487_c1 3300050511 Bacteria 7152
628 nmdc:mga08y16_36347_c1 3300050511 Bacteria 5173
629 nmdc:mga08y16_45778_c1 3300050511 Bacteria 4583
630 nmdc:mga08y16_4948_c1 3300050511 Bacteria 13920
631 nmdc:mga08y16_8502_c1 3300050511 Bacteria 10749
632 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
633 nmdc:mga0n895_21730_c1 3300050512 Bacteria 6006
634 nmdc:mga0n895_30696_c1 3300050512 Bacteria 5139
635 nmdc:mga0n895_35_c1 3300050512 Bacteria 79696
636 nmdc:mga0rr50_1059_c1 3300050513 Bacteria 14964
637 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
638 nmdc:mga0rr50_3418_c1 3300050513 Bacteria 9132
639 nmdc:mga08x19_41407_c1 3300050514 Unclassified 2934
640 nmdc:mga08x19_4860_c1 3300050514 Bacteria 7946
641 nmdc:mga0a205_121303_c1 3300050515 Bacteria 2513
642 nmdc:mga0a205_12944_c1 3300050515 Bacteria 7741
643 nmdc:mga0a205_17656_c1 3300050515 Bacteria 6697
644 nmdc:mga0a205_23179_c1 3300050515 Bacteria 5887
645 nmdc:mga0a205_7702_c1 3300050515 Bacteria 7328
646 Ga0495601_0022543 3300053077 Bacteria 3866
647 Ga0495619_0053013 3300053085 Bacteria 2682
648 Ga0495619_0148837 3300053085 Bacteria 1614
649 Ga0501084_0006062 3300054114 Bacteria 9945
650 Ga0501084_0011332 3300054114 Bacteria 7384
651 Ga0501084_0046925 3300054114 Bacteria 3618
652 Ga0501084_0165167 3300054114 Bacteria 1868
653 Ga0501084_0165664 3300054114 Bacteria 1865
654 Ga0590071_000118 3300059421 Bacteria 22283
655 Ga0590074_000298 3300059423 Bacteria 6779
656 Ga0590075_000125 3300059424 Bacteria 19823
657 Ga0590077_000080 3300059426 Bacteria 24623
658 Ga0501082_0008037 3300060353 Bacteria 9106
659 Ga0501082_0021986 3300060353 Bacteria 5499
660 Ga0501082_0023210 3300060353 Bacteria 5351
661 Ga0501082_0048993 3300060353 Bacteria 3642
662 Ga0501082_0056889 3300060353 Bacteria 3369
663 Ga0501082_0063505 3300060353 Bacteria 3180
664 Ga0530510_0002245 3300061734 Bacteria 13247
665 Ga0530510_0024129 3300061734 Bacteria 4338
666 Ga0530510_0047198 3300061734 Bacteria 3112
667 Ga0530510_0113008 3300061734 Bacteria 1990

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025914 Ga0207671_10320056 Ga0207671_103200562 328
2 3300047471 Ga0495684_0253525 Ga0495684_0253525_110_1237 328
3 3300026118 Ga0207675_100138244 Ga0207675_1001382442 351
4 3300009098 Ga0105245_10261961 Ga0105245_102619611 373
5 3300035092 Ga0373952_0002000 Ga0373952_0002000_21_1238 377
6 3300005458 Ga0070681_10020649 Ga0070681_100206494 384
7 3300025912 Ga0207707_10024587 Ga0207707_100245873 384
8 3300025932 Ga0207690_10101915 Ga0207690_101019152 384
9 3300005366 Ga0070659_100043785 Ga0070659_1000437852 386
10 3300005937 Ga0081455_10017270 Ga0081455_100172704 387
11 3300025921 Ga0207652_10018502 Ga0207652_100185023 392
12 3300049571 Ga0501034_0132882 Ga0501034_0132882_34_1308 392
13 3300005330 Ga0070690_100051254 Ga0070690_1000512543 393
14 3300005340 Ga0070689_100004045 Ga0070689_1000040455 393
15 3300005355 Ga0070671_100024333 Ga0070671_1000243334 393
16 3300005438 Ga0070701_10028064 Ga0070701_100280643 393
17 3300005543 Ga0070672_100004683 Ga0070672_1000046836 393
18 3300005578 Ga0068854_100087739 Ga0068854_1000877393 393
19 3300005843 Ga0068860_100025269 Ga0068860_1000252692 393
20 3300007076 Ga0075435_100002619 Ga0075435_1000026198 393
21 3300009176 Ga0105242_10017911 Ga0105242_100179112 393
22 3300013297 Ga0157378_10030313 Ga0157378_100303132 393
23 3300025904 Ga0207647_10059036 Ga0207647_100590361 393
24 3300025907 Ga0207645_10003141 Ga0207645_100031413 393
25 3300025931 Ga0207644_10024422 Ga0207644_100244224 393
26 3300025933 Ga0207706_10037640 Ga0207706_100376404 393
27 3300025934 Ga0207686_10071733 Ga0207686_100717332 393
28 3300025940 Ga0207691_10002022 Ga0207691_1000202213 393
29 3300025960 Ga0207651_10025134 Ga0207651_100251341 393
30 3300025961 Ga0207712_10089853 Ga0207712_100898532 393
31 3300026089 Ga0207648_10005077 Ga0207648_100050779 393
32 3300035207 Ga0373942_0011074 Ga0373942_0011074_149_1420 393
33 3300005295 Ga0065707_10001377 Ga0065707_100013775 394
34 3300005545 Ga0070695_100037685 Ga0070695_1000376852 394
35 3300005547 Ga0070693_100021115 Ga0070693_1000211153 394
36 3300005617 Ga0068859_100146147 Ga0068859_1001461472 394
37 3300005718 Ga0068866_10037558 Ga0068866_100375582 394
38 3300005842 Ga0068858_100228784 Ga0068858_1002287842 394
39 3300006931 Ga0097620_100146147 Ga0097620_1001461472 394
40 3300009174 Ga0105241_10057507 Ga0105241_100575073 394
41 3300025893 Ga0207682_10030495 Ga0207682_100304952 394
42 3300025923 Ga0207681_10080522 Ga0207681_100805222 394
43 3300026075 Ga0207708_10042030 Ga0207708_100420303 394
44 3300026118 Ga0207675_100024641 Ga0207675_1000246414 394
45 3300005536 Ga0070697_100022134 Ga0070697_1000221344 395
46 3300006914 Ga0075436_100042574 Ga0075436_1000425742 395
47 3300013306 Ga0163162_10265269 Ga0163162_102652691 395
48 3300027907 Ga0207428_10025669 Ga0207428_100256692 395
49 3300045051 Ga0451576_0066935 Ga0451576_0066935_952_2250 395
50 3300046516 Ga0495628_0053130 Ga0495628_0053130_567_2000 395
51 3300005335 Ga0070666_10176202 Ga0070666_101762022 396
52 3300005353 Ga0070669_100188684 Ga0070669_1001886842 396
53 3300005356 Ga0070674_100021777 Ga0070674_1000217773 396
54 3300005364 Ga0070673_100005813 Ga0070673_1000058133 396
55 3300014326 Ga0157380_10037082 Ga0157380_100370822 396
56 3300025901 Ga0207688_10024502 Ga0207688_100245022 396
57 3300025903 Ga0207680_10057438 Ga0207680_100574382 396
58 3300025960 Ga0207651_10011390 Ga0207651_100113904 396
59 3300026023 Ga0207677_10056134 Ga0207677_100561342 396
60 3300026035 Ga0207703_10286660 Ga0207703_102866601 396
61 3300042876 Ga0451577_0026012 Ga0451577_0026012_825_2111 396
