F473824
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 667 | 280 | 667 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100174372|Ga0068855_1001743722 |
| Length | 461 |
| Sequence | MKLAFVIQRYGAEVLGGSEQLCRLLAERLATQHEVDVLTTCARDYVTWKNEYPEGTDRVRGVTIRRFANALTRDIESFNRYSDWIFSNPHSRSDEMEWLKQQGPWCPPLIEYLRRNHQQYDVLIFFTYLYATTVQGIEVNPGRSVLVPTAHDEPAITLDIYKDVFTKAGALCYLTDSERRFVQEQFPDRPLLEELIGVGIDLPQQQPYPRMPERQDDDAAPAADAHVNTDVEGVGSAALAEASGNPGFSDRSEDTPTETADAPGDQEVARYPSHLLSRGSVFRRRHRLHGPFALYGGRIDPGKGCEELLEYFAGYVKEGGEATLALMGAKLMPLPEDPSVRFAGLLSDNERIQALEAATVVICPSPYESLSLLALEALSVGTPILVNARSEVLVEHCVRSNGGLWYADRDEFVECLNLLVRDARLRAMLGRNGRDYVRTNYRWDIVLGKYERMFAKVRNAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 181 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 182 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 183 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 184 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 185 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 186 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 187 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 188 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 189 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 261 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 262 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 276 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 278 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0 |
| Rhizoplane | 4.2 |
| Rhizosphere | 93.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001158 | 3300002459 | Bacteria | 5643 |
| 2 | Ga0065712_10068848 | 3300005290 | Bacteria | 8802 |
| 3 | Ga0065712_10069564 | 3300005290 | Bacteria | 7049 |
| 4 | Ga0065712_10117712 | 3300005290 | Bacteria | 1716 |
| 5 | Ga0065707_10001377 | 3300005295 | Bacteria | 8301 |
| 6 | Ga0065707_10106896 | 3300005295 | Bacteria | 2576 |
| 7 | Ga0065707_10117683 | 3300005295 | Bacteria | 2189 |
| 8 | Ga0070676_10015175 | 3300005328 | Bacteria | 4247 |
| 9 | Ga0070683_100002681 | 3300005329 | Bacteria | 14230 |
| 10 | Ga0070690_100051254 | 3300005330 | Bacteria | 2634 |
| 11 | Ga0070690_100057147 | 3300005330 | Bacteria | 2503 |
| 12 | Ga0070670_100006560 | 3300005331 | Bacteria | 9857 |
| 13 | Ga0070670_100032413 | 3300005331 | Bacteria | 4501 |
| 14 | Ga0068869_100061753 | 3300005334 | Bacteria | 2749 |
| 15 | Ga0068869_100103708 | 3300005334 | Unclassified | 2155 |
| 16 | Ga0070666_10039811 | 3300005335 | Unclassified | 3135 |
| 17 | Ga0070666_10049715 | 3300005335 | Bacteria | 2819 |
| 18 | Ga0070666_10176202 | 3300005335 | Bacteria | 1499 |
| 19 | Ga0068868_100055744 | 3300005338 | Bacteria | 3120 |
| 20 | Ga0068868_100144699 | 3300005338 | Bacteria | 1954 |
| 21 | Ga0070689_100004045 | 3300005340 | Bacteria | 9867 |
| 22 | Ga0070689_100075720 | 3300005340 | Bacteria | 2635 |
| 23 | Ga0070689_100181020 | 3300005340 | Bacteria | 1712 |
| 24 | Ga0070691_10002086 | 3300005341 | Bacteria | 8838 |
| 25 | Ga0070687_100021027 | 3300005343 | Bacteria | 3060 |
| 26 | Ga0070668_100039083 | 3300005347 | Bacteria | 3629 |
| 27 | Ga0070668_100133655 | 3300005347 | Bacteria | 1993 |
| 28 | Ga0070668_100164549 | 3300005347 | Bacteria | 1802 |
| 29 | Ga0070669_100000622 | 3300005353 | Bacteria | 26211 |
| 30 | Ga0070669_100015230 | 3300005353 | Bacteria | 5477 |
| 31 | Ga0070669_100049939 | 3300005353 | Bacteria | 3055 |
| 32 | Ga0070669_100102880 | 3300005353 | Bacteria | 2157 |
| 33 | Ga0070669_100188684 | 3300005353 | Unclassified | 1616 |
| 34 | Ga0070675_100001360 | 3300005354 | Bacteria | 17903 |
| 35 | Ga0070675_100068176 | 3300005354 | Bacteria | 2946 |