62 3300048905 Ga0496102_0020187 Ga0496102_0020187_4470_5762 396
63 3300048906 Ga0496103_0048379 Ga0496103_0048379_252_1544 396
64 3300048911 Ga0496108_0082563 Ga0496108_0082563_153_1445 396
65 3300048912 Ga0496109_0178448 Ga0496109_0178448_191_1483 396
66 3300048915 Ga0496112_0013877 Ga0496112_0013877_3610_4902 396
67 3300048916 Ga0496113_0048883 Ga0496113_0048883_1139_2431 396
68 3300049576 Ga0501040_0004359 Ga0501040_0004359_28_1329 396
69 3300049580 Ga0501046_0019178 Ga0501046_0019178_2352_3653 396
70 3300049581 Ga0501047_0056527 Ga0501047_0056527_858_2162 396
71 3300049587 Ga0501071_0021206 Ga0501071_0021206_1432_2733 396
72 3300049588 Ga0501072_0024218 Ga0501072_0024218_1594_2895 396
73 3300049591 Ga0501075_0022260 Ga0501075_0022260_3301_4602 396
74 3300049593 Ga0501077_0041518 Ga0501077_0041518_532_1833 396
75 3300049741 Ga0501079_0156979 Ga0501079_0156979_49_1350 396
76 3300049743 Ga0501081_0022073 Ga0501081_0022073_1751_3052 396
77 3300049824 Ga0501045_0007414 Ga0501045_0007414_6269_7570 396
78 3300061734 Ga0530510_0002245 Ga0530510_0002245_3318_4619 396
79 3300005328 Ga0070676_10015175 Ga0070676_100151753 397
80 3300005331 Ga0070670_100006560 Ga0070670_1000065603 397
81 3300005341 Ga0070691_10002086 Ga0070691_100020862 397
82 3300005353 Ga0070669_100015230 Ga0070669_1000152301 397
83 3300005438 Ga0070701_10000954 Ga0070701_1000095411 397
84 3300005440 Ga0070705_100054740 Ga0070705_1000547402 397
85 3300005444 Ga0070694_100091885 Ga0070694_1000918852 397
86 3300005459 Ga0068867_100003453 Ga0068867_1000034534 397
87 3300005545 Ga0070695_100004151 Ga0070695_1000041518 397
88 3300005546 Ga0070696_100006167 Ga0070696_1000061677 397
89 3300005549 Ga0070704_100004365 Ga0070704_1000043656 397
90 3300005564 Ga0070664_100097895 Ga0070664_1000978952 397
91 3300005615 Ga0070702_100021477 Ga0070702_1000214773 397
92 3300005719 Ga0068861_100000413 Ga0068861_10000041311 397
93 3300005842 Ga0068858_100177072 Ga0068858_1001770722 397
94 3300009147 Ga0114129_10006811 Ga0114129_1000681113 397
95 3300009147 Ga0114129_10009633 Ga0114129_100096337 397
96 3300009148 Ga0105243_10006372 Ga0105243_1000637210 397
97 3300025907 Ga0207645_10003173 Ga0207645_1000317311 397
98 3300025923 Ga0207681_10071419 Ga0207681_100714192 397
99 3300025925 Ga0207650_10009788 Ga0207650_100097885 397
100 3300025935 Ga0207709_10069011 Ga0207709_100690111 397
101 3300026089 Ga0207648_10009859 Ga0207648_100098595 397
102 3300026116 Ga0207674_10034107 Ga0207674_100341074 397
103 3300026118 Ga0207675_100000511 Ga0207675_10000051119 397
104 3300035725 Ga0373947_0024525 Ga0373947_0024525_959_2236 397
105 3300049568 Ga0501031_0101901 Ga0501031_0101901_192_1595 397
106 3300049570 Ga0501033_0029228 Ga0501033_0029228_237_1640 397
107 3300049571 Ga0501034_0027751 Ga0501034_0027751_2957_4351 397
108 3300049571 Ga0501034_0105193 Ga0501034_0105193_203_1606 397
109 3300049572 Ga0501036_0060686 Ga0501036_0060686_1756_3150 397
110 3300049573 Ga0501037_0048744 Ga0501037_0048744_439_1842 397
111 3300049574 Ga0501038_0104071 Ga0501038_0104071_873_2267 397
112 3300049575 Ga0501039_0013896 Ga0501039_0013896_776_2170 397
113 3300049579 Ga0501043_0004130 Ga0501043_0004130_3805_5208 397
114 3300049580 Ga0501046_0111290 Ga0501046_0111290_633_2036 397
115 3300049581 Ga0501047_0039199 Ga0501047_0039199_2882_4285 397
116 3300049582 Ga0501048_0073412 Ga0501048_0073412_170_1573 397
117 3300049588 Ga0501072_0010573 Ga0501072_0010573_850_2244 397
118 3300049589 Ga0501073_0029037 Ga0501073_0029037_161_1564 397
119 3300049742 Ga0501080_0002482 Ga0501080_0002482_6489_7883 397
120 3300049744 Ga0501083_0026446 Ga0501083_0026446_1454_2848 397
121 3300049823 Ga0501044_0012452 Ga0501044_0012452_6476_7870 397
122 3300050507 nmdc:mga05p37_4435_c1 nmdc:mga05p37_4435_c1_11974_13278 397
123 3300054114 Ga0501084_0011332 Ga0501084_0011332_5149_6552 397
124 3300054114 Ga0501084_0165167 Ga0501084_0165167_16_1410 397
125 3300060353 Ga0501082_0048993 Ga0501082_0048993_829_2223 397
126 3300006852 Ga0075433_10022893 Ga0075433_100228933 398
127 3300009147 Ga0114129_10004232 Ga0114129_100042323 398
128 3300036401 Ga0373937_0103299 Ga0373937_0103299_1031_2371 398
129 3300042008 Ga0439450_001038 Ga0439450_001038_283_1578 398
130 3300042439 Ga0439464_0000358 Ga0439464_0000358_1887_3182 398
131 3300044712 Ga0453684_0017361 Ga0453684_0017361_944_2230 398
132 3300050507 nmdc:mga05p37_10810_c1 nmdc:mga05p37_10810_c1_3451_4746 398
133 3300050515 nmdc:mga0a205_12944_c1 nmdc:mga0a205_12944_c1_2591_3886 398
134 3300006844 Ga0075428_100004161 Ga0075428_1000041619 399
135 3300006847 Ga0075431_100079221 Ga0075431_1000792212 399
136 3300009147 Ga0114129_10001979 Ga0114129_100019799 399
137 3300035113 Ga0373936_0046050 Ga0373936_0046050_181_1500 399
138 3300035170 Ga0373943_0011113 Ga0373943_0011113_1182_2501 399
139 3300035171 Ga0373946_0005220 Ga0373946_0005220_2339_3658 399
140 3300035692 Ga0373935_0021161 Ga0373935_0021161_845_2164 399
141 3300035725 Ga0373947_0037563 Ga0373947_0037563_1201_2520 399
142 3300037068 Ga0373925_0104487 Ga0373925_0104487_845_2164 399
143 3300049576 Ga0501040_0148663 Ga0501040_0148663_24_1340 399
144 3300049577 Ga0501041_0031740 Ga0501041_0031740_1597_2913 399
145 3300049587 Ga0501071_0027320 Ga0501071_0027320_2413_3729 399
146 3300049588 Ga0501072_0043479 Ga0501072_0043479_2048_3364 399
147 3300049591 Ga0501075_0004412 Ga0501075_0004412_4297_5613 399
148 3300049592 Ga0501076_0008340 Ga0501076_0008340_650_1966 399
149 3300049743 Ga0501081_0099433 Ga0501081_0099433_322_1638 399
150 3300050508 nmdc:mga09592_61661_c1 nmdc:mga09592_61661_c1_813_2060 399
151 3300005354 Ga0070675_100001360 Ga0070675_1000013605 400
152 3300005530 Ga0070679_100100370 Ga0070679_1001003702 400
153 3300006237 Ga0097621_100001586 Ga0097621_1000015864 400
154 3300006358 Ga0068871_100001365 Ga0068871_10000136510 400
155 3300009147 Ga0114129_10029670 Ga0114129_100296706 400
156 3300014968 Ga0157379_10139997 Ga0157379_101399971 400
157 3300025912 Ga0207707_10021944 Ga0207707_100219444 400
158 3300025949 Ga0207667_10306731 Ga0207667_103067312 400
159 3300046684 Ga0495669_0000451 Ga0495669_0000451_9508_10821 400
160 3300050507 nmdc:mga05p37_3259_c1 nmdc:mga05p37_3259_c1_4697_6028 400
161 3300005290 Ga0065712_10117712 Ga0065712_101177122 401
162 3300005295 Ga0065707_10117683 Ga0065707_101176832 401
163 3300005330 Ga0070690_100057147 Ga0070690_1000571472 401
164 3300005335 Ga0070666_10039811 Ga0070666_100398112 401
165 3300005338 Ga0068868_100055744 Ga0068868_1000557442 401
166 3300005343 Ga0070687_100021027 Ga0070687_1000210272 401
167 3300005347 Ga0070668_100039083 Ga0070668_1000390832 401
168 3300005353 Ga0070669_100049939 Ga0070669_1000499393 401
169 3300005354 Ga0070675_100068176 Ga0070675_1000681762 401
170 3300005468 Ga0070707_100066645 Ga0070707_1000666452 401
171 3300005471 Ga0070698_100218919 Ga0070698_1002189191 401
172 3300005544 Ga0070686_100000398 Ga0070686_1000003982 401
173 3300005578 Ga0068854_100004892 Ga0068854_1000048925 401
174 3300005841 Ga0068863_100004381 Ga0068863_1000043814 401
175 3300005843 Ga0068860_100116559 Ga0068860_1001165592 401
176 3300005844 Ga0068862_100121508 Ga0068862_1001215082 401
177 3300006051 Ga0075364_10003347 Ga0075364_100033475 401
178 3300006051 Ga0075364_10004372 Ga0075364_100043727 401
179 3300006177 Ga0075362_10000228 Ga0075362_100002289 401
180 3300006178 Ga0075367_10005874 Ga0075367_100058749 401
181 3300006178 Ga0075367_10015401 Ga0075367_100154013 401
182 3300006195 Ga0075366_10003831 Ga0075366_100038312 401
183 3300006353 Ga0075370_10005896 Ga0075370_100058964 401
184 3300006844 Ga0075428_100003031 Ga0075428_1000030319 401
185 3300006844 Ga0075428_100019276 Ga0075428_1000192762 401
186 3300006846 Ga0075430_100003478 Ga0075430_1000034782 401
187 3300006847 Ga0075431_100010127 Ga0075431_1000101276 401
188 3300006847 Ga0075431_100022064 Ga0075431_1000220642 401
189 3300006847 Ga0075431_100030339 Ga0075431_1000303394 401
190 3300006871 Ga0075434_100196110 Ga0075434_1001961102 401
191 3300006880 Ga0075429_100000822 Ga0075429_1000008226 401
192 3300006880 Ga0075429_100117818 Ga0075429_1001178182 401
193 3300009093 Ga0105240_10023069 Ga0105240_100230696 401
194 3300009094 Ga0111539_10002441 Ga0111539_1000244112 401
195 3300009094 Ga0111539_10172107 Ga0111539_101721073 401
196 3300009147 Ga0114129_10001494 Ga0114129_1000149415 401
197 3300009147 Ga0114129_10078021 Ga0114129_100780212 401
198 3300009147 Ga0114129_10198136 Ga0114129_101981362 401
199 3300009174 Ga0105241_10191700 Ga0105241_101917002 401
200 3300009177 Ga0105248_10051860 Ga0105248_100518603 401
201 3300009553 Ga0105249_10389112 Ga0105249_103891121 401
202 3300014325 Ga0163163_10269454 Ga0163163_102694541 401
203 3300014326 Ga0157380_10081302 Ga0157380_100813022 401
204 3300014969 Ga0157376_10106949 Ga0157376_101069492 401
205 3300025315 Ga0207697_10000393 Ga0207697_1000039314 401
206 3300025918 Ga0207662_10077793 Ga0207662_100777932 401
207 3300025926 Ga0207659_10074984 Ga0207659_100749841 401
208 3300025928 Ga0207700_10020049 Ga0207700_100200493 401
209 3300025941 Ga0207711_10043255 Ga0207711_100432552 401
210 3300025981 Ga0207640_10011564 Ga0207640_100115643 401
211 3300026023 Ga0207677_10050250 Ga0207677_100502502 401
212 3300026067 Ga0207678_10050742 Ga0207678_100507422 401
213 3300026088 Ga0207641_10002396 Ga0207641_100023964 401
214 3300026118 Ga0207675_100080110 Ga0207675_1000801103 401
215 3300027907 Ga0207428_10001623 Ga0207428_1000162314 401
216 3300028381 Ga0268264_10219425 Ga0268264_102194252 401
217 3300031548 Ga0307408_100003522 Ga0307408_1000035224 401
218 3300031548 Ga0307408_100042020 Ga0307408_1000420202 401
219 3300031548 Ga0307408_100074645 Ga0307408_1000746452 401
220 3300031731 Ga0307405_10088012 Ga0307405_100880121 401
221 3300031901 Ga0307406_10030987 Ga0307406_100309871 401
222 3300031911 Ga0307412_10089321 Ga0307412_100893212 401
223 3300032002 Ga0307416_100004129 Ga0307416_1000041291 401
224 3300032002 Ga0307416_100025043 Ga0307416_1000250433 401
225 3300032005 Ga0307411_10016203 Ga0307411_100162032 401
226 3300032005 Ga0307411_10116247 Ga0307411_101162472 401
227 3300035084 Ga0373928_0000525 Ga0373928_0000525_601_1890 401
228 3300035085 Ga0373929_0004174 Ga0373929_0004174_44_1333 401
229 3300035088 Ga0373940_0000040 Ga0373940_0000040_5681_6970 401
230 3300035091 Ga0373951_0001092 Ga0373951_0001092_5353_6642 401
231 3300035112 Ga0373932_0000338 Ga0373932_0000338_9344_10633 401
232 3300035114 Ga0373939_0000129 Ga0373939_0000129_612_1901 401
233 3300035114 Ga0373939_0008652 Ga0373939_0008652_831_2135 401
234 3300035121 Ga0373960_0000070 Ga0373960_0000070_2414_3703 401
235 3300035207 Ga0373942_0000050 Ga0373942_0000050_3781_5070 401
236 3300035241 Ga0373961_0000288 Ga0373961_0000288_2853_4142 401
237 3300035242 Ga0373962_0000753 Ga0373962_0000753_4192_5481 401
238 3300035724 Ga0373933_0013664 Ga0373933_0013664_791_2146 401
239 3300041999 Ga0439433_0012485 Ga0439433_0012485_311_1561 401
240 3300042156 Ga0439446_0005323 Ga0439446_0005323_1606_2856 401
241 3300042435 Ga0439434_0029164 Ga0439434_0029164_263_1513 401
242 3300042436 Ga0439435_0030656 Ga0439435_0030656_102_1400 401
243 3300045051 Ga0451576_0029209 Ga0451576_0029209_3811_5100 401
244 3300048905 Ga0496102_0088111 Ga0496102_0088111_101_1390 401