| 36 | Ga0070675_100139288 | 3300005354 | Bacteria | 2073 |
| 37 | Ga0070671_100024333 | 3300005355 | Bacteria | 4956 |
| 38 | Ga0070674_100005846 | 3300005356 | Bacteria | 7151 |
| 39 | Ga0070674_100021777 | 3300005356 | Bacteria | 4123 |
| 40 | Ga0070673_100005813 | 3300005364 | Bacteria | 7946 |
| 41 | Ga0070688_100039373 | 3300005365 | Bacteria | 2892 |
| 42 | Ga0070688_100055951 | 3300005365 | Bacteria | 2476 |
| 43 | Ga0070688_100078098 | 3300005365 | Bacteria | 2135 |
| 44 | Ga0070659_100043785 | 3300005366 | Bacteria | 3502 |
| 45 | Ga0070667_100033513 | 3300005367 | Bacteria | 4294 |
| 46 | Ga0070667_100162568 | 3300005367 | Unclassified | 1967 |
| 47 | Ga0070713_100006103 | 3300005436 | Bacteria | 8312 |
| 48 | Ga0070701_10000954 | 3300005438 | Bacteria | 10486 |
| 49 | Ga0070701_10028064 | 3300005438 | Bacteria | 2764 |
| 50 | Ga0070705_100030206 | 3300005440 | Bacteria | 2989 |
| 51 | Ga0070705_100054740 | 3300005440 | Bacteria | 2342 |
| 52 | Ga0070694_100091885 | 3300005444 | Bacteria | 2131 |
| 53 | Ga0070708_100149137 | 3300005445 | Bacteria | 2174 |
| 54 | Ga0070678_100131329 | 3300005456 | Bacteria | 1990 |
| 55 | Ga0070662_100040145 | 3300005457 | Bacteria | 3331 |
| 56 | Ga0070681_10020649 | 3300005458 | Bacteria | 6599 |
| 57 | Ga0068867_100003453 | 3300005459 | Bacteria | 11115 |
| 58 | Ga0068867_100053704 | 3300005459 | Bacteria | 2976 |
| 59 | Ga0068867_100130968 | 3300005459 | Unclassified | 1949 |
| 60 | Ga0068867_100136177 | 3300005459 | Unclassified | 1915 |
| 61 | Ga0070707_100066645 | 3300005468 | Bacteria | 3461 |
| 62 | Ga0070707_100257523 | 3300005468 | Bacteria | 1698 |
| 63 | Ga0070698_100056026 | 3300005471 | Bacteria | 3995 |
| 64 | Ga0070698_100218919 | 3300005471 | Unclassified | 1838 |
| 65 | Ga0070699_100000613 | 3300005518 | Bacteria | 33675 |
| 66 | Ga0070699_100261693 | 3300005518 | Unclassified | 1547 |
| 67 | Ga0070679_100100370 | 3300005530 | Bacteria | 2881 |
| 68 | Ga0070684_100000296 | 3300005535 | Bacteria | 34560 |
| 69 | Ga0070684_100049573 | 3300005535 | Bacteria | 3645 |
| 70 | Ga0070697_100022134 | 3300005536 | Bacteria | 5043 |
| 71 | Ga0070672_100004683 | 3300005543 | Bacteria | 8969 |
| 72 | Ga0070686_100000398 | 3300005544 | Bacteria | 27472 |
| 73 | Ga0070686_100138497 | 3300005544 | Bacteria | 1691 |
| 74 | Ga0070695_100004151 | 3300005545 | Bacteria | 8466 |
| 75 | Ga0070695_100037685 | 3300005545 | Bacteria | 3048 |
| 76 | Ga0070696_100006167 | 3300005546 | Bacteria | 8009 |
| 77 | Ga0070696_100101850 | 3300005546 | Bacteria | 2059 |
| 78 | Ga0070693_100006549 | 3300005547 | Bacteria | 5649 |
| 79 | Ga0070693_100021115 | 3300005547 | Bacteria | 3446 |
| 80 | Ga0070665_100002176 | 3300005548 | Bacteria | 21848 |
| 81 | Ga0070665_100022887 | 3300005548 | Bacteria | 6291 |
| 82 | Ga0070665_100159982 | 3300005548 | Unclassified | 2254 |
| 83 | Ga0070704_100004365 | 3300005549 | Bacteria | 8169 |
| 84 | Ga0070704_100044031 | 3300005549 | Bacteria | 3099 |
| 85 | Ga0068855_100039380 | 3300005563 | Bacteria | 5611 |
| 86 | Ga0068855_100174372 | 3300005563 | Bacteria | 2434 |
| 87 | Ga0068855_100297026 | 3300005563 | Bacteria | 1789 |
| 88 | Ga0070664_100018420 | 3300005564 | Bacteria | 5736 |
| 89 | Ga0070664_100097895 | 3300005564 | Bacteria | 2548 |
| 90 | Ga0068857_100094445 | 3300005577 | Unclassified | 2678 |
| 91 | Ga0068854_100004892 | 3300005578 | Bacteria | 8449 |
| 92 | Ga0068854_100087739 | 3300005578 | Bacteria | 2308 |
| 93 | Ga0070702_100021477 | 3300005615 | Bacteria | 3397 |
| 94 | Ga0068859_100003307 | 3300005617 | Bacteria | 16387 |