245 3300048909 Ga0496106_0066413 Ga0496106_0066413_1318_2607 401
246 3300049569 Ga0501032_0010633 Ga0501032_0010633_1742_3184 401
247 3300049570 Ga0501033_0006968 Ga0501033_0006968_1287_2729 401
248 3300049571 Ga0501034_0042744 Ga0501034_0042744_551_1993 401
249 3300049572 Ga0501036_0014950 Ga0501036_0014950_1313_2755 401
250 3300049574 Ga0501038_0057631 Ga0501038_0057631_91_1533 401
251 3300049575 Ga0501039_0085672 Ga0501039_0085672_591_2033 401
252 3300049579 Ga0501043_0003533 Ga0501043_0003533_5586_7028 401
253 3300049580 Ga0501046_0008447 Ga0501046_0008447_2723_4165 401
254 3300049581 Ga0501047_0052128 Ga0501047_0052128_643_1950 401
255 3300049581 Ga0501047_0171434 Ga0501047_0171434_386_1828 401
256 3300049582 Ga0501048_0006989 Ga0501048_0006989_5820_7262 401
257 3300049584 Ga0501068_0030745 Ga0501068_0030745_106_1548 401
258 3300049586 Ga0501070_0014530 Ga0501070_0014530_3712_5154 401
259 3300049588 Ga0501072_0084761 Ga0501072_0084761_206_1612 401
260 3300049589 Ga0501073_0009602 Ga0501073_0009602_3191_4633 401
261 3300049592 Ga0501076_0042439 Ga0501076_0042439_2120_3526 401
262 3300049742 Ga0501080_0039499 Ga0501080_0039499_2262_3704 401
263 3300049742 Ga0501080_0197423 Ga0501080_0197423_451_1752 401
264 3300049743 Ga0501081_0026929 Ga0501081_0026929_241_1647 401
265 3300049744 Ga0501083_0129353 Ga0501083_0129353_170_1471 401
266 3300049823 Ga0501044_0006469 Ga0501044_0006469_9170_10477 401
267 3300050491 nmdc:mga00v17_110226_c1 nmdc:mga00v17_110226_c1_119_1429 401
268 3300050491 nmdc:mga00v17_19761_c1 nmdc:mga00v17_19761_c1_1403_2698 401
269 3300050493 nmdc:mga0k408_1720_c1 nmdc:mga0k408_1720_c1_9899_11185 401
270 3300050494 nmdc:mga06z11_2791_c1 nmdc:mga06z11_2791_c1_4322_5632 401
271 3300050494 nmdc:mga06z11_4578_c1 nmdc:mga06z11_4578_c1_558_1853 401
272 3300050496 nmdc:mga07m45_14244_c1 nmdc:mga07m45_14244_c1_193_1485 401
273 3300050507 nmdc:mga05p37_11594_c1 nmdc:mga05p37_11594_c1_3925_5220 401
274 3300050507 nmdc:mga05p37_168627_c1 nmdc:mga05p37_168627_c1_910_2208 401
275 3300050507 nmdc:mga05p37_25261_c1 nmdc:mga05p37_25261_c1_405_1709 401
276 3300050508 nmdc:mga09592_2041_c1 nmdc:mga09592_2041_c1_8615_9910 401
277 3300050509 nmdc:mga0qj67_2885_c1 nmdc:mga0qj67_2885_c1_6014_7309 401
278 3300050509 nmdc:mga0qj67_7285_c1 nmdc:mga0qj67_7285_c1_910_2208 401
279 3300050510 nmdc:mga06r32_4790_c1 nmdc:mga06r32_4790_c1_6631_7926 401
280 3300050511 nmdc:mga08y16_12198_c1 nmdc:mga08y16_12198_c1_4052_5347 401
281 3300059421 Ga0590071_000118 Ga0590071_000118_9432_10715 401
282 3300059423 Ga0590074_000298 Ga0590074_000298_1884_3167 401
283 3300059424 Ga0590075_000125 Ga0590075_000125_17702_18985 401
284 3300059426 Ga0590077_000080 Ga0590077_000080_20322_21605 401
285 3300060353 Ga0501082_0056889 Ga0501082_0056889_147_1589 401
286 3300061734 Ga0530510_0113008 Ga0530510_0113008_230_1636 401
287 3300005334 Ga0068869_100103708 Ga0068869_1001037082 402
288 3300005365 Ga0070688_100078098 Ga0070688_1000780981 402
289 3300005445 Ga0070708_100149137 Ga0070708_1001491372 402
290 3300005843 Ga0068860_100151713 Ga0068860_1001517132 402
291 3300006038 Ga0075365_10006494 Ga0075365_100064946 402
292 3300006844 Ga0075428_100002999 Ga0075428_1000029998 402
293 3300006846 Ga0075430_100067543 Ga0075430_1000675432 402
294 3300006846 Ga0075430_100072088 Ga0075430_1000720882 402
295 3300006847 Ga0075431_100032202 Ga0075431_1000322023 402
296 3300006852 Ga0075433_10105219 Ga0075433_101052192 402
297 3300006871 Ga0075434_100029094 Ga0075434_1000290944 402
298 3300006880 Ga0075429_100002301 Ga0075429_1000023015 402
299 3300006914 Ga0075436_100006788 Ga0075436_1000067884 402
300 3300013306 Ga0163162_10007328 Ga0163162_100073289 402
301 3300026095 Ga0207676_10348754 Ga0207676_103487541 402
302 3300031731 Ga0307405_10010720 Ga0307405_100107204 402
303 3300031824 Ga0307413_10162999 Ga0307413_101629991 402
304 3300031852 Ga0307410_10019796 Ga0307410_100197962 402
305 3300031995 Ga0307409_100040993 Ga0307409_1000409931 402
306 3300031995 Ga0307409_100065661 Ga0307409_1000656612 402
307 3300032002 Ga0307416_100403871 Ga0307416_1004038711 402
308 3300032004 Ga0307414_10121306 Ga0307414_101213062 402
309 3300032005 Ga0307411_10010050 Ga0307411_100100502 402
310 3300032005 Ga0307411_10211915 Ga0307411_102119151 402
311 3300032126 Ga0307415_100043427 Ga0307415_1000434272 402
312 3300042461 Ga0439460_0015942 Ga0439460_0015942_267_1565 402
313 3300042876 Ga0451577_0023812 Ga0451577_0023812_2122_3384 402
314 3300046454 Ga0495592_0103423 Ga0495592_0103423_304_1659 402
315 3300049592 Ga0501076_0083065 Ga0501076_0083065_1011_2264 402
316 3300050492 nmdc:mga0yw44_109745_c1 nmdc:mga0yw44_109745_c1_128_1402 402
317 3300050508 nmdc:mga09592_49840_c1 nmdc:mga09592_49840_c1_1795_3093 402
318 3300050510 nmdc:mga06r32_21282_c1 nmdc:mga06r32_21282_c1_3348_4646 402
319 3300050512 nmdc:mga0n895_30696_c1 nmdc:mga0n895_30696_c1_315_1604 402
320 3300050515 nmdc:mga0a205_7702_c1 nmdc:mga0a205_7702_c1_1811_3100 402
321 3300061734 Ga0530510_0024129 Ga0530510_0024129_330_1583 402
322 3300005295 Ga0065707_10106896 Ga0065707_101068962 403
323 3300005334 Ga0068869_100061753 Ga0068869_1000617532 403
324 3300005338 Ga0068868_100144699 Ga0068868_1001446992 403
325 3300005347 Ga0070668_100133655 Ga0070668_1001336552 403
326 3300005353 Ga0070669_100000622 Ga0070669_1000006229 403
327 3300005367 Ga0070667_100033513 Ga0070667_1000335132 403
328 3300005547 Ga0070693_100006549 Ga0070693_1000065492 403
329 3300005563 Ga0068855_100297026 Ga0068855_1002970262 403
330 3300005577 Ga0068857_100094445 Ga0068857_1000944452 403
331 3300005617 Ga0068859_100023420 Ga0068859_1000234204 403
332 3300005844 Ga0068862_100092634 Ga0068862_1000926342 403
333 3300006178 Ga0075367_10006108 Ga0075367_100061082 403
334 3300006237 Ga0097621_100154988 Ga0097621_1001549881 403
335 3300006844 Ga0075428_100139456 Ga0075428_1001394563 403
336 3300006880 Ga0075429_100132721 Ga0075429_1001327212 403
337 3300006931 Ga0097620_100023420 Ga0097620_1000234204 403
338 3300009094 Ga0111539_10000341 Ga0111539_1000034138 403
339 3300009094 Ga0111539_10011360 Ga0111539_1001136010 403
340 3300009147 Ga0114129_10000162 Ga0114129_1000016228 403
341 3300009177 Ga0105248_10361829 Ga0105248_103618292 403
342 3300009553 Ga0105249_10041421 Ga0105249_100414212 403
343 3300014325 Ga0163163_10000042 Ga0163163_1000004236 403
344 3300025920 Ga0207649_10102916 Ga0207649_101029162 403
345 3300025923 Ga0207681_10005978 Ga0207681_100059786 403
346 3300025945 Ga0207679_10266354 Ga0207679_102663541 403
347 3300026035 Ga0207703_10084295 Ga0207703_100842952 403
348 3300026116 Ga0207674_10085973 Ga0207674_100859732 403
349 3300027907 Ga0207428_10000816 Ga0207428_100008162 403
350 3300027907 Ga0207428_10000998 Ga0207428_1000099824 403
351 3300028380 Ga0268265_10070434 Ga0268265_100704342 403
352 3300035086 Ga0373934_0021084 Ga0373934_0021084_944_2218 403
353 3300035119 Ga0373956_0001725 Ga0373956_0001725_2651_3925 403
354 3300035724 Ga0373933_0143171 Ga0373933_0143171_112_1386 403
355 3300036401 Ga0373937_0000130 Ga0373937_0000130_3791_5065 403
356 3300037068 Ga0373925_0177187 Ga0373925_0177187_111_1412 403
357 3300042125 Ga0450923_005080 Ga0450923_005080_225_1496 403
358 3300042132 Ga0450895_000137 Ga0450895_000137_763_2034 403
359 3300042133 Ga0450896_001850 Ga0450896_001850_228_1499 403
360 3300042876 Ga0451577_0032813 Ga0451577_0032813_1136_2422 403
361 3300046462 Ga0495651_0113611 Ga0495651_0113611_337_1611 403
362 3300046536 Ga0495587_0115732 Ga0495587_0115732_42_1316 403
363 3300046683 Ga0495658_0096718 Ga0495658_0096718_144_1445 403
364 3300047319 Ga0495674_0117734 Ga0495674_0117734_937_2214 403
365 3300048915 Ga0496112_0234368 Ga0496112_0234368_89_1375 403
366 3300049568 Ga0501031_0002290 Ga0501031_0002290_5825_7273 403
367 3300049569 Ga0501032_0003907 Ga0501032_0003907_5104_6552 403
368 3300049570 Ga0501033_0006400 Ga0501033_0006400_4494_5942 403
369 3300049570 Ga0501033_0089438 Ga0501033_0089438_206_1648 403
370 3300049571 Ga0501034_0107382 Ga0501034_0107382_252_1694 403
371 3300049572 Ga0501036_0001004 Ga0501036_0001004_18459_19907 403
372 3300049572 Ga0501036_0146576 Ga0501036_0146576_473_1861 403
373 3300049573 Ga0501037_0005576 Ga0501037_0005576_3410_4858 403
374 3300049574 Ga0501038_0009366 Ga0501038_0009366_4075_5523 403
375 3300049575 Ga0501039_0006831 Ga0501039_0006831_2853_4301 403
376 3300049578 Ga0501042_0021727 Ga0501042_0021727_1490_2938 403
377 3300049578 Ga0501042_0117357 Ga0501042_0117357_453_1841 403
378 3300049579 Ga0501043_0013100 Ga0501043_0013100_186_1628 403
379 3300049580 Ga0501046_0011996 Ga0501046_0011996_1059_2507 403
380 3300049580 Ga0501046_0012166 Ga0501046_0012166_4747_6189 403
381 3300049581 Ga0501047_0027143 Ga0501047_0027143_274_1722 403
382 3300049582 Ga0501048_0022176 Ga0501048_0022176_121_1569 403
383 3300049582 Ga0501048_0065165 Ga0501048_0065165_271_1713 403
384 3300049583 Ga0501067_0002039 Ga0501067_0002039_3829_5277 403
385 3300049583 Ga0501067_0030261 Ga0501067_0030261_1159_2601 403
386 3300049584 Ga0501068_0007073 Ga0501068_0007073_4330_5778 403
387 3300049585 Ga0501069_0000895 Ga0501069_0000895_5795_7243 403
388 3300049587 Ga0501071_0011092 Ga0501071_0011092_4454_5902 403
389 3300049588 Ga0501072_0037419 Ga0501072_0037419_2327_3715 403
390 3300049588 Ga0501072_0095071 Ga0501072_0095071_153_1436 403
391 3300049589 Ga0501073_0000607 Ga0501073_0000607_22753_24201 403
392 3300049590 Ga0501074_0007919 Ga0501074_0007919_1520_2968 403
393 3300049591 Ga0501075_0158146 Ga0501075_0158146_177_1565 403
394 3300049741 Ga0501079_0008647 Ga0501079_0008647_5874_7157 403
395 3300049741 Ga0501079_0011149 Ga0501079_0011149_4067_5515 403
396 3300049741 Ga0501079_0049331 Ga0501079_0049331_1074_2516 403
397 3300049742 Ga0501080_0072142 Ga0501080_0072142_1341_2789 403
398 3300049742 Ga0501080_0100981 Ga0501080_0100981_1275_2558 403
399 3300049743 Ga0501081_0186418 Ga0501081_0186418_55_1338 403
400 3300049744 Ga0501083_0018068 Ga0501083_0018068_1221_2663 403
401 3300049822 Ga0501035_0017870 Ga0501035_0017870_3818_5260 403
402 3300049822 Ga0501035_0018426 Ga0501035_0018426_1576_3024 403
403 3300049823 Ga0501044_0008738 Ga0501044_0008738_4075_5523 403
404 3300049823 Ga0501044_0012562 Ga0501044_0012562_6004_7446 403
405 3300049824 Ga0501045_0009378 Ga0501045_0009378_1422_2810 403
406 3300050507 nmdc:mga05p37_53_c1 nmdc:mga05p37_53_c1_67485_68756 403
407 3300050508 nmdc:mga09592_29716_c1 nmdc:mga09592_29716_c1_943_2214 403
408 3300050511 nmdc:mga08y16_1010_c1 nmdc:mga08y16_1010_c1_13684_14985 403
409 3300050511 nmdc:mga08y16_19487_c1 nmdc:mga08y16_19487_c1_1789_3186 403
410 3300053085 Ga0495619_0053013 Ga0495619_0053013_1224_2528 403
411 3300054114 Ga0501084_0046925 Ga0501084_0046925_1262_2545 403
412 3300060353 Ga0501082_0008037 Ga0501082_0008037_4708_6156 403
413 3300060353 Ga0501082_0021986 Ga0501082_0021986_2984_4426 403
414 3300061734 Ga0530510_0047198 Ga0530510_0047198_137_1525 403
415 3300005290 Ga0065712_10068848 Ga0065712_100688484 404
416 3300005329 Ga0070683_100002681 Ga0070683_1000026811 404
417 3300005340 Ga0070689_100075720 Ga0070689_1000757202 404
418 3300005365 Ga0070688_100039373 Ga0070688_1000393732 404
419 3300005367 Ga0070667_100162568 Ga0070667_1001625682 404
420 3300005456 Ga0070678_100131329 Ga0070678_1001313292 404
421 3300005457 Ga0070662_100040145 Ga0070662_1000401453 404