| 95 | Ga0068859_100023420 | 3300005617 | Bacteria | 6196 |
| 96 | Ga0068859_100146147 | 3300005617 | Bacteria | 2439 |
| 97 | Ga0068859_100281755 | 3300005617 | Bacteria | 1755 |
| 98 | Ga0068864_100002493 | 3300005618 | Bacteria | 15218 |
| 99 | Ga0068864_100021764 | 3300005618 | Bacteria | 5371 |
| 100 | Ga0068866_10037558 | 3300005718 | Bacteria | 2379 |
| 101 | Ga0068861_100000413 | 3300005719 | Bacteria | 24723 |
| 102 | Ga0068861_100088694 | 3300005719 | Bacteria | 2436 |
| 103 | Ga0068863_100004381 | 3300005841 | Bacteria | 13919 |
| 104 | Ga0068863_100025405 | 3300005841 | Bacteria | 5648 |
| 105 | Ga0068858_100001614 | 3300005842 | Bacteria | 22989 |
| 106 | Ga0068858_100007374 | 3300005842 | Bacteria | 10643 |
| 107 | Ga0068858_100021865 | 3300005842 | Bacteria | 5974 |
| 108 | Ga0068858_100034888 | 3300005842 | Bacteria | 4666 |
| 109 | Ga0068858_100177072 | 3300005842 | Unclassified | 2013 |
| 110 | Ga0068858_100228784 | 3300005842 | Bacteria | 1762 |
| 111 | Ga0068860_100025269 | 3300005843 | Bacteria | 5732 |
| 112 | Ga0068860_100056083 | 3300005843 | Bacteria | 3747 |
| 113 | Ga0068860_100116559 | 3300005843 | Bacteria | 2556 |
| 114 | Ga0068860_100151713 | 3300005843 | Bacteria | 2231 |
| 115 | Ga0068860_100223461 | 3300005843 | Bacteria | 1829 |
| 116 | Ga0068860_100236808 | 3300005843 | Unclassified | 1775 |
| 117 | Ga0068862_100092634 | 3300005844 | Bacteria | 2634 |
| 118 | Ga0068862_100121508 | 3300005844 | Bacteria | 2302 |
| 119 | Ga0081455_10017270 | 3300005937 | Bacteria | 6925 |
| 120 | Ga0081455_10066961 | 3300005937 | Bacteria | 2995 |
| 121 | Ga0081539_10010419 | 3300005985 | Bacteria | 7553 |
| 122 | Ga0070717_10043490 | 3300006028 | Bacteria | 3667 |
| 123 | Ga0075365_10006494 | 3300006038 | Bacteria | 6439 |
| 124 | Ga0075364_10003347 | 3300006051 | Bacteria | 9094 |
| 125 | Ga0075364_10004372 | 3300006051 | Bacteria | 8115 |
| 126 | Ga0070715_10030456 | 3300006163 | Bacteria | 2182 |
| 127 | Ga0075362_10000228 | 3300006177 | Bacteria | 15674 |
| 128 | Ga0075367_10005874 | 3300006178 | Bacteria | 6152 |
| 129 | Ga0075367_10006108 | 3300006178 | Bacteria | 6054 |
| 130 | Ga0075367_10015401 | 3300006178 | Bacteria | 4155 |
| 131 | Ga0075366_10003831 | 3300006195 | Bacteria | 8010 |
| 132 | Ga0097621_100000956 | 3300006237 | Bacteria | 20258 |
| 133 | Ga0097621_100001586 | 3300006237 | Bacteria | 15557 |
| 134 | Ga0097621_100038470 | 3300006237 | Bacteria | 3839 |
| 135 | Ga0097621_100154988 | 3300006237 | Bacteria | 1966 |
| 136 | Ga0075370_10005896 | 3300006353 | Bacteria | 6127 |
| 137 | Ga0068871_100001365 | 3300006358 | Bacteria | 16365 |
| 138 | Ga0068871_100018930 | 3300006358 | Bacteria | 5247 |
| 139 | Ga0068871_100107878 | 3300006358 | Bacteria | 2339 |
| 140 | Ga0075428_100000034 | 3300006844 | Bacteria | 115982 |
| 141 | Ga0075428_100002999 | 3300006844 | Bacteria | 18417 |
| 142 | Ga0075428_100003031 | 3300006844 | Bacteria | 18347 |
| 143 | Ga0075428_100004161 | 3300006844 | Bacteria | 15927 |
| 144 | Ga0075428_100019276 | 3300006844 | Bacteria | 7548 |
| 145 | Ga0075428_100054654 | 3300006844 | Bacteria | 4375 |
| 146 | Ga0075428_100139456 | 3300006844 | Bacteria | 2636 |
| 147 | Ga0075430_100003478 | 3300006846 | Bacteria | 13175 |
| 148 | Ga0075430_100067543 | 3300006846 | Bacteria | 3001 |
| 149 | Ga0075430_100072088 | 3300006846 | Bacteria | 2897 |
| 150 | Ga0075431_100010127 | 3300006847 | Bacteria | 9474 |
| 151 | Ga0075431_100022064 | 3300006847 | Bacteria | 6511 |
| 152 | Ga0075431_100030339 | 3300006847 | Bacteria | 5568 |
| 153 | Ga0075431_100032202 | 3300006847 | Bacteria | 5402 |
| 154 | Ga0075431_100079221 | 3300006847 | Bacteria | 3391 |
| 155 | Ga0075433_10022893 | 3300006852 | Bacteria | 5250 |
| 156 | Ga0075433_10026243 | 3300006852 | Bacteria | 4930 |
| 157 | Ga0075433_10030578 | 3300006852 | Bacteria | 4596 |
| 158 | Ga0075433_10105219 | 3300006852 | Bacteria | 2500 |
| 159 | Ga0075434_100000878 | 3300006871 | Bacteria | 24045 |
| 160 | Ga0075434_100029094 | 3300006871 | Bacteria | 5433 |
| 161 | Ga0075434_100036218 | 3300006871 | Bacteria | 4881 |
| 162 | Ga0075434_100144130 | 3300006871 | Bacteria | 2402 |
| 163 | Ga0075434_100196110 | 3300006871 | Unclassified | 2039 |
| 164 | Ga0075429_100000822 | 3300006880 | Bacteria | 24352 |
| 165 | Ga0075429_100002301 | 3300006880 | Bacteria | 16031 |
| 166 | Ga0075429_100117818 | 3300006880 | Bacteria | 2321 |
| 167 | Ga0075429_100132721 | 3300006880 | Bacteria | 2179 |
| 168 | Ga0068865_100010765 | 3300006881 | Bacteria | 5703 |
| 169 | Ga0075436_100006788 | 3300006914 | Bacteria | 7833 |
| 170 | Ga0075436_100015343 | 3300006914 | Bacteria | 5248 |
| 171 | Ga0075436_100023673 | 3300006914 | Unclassified | 4218 |
| 172 | Ga0075436_100042574 | 3300006914 | Bacteria | 3132 |
| 173 | Ga0097620_100003307 | 3300006931 | Bacteria | 16387 |
| 174 | Ga0097620_100023420 | 3300006931 | Bacteria | 6196 |
| 175 | Ga0097620_100146147 | 3300006931 | Bacteria | 2439 |
| 176 | Ga0097620_100281756 | 3300006931 | Bacteria | 1755 |
| 177 | Ga0075435_100000346 | 3300007076 | Bacteria | 28639 |
| 178 | Ga0075435_100000679 | 3300007076 | Bacteria | 21089 |
| 179 | Ga0075435_100002619 | 3300007076 | Bacteria | 11989 |
| 180 | Ga0075435_100004536 | 3300007076 | Bacteria | 9548 |
| 181 | Ga0075435_100005712 | 3300007076 | Bacteria | 8721 |
| 182 | Ga0105240_10023069 | 3300009093 | Bacteria | 8242 |
| 183 | Ga0111539_10000014 | 3300009094 | Bacteria | 307501 |
| 184 | Ga0111539_10000341 | 3300009094 | Bacteria | 57424 |
| 185 | Ga0111539_10002441 | 3300009094 | Bacteria | 24713 |
| 186 | Ga0111539_10004791 | 3300009094 | Bacteria | 17654 |
| 187 | Ga0111539_10011360 | 3300009094 | Bacteria | 11179 |
| 188 | Ga0111539_10032816 | 3300009094 | Bacteria | 6305 |
| 189 | Ga0111539_10065903 | 3300009094 | Unclassified | 4278 |
| 190 | Ga0111539_10087941 | 3300009094 | Bacteria | 3650 |
| 191 | Ga0111539_10172107 | 3300009094 | Bacteria | 2530 |
| 192 | Ga0105245_10007142 | 3300009098 | Bacteria | 9796 |
| 193 | Ga0105245_10017071 | 3300009098 | Bacteria | 6334 |
| 194 | Ga0105245_10055351 | 3300009098 | Bacteria | 3563 |
| 195 | Ga0105245_10261961 | 3300009098 | Bacteria | 1683 |
| 196 | Ga0105247_10027016 | 3300009101 | Bacteria | 3470 |
| 197 | Ga0105247_10053301 | 3300009101 | Bacteria | 2495 |
| 198 | Ga0105247_10089183 | 3300009101 | Bacteria | 1955 |
| 199 | Ga0114129_10000162 | 3300009147 | Bacteria | 71781 |
| 200 | Ga0114129_10001494 | 3300009147 | Bacteria | 31640 |
| 201 | Ga0114129_10001979 | 3300009147 | Bacteria | 28017 |
| 202 | Ga0114129_10003915 | 3300009147 | Bacteria | 21010 |
| 203 | Ga0114129_10004232 | 3300009147 | Bacteria | 20267 |
| 204 | Ga0114129_10006811 | 3300009147 | Bacteria | 16229 |
| 205 | Ga0114129_10009633 | 3300009147 | Bacteria | 13783 |
| 206 | Ga0114129_10010441 | 3300009147 | Bacteria | 13244 |
| 207 | Ga0114129_10013735 | 3300009147 | Bacteria | 11544 |
| 208 | Ga0114129_10029670 | 3300009147 | Bacteria | 7745 |
| 209 | Ga0114129_10052603 | 3300009147 | Bacteria | 5716 |
| 210 | Ga0114129_10055038 | 3300009147 | Bacteria | 5576 |
| 211 | Ga0114129_10078021 | 3300009147 | Bacteria | 4607 |
| 212 | Ga0114129_10127174 | 3300009147 | Bacteria | 3503 |
| 213 | Ga0114129_10198136 | 3300009147 | Bacteria | 2722 |