422 3300005459 Ga0068867_100130968 Ga0068867_1001309682 404
423 3300005535 Ga0070684_100000296 Ga0070684_1000002964 404
424 3300005564 Ga0070664_100018420 Ga0070664_1000184205 404
425 3300005843 Ga0068860_100223461 Ga0068860_1002234612 404
426 3300005843 Ga0068860_100236808 Ga0068860_1002368082 404
427 3300006852 Ga0075433_10026243 Ga0075433_100262433 404
428 3300006852 Ga0075433_10030578 Ga0075433_100305784 404
429 3300006871 Ga0075434_100144130 Ga0075434_1001441302 404
430 3300009094 Ga0111539_10032816 Ga0111539_100328163 404
431 3300009147 Ga0114129_10013735 Ga0114129_100137355 404
432 3300009177 Ga0105248_10009770 Ga0105248_100097706 404
433 3300009553 Ga0105249_10021108 Ga0105249_100211085 404
434 3300014326 Ga0157380_10123434 Ga0157380_101234342 404
435 3300025933 Ga0207706_10149531 Ga0207706_101495312 404
436 3300025936 Ga0207670_10016523 Ga0207670_100165232 404
437 3300025944 Ga0207661_10000429 Ga0207661_1000042920 404
438 3300025944 Ga0207661_10104141 Ga0207661_101041412 404
439 3300025945 Ga0207679_10006877 Ga0207679_100068772 404
440 3300025961 Ga0207712_10018526 Ga0207712_100185263 404
441 3300025986 Ga0207658_10137274 Ga0207658_101372742 404
442 3300026067 Ga0207678_10028860 Ga0207678_100288604 404
443 3300026121 Ga0207683_10047807 Ga0207683_100478073 404
444 3300028381 Ga0268264_10148062 Ga0268264_101480622 404
445 3300031901 Ga0307406_10144779 Ga0307406_101447791 404
446 3300032126 Ga0307415_100159639 Ga0307415_1001596391 404
447 3300048904 Ga0496101_0208576 Ga0496101_0208576_129_1430 404
448 3300048908 Ga0496105_0010154 Ga0496105_0010154_4966_6267 404
449 3300048911 Ga0496108_0000908 Ga0496108_0000908_16352_17653 404
450 3300048912 Ga0496109_0001799 Ga0496109_0001799_9580_10881 404
451 3300048913 Ga0496110_0000066 Ga0496110_0000066_31463_32764 404
452 3300048914 Ga0496111_0023460 Ga0496111_0023460_760_2061 404
453 3300049570 Ga0501033_0027321 Ga0501033_0027321_906_2177 404
454 3300049573 Ga0501037_0060364 Ga0501037_0060364_826_2097 404
455 3300049575 Ga0501039_0013257 Ga0501039_0013257_632_1903 404
456 3300049576 Ga0501040_0004306 Ga0501040_0004306_6724_7995 404
457 3300049577 Ga0501041_0113125 Ga0501041_0113125_231_1502 404
458 3300049579 Ga0501043_0015508 Ga0501043_0015508_1123_2394 404
459 3300049580 Ga0501046_0022214 Ga0501046_0022214_1229_2500 404
460 3300049584 Ga0501068_0013818 Ga0501068_0013818_1698_2969 404
461 3300049587 Ga0501071_0002561 Ga0501071_0002561_1221_2492 404
462 3300049588 Ga0501072_0045151 Ga0501072_0045151_1051_2322 404
463 3300049591 Ga0501075_0001836 Ga0501075_0001836_10064_11335 404
464 3300049592 Ga0501076_0039574 Ga0501076_0039574_619_1890 404
465 3300049593 Ga0501077_0022163 Ga0501077_0022163_1531_2802 404
466 3300049741 Ga0501079_0002271 Ga0501079_0002271_9357_10628 404
467 3300049743 Ga0501081_0002262 Ga0501081_0002262_9584_10855 404
468 3300049824 Ga0501045_0015997 Ga0501045_0015997_3223_4494 404
469 3300050507 nmdc:mga05p37_26005_c1 nmdc:mga05p37_26005_c1_2311_3663 404
470 3300050511 nmdc:mga08y16_45778_c1 nmdc:mga08y16_45778_c1_2854_4293 404
471 3300050515 nmdc:mga0a205_121303_c1 nmdc:mga0a205_121303_c1_826_2178 404
472 3300050515 nmdc:mga0a205_23179_c1 nmdc:mga0a205_23179_c1_2491_3795 404
473 3300054114 Ga0501084_0006062 Ga0501084_0006062_7449_8720 404
474 3300060353 Ga0501082_0023210 Ga0501082_0023210_1158_2429 404
475 3300005347 Ga0070668_100164549 Ga0070668_1001645491 405
476 3300005549 Ga0070704_100044031 Ga0070704_1000440312 405
477 3300005937 Ga0081455_10066961 Ga0081455_100669612 405
478 3300009098 Ga0105245_10055351 Ga0105245_100553512 405
479 3300049572 Ga0501036_0066581 Ga0501036_0066581_288_1661 405
480 3300049578 Ga0501042_0100062 Ga0501042_0100062_536_1909 405
481 3300049587 Ga0501071_0048111 Ga0501071_0048111_247_1620 405
482 3300049588 Ga0501072_0001720 Ga0501072_0001720_13365_14738 405
483 3300049590 Ga0501074_0054310 Ga0501074_0054310_74_1363 405
484 3300049591 Ga0501075_0052020 Ga0501075_0052020_413_1786 405
485 3300049592 Ga0501076_0087760 Ga0501076_0087760_595_1968 405
486 3300049743 Ga0501081_0062481 Ga0501081_0062481_690_2063 405
487 3300049824 Ga0501045_0016504 Ga0501045_0016504_1295_2668 405
488 3300054114 Ga0501084_0165664 Ga0501084_0165664_295_1668 405
489 3300060353 Ga0501082_0063505 Ga0501082_0063505_1253_2626 405
490 3300005356 Ga0070674_100005846 Ga0070674_1000058464 406
491 3300005459 Ga0068867_100053704 Ga0068867_1000537042 406
492 3300005719 Ga0068861_100088694 Ga0068861_1000886942 406
493 3300005842 Ga0068858_100034888 Ga0068858_1000348883 406
494 3300009094 Ga0111539_10065903 Ga0111539_100659032 406
495 3300025937 Ga0207669_10004136 Ga0207669_100041363 406
496 3300025972 Ga0207668_10095231 Ga0207668_100952312 406
497 3300026035 Ga0207703_10056825 Ga0207703_100568253 406
498 3300026089 Ga0207648_10069175 Ga0207648_100691752 406
499 3300026118 Ga0207675_100120274 Ga0207675_1001202742 406
500 3300026118 Ga0207675_100212155 Ga0207675_1002121552 406
501 3300047673 Ga0495593_0086771 Ga0495593_0086771_47_1357 406
502 3300005290 Ga0065712_10069564 Ga0065712_100695643 407
503 3300005436 Ga0070713_100006103 Ga0070713_1000061037 407
504 3300005440 Ga0070705_100030206 Ga0070705_1000302062 407
505 3300005471 Ga0070698_100056026 Ga0070698_1000560263 407
506 3300005544 Ga0070686_100138497 Ga0070686_1001384972 407
507 3300005546 Ga0070696_100101850 Ga0070696_1001018502 407
508 3300006028 Ga0070717_10043490 Ga0070717_100434902 407
509 3300006871 Ga0075434_100036218 Ga0075434_1000362182 407
510 3300007076 Ga0075435_100000679 Ga0075435_10000067918 407
511 3300009094 Ga0111539_10004791 Ga0111539_100047918 407