| 214 | Ga0114129_10232177 | 3300009147 | Bacteria | 2484 |
| 215 | Ga0105243_10006372 | 3300009148 | Bacteria | 9117 |
| 216 | Ga0105241_10057507 | 3300009174 | Bacteria | 2984 |
| 217 | Ga0105241_10191700 | 3300009174 | Unclassified | 1702 |
| 218 | Ga0105242_10004909 | 3300009176 | Bacteria | 10351 |
| 219 | Ga0105242_10017911 | 3300009176 | Bacteria | 5531 |
| 220 | Ga0105242_10058986 | 3300009176 | Bacteria | 3148 |
| 221 | Ga0105242_10141024 | 3300009176 | Bacteria | 2091 |
| 222 | Ga0105242_10166578 | 3300009176 | Unclassified | 1934 |
| 223 | Ga0105248_10009770 | 3300009177 | Bacteria | 10570 |
| 224 | Ga0105248_10027721 | 3300009177 | Bacteria | 6307 |
| 225 | Ga0105248_10036771 | 3300009177 | Bacteria | 5476 |
| 226 | Ga0105248_10051860 | 3300009177 | Bacteria | 4603 |
| 227 | Ga0105248_10253545 | 3300009177 | Bacteria | 1980 |
| 228 | Ga0105248_10361829 | 3300009177 | Unclassified | 1633 |
| 229 | Ga0105237_10358350 | 3300009545 | Unclassified | 1463 |
| 230 | Ga0105249_10021108 | 3300009553 | Bacteria | 5829 |
| 231 | Ga0105249_10041421 | 3300009553 | Bacteria | 4187 |
| 232 | Ga0105249_10389112 | 3300009553 | Bacteria | 1422 |
| 233 | Ga0157378_10030313 | 3300013297 | Bacteria | 4780 |
| 234 | Ga0163162_10007328 | 3300013306 | Bacteria | 10721 |
| 235 | Ga0163162_10265269 | 3300013306 | Bacteria | 1849 |
| 236 | Ga0157375_10184391 | 3300013308 | Unclassified | 2240 |
| 237 | Ga0157375_10246973 | 3300013308 | Bacteria | 1945 |
| 238 | Ga0163163_10000042 | 3300014325 | Bacteria | 138794 |
| 239 | Ga0163163_10006204 | 3300014325 | Bacteria | 10426 |
| 240 | Ga0163163_10111182 | 3300014325 | Bacteria | 2769 |
| 241 | Ga0163163_10269454 | 3300014325 | Bacteria | 1754 |
| 242 | Ga0157380_10037082 | 3300014326 | Bacteria | 3776 |
| 243 | Ga0157380_10081302 | 3300014326 | Bacteria | 2650 |
| 244 | Ga0157380_10123434 | 3300014326 | Bacteria | 2197 |
| 245 | Ga0157379_10041814 | 3300014968 | Bacteria | 4091 |
| 246 | Ga0157379_10118462 | 3300014968 | Bacteria | 2382 |
| 247 | Ga0157379_10130196 | 3300014968 | Bacteria | 2264 |
| 248 | Ga0157379_10139997 | 3300014968 | Unclassified | 2181 |
| 249 | Ga0157376_10063670 | 3300014969 | Bacteria | 3108 |
| 250 | Ga0157376_10106949 | 3300014969 | Bacteria | 2455 |
| 251 | Ga0157376_10252474 | 3300014969 | Bacteria | 1648 |
| 252 | Ga0157376_10304445 | 3300014969 | Bacteria | 1510 |
| 253 | Ga0207697_10000393 | 3300025315 | Bacteria | 24614 |
| 254 | Ga0207682_10019050 | 3300025893 | Unclassified | 2686 |
| 255 | Ga0207682_10030495 | 3300025893 | Bacteria | 2160 |
| 256 | Ga0207710_10012971 | 3300025900 | Bacteria | 3511 |
| 257 | Ga0207688_10024502 | 3300025901 | Bacteria | 3309 |
| 258 | Ga0207688_10049866 | 3300025901 | Unclassified | 2341 |
| 259 | Ga0207680_10057438 | 3300025903 | Bacteria | 2354 |
| 260 | Ga0207647_10059036 | 3300025904 | Bacteria | 2348 |
| 261 | Ga0207645_10003141 | 3300025907 | Bacteria | 12665 |
| 262 | Ga0207645_10003173 | 3300025907 | Bacteria | 12589 |
| 263 | Ga0207707_10021944 | 3300025912 | Bacteria | 5580 |
| 264 | Ga0207707_10024587 | 3300025912 | Bacteria | 5272 |
| 265 | Ga0207671_10320056 | 3300025914 | Bacteria | 1227 |
| 266 | Ga0207662_10077793 | 3300025918 | Bacteria | 2018 |
| 267 | Ga0207649_10102916 | 3300025920 | Unclassified | 1894 |
| 268 | Ga0207652_10018502 | 3300025921 | Bacteria | 5717 |
| 269 | Ga0207646_10223324 | 3300025922 | Bacteria | 1702 |
| 270 | Ga0207681_10005978 | 3300025923 | Bacteria | 7464 |
| 271 | Ga0207681_10071419 | 3300025923 | Bacteria | 2421 |
| 272 | Ga0207681_10080522 | 3300025923 | Bacteria | 2297 |
| 273 | Ga0207681_10102419 | 3300025923 | Bacteria | 2067 |
| 274 | Ga0207650_10009788 | 3300025925 | Bacteria | 6553 |
| 275 | Ga0207659_10074984 | 3300025926 | Bacteria | 2481 |
| 276 | Ga0207700_10020049 | 3300025928 | Bacteria | 4531 |
| 277 | Ga0207700_10121147 | 3300025928 | Bacteria | 2121 |
| 278 | Ga0207644_10024422 | 3300025931 | Bacteria | 4149 |
| 279 | Ga0207690_10101915 | 3300025932 | Bacteria | 2052 |
| 280 | Ga0207706_10037640 | 3300025933 | Bacteria | 4295 |
| 281 | Ga0207706_10149531 | 3300025933 | Bacteria | 2054 |
| 282 | Ga0207686_10001273 | 3300025934 | Bacteria | 14490 |
| 283 | Ga0207686_10071733 | 3300025934 | Bacteria | 2230 |
| 284 | Ga0207709_10069011 | 3300025935 | Bacteria | 2236 |
| 285 | Ga0207670_10016523 | 3300025936 | Bacteria | 4438 |
| 286 | Ga0207669_10004136 | 3300025937 | Bacteria | 6360 |
| 287 | Ga0207704_10002599 | 3300025938 | Bacteria | 8145 |
| 288 | Ga0207704_10129605 | 3300025938 | Bacteria | 1744 |
| 289 | Ga0207691_10002022 | 3300025940 | Bacteria | 19849 |
| 290 | Ga0207711_10026403 | 3300025941 | Bacteria | 4873 |
| 291 | Ga0207711_10043255 | 3300025941 | Bacteria | 3841 |
| 292 | Ga0207711_10061858 | 3300025941 | Bacteria | 3228 |
| 293 | Ga0207711_10102191 | 3300025941 | Bacteria | 2537 |
| 294 | Ga0207661_10000429 | 3300025944 | Bacteria | 27131 |
| 295 | Ga0207661_10104141 | 3300025944 | Bacteria | 2389 |
| 296 | Ga0207679_10006877 | 3300025945 | Bacteria | 7210 |
| 297 | Ga0207679_10029141 | 3300025945 | Bacteria | 3841 |
| 298 | Ga0207679_10266354 | 3300025945 | Bacteria | 1464 |
| 299 | Ga0207667_10306731 | 3300025949 | Bacteria | 1622 |
| 300 | Ga0207651_10011390 | 3300025960 | Bacteria | 4979 |
| 301 | Ga0207651_10025134 | 3300025960 | Bacteria | 3698 |
| 302 | Ga0207712_10018526 | 3300025961 | Bacteria | 4536 |
| 303 | Ga0207712_10089853 | 3300025961 | Bacteria | 2259 |
| 304 | Ga0207668_10095231 | 3300025972 | Bacteria | 2197 |
| 305 | Ga0207640_10011564 | 3300025981 | Bacteria | 5001 |
| 306 | Ga0207658_10032995 | 3300025986 | Bacteria | 3690 |
| 307 | Ga0207658_10137274 | 3300025986 | Bacteria | 1974 |
| 308 | Ga0207677_10019524 | 3300026023 | Bacteria | 4095 |
| 309 | Ga0207677_10050250 | 3300026023 | Bacteria | 2819 |
| 310 | Ga0207677_10056134 | 3300026023 | Bacteria | 2696 |
| 311 | Ga0207703_10004455 | 3300026035 | Bacteria | 11505 |
| 312 | Ga0207703_10004637 | 3300026035 | Bacteria | 11231 |
| 313 | Ga0207703_10048095 | 3300026035 | Bacteria | 3441 |
| 314 | Ga0207703_10056825 | 3300026035 | Bacteria | 3189 |
| 315 | Ga0207703_10071876 | 3300026035 | Unclassified | 2858 |
| 316 | Ga0207703_10084295 | 3300026035 | Bacteria | 2657 |
| 317 | Ga0207703_10286660 | 3300026035 | Bacteria | 1497 |
| 318 | Ga0207678_10028860 | 3300026067 | Bacteria | 4844 |
| 319 | Ga0207678_10050742 | 3300026067 | Bacteria | 3584 |
| 320 | Ga0207708_10042030 | 3300026075 | Bacteria | 3485 |
| 321 | Ga0207708_10094975 | 3300026075 | Bacteria | 2302 |
| 322 | Ga0207641_10002396 | 3300026088 | Bacteria | 17302 |
| 323 | Ga0207641_10024194 | 3300026088 | Bacteria | 5006 |
| 324 | Ga0207641_10129657 | 3300026088 | Bacteria | 2263 |
| 325 | Ga0207648_10005077 | 3300026089 | Bacteria | 13342 |
| 326 | Ga0207648_10009859 | 3300026089 | Bacteria | 9109 |
| 327 | Ga0207648_10033008 | 3300026089 | Bacteria | 4567 |
| 328 | Ga0207648_10069175 | 3300026089 | Bacteria | 3076 |
| 329 | Ga0207648_10087812 | 3300026089 | Bacteria | 2714 |
| 330 | Ga0207676_10348754 | 3300026095 | Bacteria | 1368 |
| 331 | Ga0207674_10034107 | 3300026116 | Bacteria | 5323 |
| 332 | Ga0207674_10085973 | 3300026116 | Bacteria | 3139 |