512 3300009147 Ga0114129_10055038 Ga0114129_100550384 407
513 3300025928 Ga0207700_10121147 Ga0207700_101211472 407
514 3300026035 Ga0207703_10048095 Ga0207703_100480953 407
515 3300026118 Ga0207675_100058162 Ga0207675_1000581622 407
516 3300046517 Ga0495630_0005297 Ga0495630_0005297_7488_8807 407
517 3300046536 Ga0495587_0031483 Ga0495587_0031483_80_1399 407
518 3300046559 Ga0495667_0138216 Ga0495667_0138216_164_1483 407
519 3300046689 Ga0495613_0009377 Ga0495613_0009377_1424_2743 407
520 3300047317 Ga0495604_0010365 Ga0495604_0010365_5573_6892 407
521 3300047471 Ga0495684_0000549 Ga0495684_0000549_21411_22730 407
522 3300050507 nmdc:mga05p37_42381_c1 nmdc:mga05p37_42381_c1_2609_3901 407
523 3300050511 nmdc:mga08y16_8502_c1 nmdc:mga08y16_8502_c1_2069_3361 407
524 3300050512 nmdc:mga0n895_21730_c1 nmdc:mga0n895_21730_c1_3854_5179 407
525 3300050513 nmdc:mga0rr50_1059_c1 nmdc:mga0rr50_1059_c1_6133_7458 407
526 3300053077 Ga0495601_0022543 Ga0495601_0022543_386_1708 407
527 3300053085 Ga0495619_0148837 Ga0495619_0148837_259_1578 407
528 3300005331 Ga0070670_100032413 Ga0070670_1000324134 408
529 3300005340 Ga0070689_100181020 Ga0070689_1001810201 408
530 3300005354 Ga0070675_100139288 Ga0070675_1001392882 408
531 3300005365 Ga0070688_100055951 Ga0070688_1000559512 408
532 3300005459 Ga0068867_100136177 Ga0068867_1001361772 408
533 3300005535 Ga0070684_100049573 Ga0070684_1000495733 408
534 3300005548 Ga0070665_100159982 Ga0070665_1001599822 408
535 3300005842 Ga0068858_100001614 Ga0068858_10000161414 408
536 3300005843 Ga0068860_100056083 Ga0068860_1000560833 408
537 3300006237 Ga0097621_100038470 Ga0097621_1000384702 408
538 3300006844 Ga0075428_100000034 Ga0075428_10000003467 408
539 3300007076 Ga0075435_100005712 Ga0075435_1000057128 408
540 3300009094 Ga0111539_10000014 Ga0111539_10000014222 408
541 3300009098 Ga0105245_10017071 Ga0105245_100170715 408
542 3300009101 Ga0105247_10053301 Ga0105247_100533013 408
543 3300009147 Ga0114129_10127174 Ga0114129_101271742 408
544 3300009176 Ga0105242_10058986 Ga0105242_100589862 408
545 3300009176 Ga0105242_10166578 Ga0105242_101665781 408
546 3300009177 Ga0105248_10036771 Ga0105248_100367712 408
547 3300013308 Ga0157375_10184391 Ga0157375_101843912 408
548 3300014969 Ga0157376_10252474 Ga0157376_102524742 408
549 3300025893 Ga0207682_10019050 Ga0207682_100190502 408
550 3300025901 Ga0207688_10049866 Ga0207688_100498662 408
551 3300026035 Ga0207703_10071876 Ga0207703_100718762 408
552 3300026089 Ga0207648_10033008 Ga0207648_100330083 408
553 3300026118 Ga0207675_100152372 Ga0207675_1001523722 408
554 3300026121 Ga0207683_10072146 Ga0207683_100721462 408
555 3300027907 Ga0207428_10000005 Ga0207428_1000000524 408
556 3300028379 Ga0268266_10069550 Ga0268266_100695503 408
557 3300028380 Ga0268265_10088139 Ga0268265_100881392 408
558 3300050507 nmdc:mga05p37_3329_c1 nmdc:mga05p37_3329_c1_1409_2689 408
559 3300050511 nmdc:mga08y16_9_c1 nmdc:mga08y16_9_c1_530961_532292 408
560 3300050513 nmdc:mga0rr50_3418_c1 nmdc:mga0rr50_3418_c1_6873_8162 408
561 3300050515 nmdc:mga0a205_17656_c1 nmdc:mga0a205_17656_c1_735_2015 408
562 3300002459 JGI24751J29686_10001158 JGI24751J29686_100011582 409
563 3300005335 Ga0070666_10049715 Ga0070666_100497152 409
564 3300005353 Ga0070669_100102880 Ga0070669_1001028802 409
565 3300005468 Ga0070707_100257523 Ga0070707_1002575232 409
566 3300005518 Ga0070699_100000613 Ga0070699_10000061315 409
567 3300005518 Ga0070699_100261693 Ga0070699_1002616932 409
568 3300005548 Ga0070665_100002176 Ga0070665_1000021769 409
569 3300005548 Ga0070665_100022887 Ga0070665_1000228873 409
570 3300005563 Ga0068855_100039380 Ga0068855_1000393806 409
571 3300005563 Ga0068855_100174372 Ga0068855_1001743722 409
572 3300005617 Ga0068859_100003307 Ga0068859_10000330711 409
573 3300005617 Ga0068859_100281755 Ga0068859_1002817552 409
574 3300005618 Ga0068864_100002493 Ga0068864_1000024937 409
575 3300005618 Ga0068864_100021764 Ga0068864_1000217645 409
576 3300005841 Ga0068863_100025405 Ga0068863_1000254054 409
577 3300005842 Ga0068858_100007374 Ga0068858_1000073743 409
578 3300005842 Ga0068858_100021865 Ga0068858_1000218653 409
579 3300005985 Ga0081539_10010419 Ga0081539_100104193 409
580 3300006163 Ga0070715_10030456 Ga0070715_100304563 409
581 3300006237 Ga0097621_100000956 Ga0097621_1000009562 409
582 3300006358 Ga0068871_100018930 Ga0068871_1000189304 409
583 3300006358 Ga0068871_100107878 Ga0068871_1001078782 409
584 3300006844 Ga0075428_100054654 Ga0075428_1000546544 409
585 3300006871 Ga0075434_100000878 Ga0075434_1000008786 409
586 3300006881 Ga0068865_100010765 Ga0068865_1000107653 409
587 3300006914 Ga0075436_100015343 Ga0075436_1000153434 409
588 3300006914 Ga0075436_100023673 Ga0075436_1000236734 409
589 3300006931 Ga0097620_100003307 Ga0097620_1000033074 409
590 3300006931 Ga0097620_100281756 Ga0097620_1002817562 409
591 3300007076 Ga0075435_100000346 Ga0075435_1000003462 409
592 3300007076 Ga0075435_100004536 Ga0075435_1000045365 409
593 3300009094 Ga0111539_10087941 Ga0111539_100879413 409
594 3300009098 Ga0105245_10007142 Ga0105245_100071423 409
595 3300009101 Ga0105247_10027016 Ga0105247_100270163 409
596 3300009101 Ga0105247_10089183 Ga0105247_100891831 409
597 3300009147 Ga0114129_10003915 Ga0114129_1000391511 409
598 3300009147 Ga0114129_10010441 Ga0114129_100104413 409
599 3300009147 Ga0114129_10052603 Ga0114129_100526034 409
600 3300009147 Ga0114129_10232177 Ga0114129_102321772 409
601 3300009176 Ga0105242_10004909 Ga0105242_100049092 409
602 3300009176 Ga0105242_10141024 Ga0105242_101410242 409
603 3300009177 Ga0105248_10027721 Ga0105248_100277213 409
604 3300009177 Ga0105248_10253545 Ga0105248_102535452 409