| 333 | Ga0207675_100000511 | 3300026118 | Bacteria | 37642 |
| 334 | Ga0207675_100024641 | 3300026118 | Bacteria | 5594 |
| 335 | Ga0207675_100058162 | 3300026118 | Bacteria | 3608 |
| 336 | Ga0207675_100080110 | 3300026118 | Bacteria | 3061 |
| 337 | Ga0207675_100120274 | 3300026118 | Bacteria | 2484 |
| 338 | Ga0207675_100138244 | 3300026118 | Bacteria | 2313 |
| 339 | Ga0207675_100152372 | 3300026118 | Bacteria | 2201 |
| 340 | Ga0207675_100212155 | 3300026118 | Bacteria | 1863 |
| 341 | Ga0207683_10047807 | 3300026121 | Bacteria | 3747 |
| 342 | Ga0207683_10072146 | 3300026121 | Bacteria | 3054 |
| 343 | Ga0207428_10000005 | 3300027907 | Bacteria | 520045 |
| 344 | Ga0207428_10000816 | 3300027907 | Bacteria | 35146 |
| 345 | Ga0207428_10000998 | 3300027907 | Bacteria | 31385 |
| 346 | Ga0207428_10001623 | 3300027907 | Bacteria | 23347 |
| 347 | Ga0207428_10025669 | 3300027907 | Bacteria | 4929 |
| 348 | Ga0207428_10128369 | 3300027907 | Unclassified | 1941 |
| 349 | Ga0268266_10002791 | 3300028379 | Bacteria | 18207 |
| 350 | Ga0268266_10002943 | 3300028379 | Bacteria | 17587 |
| 351 | Ga0268266_10069550 | 3300028379 | Bacteria | 3050 |
| 352 | Ga0268265_10070434 | 3300028380 | Bacteria | 2719 |
| 353 | Ga0268265_10088139 | 3300028380 | Unclassified | 2472 |
| 354 | Ga0268264_10148062 | 3300028381 | Bacteria | 2102 |
| 355 | Ga0268264_10219425 | 3300028381 | Bacteria | 1750 |
| 356 | Ga0307408_100003522 | 3300031548 | Bacteria | 10656 |
| 357 | Ga0307408_100042020 | 3300031548 | Bacteria | 3244 |
| 358 | Ga0307408_100074645 | 3300031548 | Bacteria | 2517 |
| 359 | Ga0307405_10010720 | 3300031731 | Bacteria | 4765 |
| 360 | Ga0307405_10088012 | 3300031731 | Bacteria | 2048 |
| 361 | Ga0307413_10162999 | 3300031824 | Bacteria | 1568 |
| 362 | Ga0307410_10019796 | 3300031852 | Bacteria | 4102 |
| 363 | Ga0307406_10030987 | 3300031901 | Bacteria | 3253 |
| 364 | Ga0307406_10144779 | 3300031901 | Bacteria | 1687 |
| 365 | Ga0307412_10089321 | 3300031911 | Bacteria | 2151 |
| 366 | Ga0307409_100040993 | 3300031995 | Bacteria | 3454 |
| 367 | Ga0307409_100065661 | 3300031995 | Bacteria | 2857 |
| 368 | Ga0307416_100004129 | 3300032002 | Bacteria | 8700 |
| 369 | Ga0307416_100025043 | 3300032002 | Bacteria | 4367 |
| 370 | Ga0307416_100403871 | 3300032002 | Unclassified | 1405 |
| 371 | Ga0307414_10121306 | 3300032004 | Bacteria | 2010 |
| 372 | Ga0307411_10010050 | 3300032005 | Bacteria | 5020 |
| 373 | Ga0307411_10016203 | 3300032005 | Bacteria | 4215 |
| 374 | Ga0307411_10116247 | 3300032005 | Bacteria | 1925 |
| 375 | Ga0307411_10211915 | 3300032005 | Bacteria | 1496 |
| 376 | Ga0307415_100043427 | 3300032126 | Bacteria | 2999 |
| 377 | Ga0307415_100159639 | 3300032126 | Bacteria | 1746 |
| 378 | Ga0373928_0000525 | 3300035084 | Bacteria | 7474 |
| 379 | Ga0373929_0004174 | 3300035085 | Bacteria | 2592 |
| 380 | Ga0373934_0021084 | 3300035086 | Bacteria | 2509 |
| 381 | Ga0373940_0000040 | 3300035088 | Bacteria | 13934 |
| 382 | Ga0373944_0005125 | 3300035089 | Bacteria | 3444 |
| 383 | Ga0373951_0001092 | 3300035091 | Bacteria | 7259 |
| 384 | Ga0373952_0002000 | 3300035092 | Bacteria | 3683 |
| 385 | Ga0373932_0000338 | 3300035112 | Bacteria | 14295 |
| 386 | Ga0373936_0046050 | 3300035113 | Bacteria | 1758 |
| 387 | Ga0373939_0000129 | 3300035114 | Bacteria | 22200 |
| 388 | Ga0373939_0008652 | 3300035114 | Bacteria | 2501 |
| 389 | Ga0373956_0001725 | 3300035119 | Bacteria | 9016 |
| 390 | Ga0373960_0000070 | 3300035121 | Bacteria | 14646 |
| 391 | Ga0373943_0011113 | 3300035170 | Bacteria | 4046 |
| 392 | Ga0373946_0005220 | 3300035171 | Bacteria | 4682 |