605 3300009545 Ga0105237_10358350 Ga0105237_103583501 409
606 3300013308 Ga0157375_10246973 Ga0157375_102469732 409
607 3300014325 Ga0163163_10006204 Ga0163163_100062043 409
608 3300014325 Ga0163163_10111182 Ga0163163_101111822 409
609 3300014968 Ga0157379_10041814 Ga0157379_100418142 409
610 3300014968 Ga0157379_10118462 Ga0157379_101184622 409
611 3300014968 Ga0157379_10130196 Ga0157379_101301962 409
612 3300014969 Ga0157376_10063670 Ga0157376_100636702 409
613 3300014969 Ga0157376_10304445 Ga0157376_103044451 409
614 3300025900 Ga0207710_10012971 Ga0207710_100129713 409
615 3300025922 Ga0207646_10223324 Ga0207646_102233241 409
616 3300025923 Ga0207681_10102419 Ga0207681_101024192 409
617 3300025934 Ga0207686_10001273 Ga0207686_100012734 409
618 3300025938 Ga0207704_10002599 Ga0207704_100025992 409
619 3300025938 Ga0207704_10129605 Ga0207704_101296052 409
620 3300025941 Ga0207711_10026403 Ga0207711_100264033 409
621 3300025941 Ga0207711_10061858 Ga0207711_100618582 409
622 3300025941 Ga0207711_10102191 Ga0207711_101021912 409
623 3300025945 Ga0207679_10029141 Ga0207679_100291413 409
624 3300025986 Ga0207658_10032995 Ga0207658_100329954 409
625 3300026023 Ga0207677_10019524 Ga0207677_100195245 409
626 3300026035 Ga0207703_10004455 Ga0207703_100044556 409
627 3300026035 Ga0207703_10004637 Ga0207703_100046374 409
628 3300026075 Ga0207708_10094975 Ga0207708_100949752 409
629 3300026088 Ga0207641_10024194 Ga0207641_100241942 409
630 3300026088 Ga0207641_10129657 Ga0207641_101296572 409
631 3300026089 Ga0207648_10087812 Ga0207648_100878122 409
632 3300027907 Ga0207428_10128369 Ga0207428_101283692 409
633 3300028379 Ga0268266_10002791 Ga0268266_100027918 409
634 3300028379 Ga0268266_10002943 Ga0268266_1000294311 409
635 3300035089 Ga0373944_0005125 Ga0373944_0005125_272_1579 409
636 3300035241 Ga0373961_0019233 Ga0373961_0019233_34_1335 409
637 3300036401 Ga0373937_0037893 Ga0373937_0037893_227_1534 409
638 3300036401 Ga0373937_0107582 Ga0373937_0107582_904_2244 409
639 3300046459 Ga0495629_0135150 Ga0495629_0135150_67_1374 409
640 3300046535 Ga0495586_0139750 Ga0495586_0139750_30_1337 409
641 3300046539 Ga0495621_0025842 Ga0495621_0025842_209_1504 409
642 3300046543 Ga0495645_0001908 Ga0495645_0001908_4141_5448 409
643 3300046681 Ga0495647_0002504 Ga0495647_0002504_2168_3475 409
644 3300046683 Ga0495658_0020116 Ga0495658_0020116_1106_2413 409
645 3300046683 Ga0495658_0080835 Ga0495658_0080835_121_1428 409
646 3300048904 Ga0496101_0001942 Ga0496101_0001942_5254_6570 409
647 3300048907 Ga0496104_0011320 Ga0496104_0011320_3595_4902 409
648 3300048907 Ga0496104_0068648 Ga0496104_0068648_1797_3113 409
649 3300048907 Ga0496104_0093056 Ga0496104_0093056_1022_2368 409
650 3300048910 Ga0496107_0062136 Ga0496107_0062136_246_1562 409
651 3300048911 Ga0496108_0019676 Ga0496108_0019676_384_1691 409
652 3300048912 Ga0496109_0256091 Ga0496109_0256091_160_1467 409
653 3300048915 Ga0496112_0055158 Ga0496112_0055158_2169_3476 409
654 3300048915 Ga0496112_0148779 Ga0496112_0148779_759_2105 409
655 3300048916 Ga0496113_0187683 Ga0496113_0187683_24_1331 409
656 3300048917 Ga0496114_0001859 Ga0496114_0001859_1823_3139 409
657 3300048917 Ga0496114_0068178 Ga0496114_0068178_237_1544 409
658 3300048917 Ga0496114_0188124 Ga0496114_0188124_334_1641 409
659 3300050507 nmdc:mga05p37_53213_c1 nmdc:mga05p37_53213_c1_2969_4258 409
660 3300050507 nmdc:mga05p37_67575_c1 nmdc:mga05p37_67575_c1_2422_3729 409
661 3300050507 nmdc:mga05p37_8845_c1 nmdc:mga05p37_8845_c1_3476_4780 409
662 3300050511 nmdc:mga08y16_36347_c1 nmdc:mga08y16_36347_c1_2915_4219 409
663 3300050511 nmdc:mga08y16_4948_c1 nmdc:mga08y16_4948_c1_10565_11881 409
664 3300050512 nmdc:mga0n895_35_c1 nmdc:mga0n895_35_c1_26334_27632 409
665 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_26334_27632 409
666 3300050514 nmdc:mga08x19_41407_c1 nmdc:mga08x19_41407_c1_1021_2328 409
667 3300050514 nmdc:mga08x19_4860_c1 nmdc:mga08x19_4860_c1_1111_2409 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

281

436

0.9

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

315

394

0.86

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

290

422

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6me5-assembly1.cif.gz_A xfel crystal structure of human melatonin receptor mt1 in complex with agomelatine 0.8095 226 386
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.7973 237 386
6tpk-assembly1.cif.gz_A crystal structure of the human oxytocin receptor 0.7938 226 388
6kqi-assembly1.cif.gz_A structure of an allosteric modulator bound to the cb1 cannabinoid receptor 0.7926 226 405
4s0v-assembly1.cif.gz_A crystal structure of the human ox2 orexin receptor bound to the insomnia drug suvorexant 0.7846 226 386
ID Description Score Start End Superfamily
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8897 229 389 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.868 243 386 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8609 236 385 3.40.50.2000
3okaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8537 226 386 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8505 237 385 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A521T918-F1-model_v4 Glycosyltransferase family 1 protein 0.9964 1 180
AF-A0A497PN64-F1-model_v4 Glycosyltransferase family 1 protein 0.9816 1 165 GO:0016740
AF-A0A521T918-F1-model_v4 Glycosyltransferase family 1 protein 0.9801 1 180
AF-A0A2V7V5Z4-F1-model_v4 Hexosyltransferase 0.9776 1 167 GO:0016740
AF-A0A832TGL2-F1-model_v4 Glycosyltransferase family 4 protein 0.9714 1 73 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map