| 393 | Ga0373942_0000050 | 3300035207 | Bacteria | 23361 |
| 394 | Ga0373942_0011074 | 3300035207 | Bacteria | 2133 |
| 395 | Ga0373961_0000288 | 3300035241 | Bacteria | 22649 |
| 396 | Ga0373961_0019233 | 3300035241 | Bacteria | 1792 |
| 397 | Ga0373962_0000753 | 3300035242 | Bacteria | 7369 |
| 398 | Ga0373935_0021161 | 3300035692 | Bacteria | 3981 |
| 399 | Ga0373933_0013664 | 3300035724 | Bacteria | 4503 |
| 400 | Ga0373933_0143171 | 3300035724 | Bacteria | 1510 |
| 401 | Ga0373947_0024525 | 3300035725 | Bacteria | 3515 |
| 402 | Ga0373947_0037563 | 3300035725 | Bacteria | 2874 |
| 403 | Ga0373937_0000130 | 3300036401 | Bacteria | 72827 |
| 404 | Ga0373937_0037893 | 3300036401 | Bacteria | 4394 |
| 405 | Ga0373937_0103299 | 3300036401 | Bacteria | 2647 |
| 406 | Ga0373937_0107582 | 3300036401 | Bacteria | 2593 |
| 407 | Ga0373925_0104487 | 3300037068 | Bacteria | 2181 |
| 408 | Ga0373925_0177187 | 3300037068 | Bacteria | 1685 |
| 409 | Ga0439433_0012485 | 3300041999 | Bacteria | 1863 |
| 410 | Ga0439450_001038 | 3300042008 | Bacteria | 3911 |
| 411 | Ga0450923_005080 | 3300042125 | Bacteria | 2107 |
| 412 | Ga0450895_000137 | 3300042132 | Bacteria | 3204 |
| 413 | Ga0450896_001850 | 3300042133 | Bacteria | 2674 |
| 414 | Ga0439446_0005323 | 3300042156 | Bacteria | 3307 |
| 415 | Ga0439434_0029164 | 3300042435 | Bacteria | 1673 |
| 416 | Ga0439435_0030656 | 3300042436 | Bacteria | 1459 |
| 417 | Ga0439464_0000358 | 3300042439 | Bacteria | 8850 |
| 418 | Ga0439460_0015942 | 3300042461 | Unclassified | 1996 |
| 419 | Ga0451577_0023812 | 3300042876 | Bacteria | 5577 |
| 420 | Ga0451577_0026012 | 3300042876 | Bacteria | 5303 |
| 421 | Ga0451577_0032813 | 3300042876 | Bacteria | 4680 |
| 422 | Ga0453684_0017361 | 3300044712 | Bacteria | 11153 |
| 423 | Ga0451576_0029209 | 3300045051 | Bacteria | 5900 |
| 424 | Ga0451576_0066935 | 3300045051 | Bacteria | 3739 |
| 425 | Ga0495592_0103423 | 3300046454 | Bacteria | 2026 |
| 426 | Ga0495629_0135150 | 3300046459 | Bacteria | 1717 |
| 427 | Ga0495651_0113611 | 3300046462 | Bacteria | 1999 |
| 428 | Ga0495628_0053130 | 3300046516 | Bacteria | 3199 |
| 429 | Ga0495630_0005297 | 3300046517 | Bacteria | 9103 |
| 430 | Ga0495586_0139750 | 3300046535 | Bacteria | 1359 |
| 431 | Ga0495587_0031483 | 3300046536 | Bacteria | 3212 |
| 432 | Ga0495587_0115732 | 3300046536 | Bacteria | 1538 |
| 433 | Ga0495621_0025842 | 3300046539 | Bacteria | 1976 |
| 434 | Ga0495645_0001908 | 3300046543 | Bacteria | 14162 |
| 435 | Ga0495667_0138216 | 3300046559 | Bacteria | 1570 |
| 436 | Ga0495647_0002504 | 3300046681 | Bacteria | 5823 |
| 437 | Ga0495658_0020116 | 3300046683 | Bacteria | 3497 |
| 438 | Ga0495658_0080835 | 3300046683 | Bacteria | 1907 |
| 439 | Ga0495658_0096718 | 3300046683 | Bacteria | 1757 |
| 440 | Ga0495669_0000451 | 3300046684 | Bacteria | 19317 |
| 441 | Ga0495613_0009377 | 3300046689 | Bacteria | 7263 |
| 442 | Ga0495604_0010365 | 3300047317 | Bacteria | 7382 |
| 443 | Ga0495674_0117734 | 3300047319 | Bacteria | 2247 |
| 444 | Ga0495684_0000549 | 3300047471 | Bacteria | 30432 |
| 445 | Ga0495684_0253525 | 3300047471 | Bacteria | 1279 |
| 446 | Ga0495593_0086771 | 3300047673 | Bacteria | 1614 |
| 447 | Ga0496101_0001942 | 3300048904 | Bacteria | 12521 |
| 448 | Ga0496101_0208576 | 3300048904 | Unclassified | 1513 |
| 449 | Ga0496102_0020187 | 3300048905 | Bacteria | 5884 |
| 450 | Ga0496102_0088111 | 3300048905 | Unclassified | 2869 |
| 451 | Ga0496103_0048379 | 3300048906 | Bacteria | 2628 |
| 452 | Ga0496104_0011320 | 3300048907 | Bacteria | 7986 |
| 453 | Ga0496104_0068648 | 3300048907 | Bacteria | 3368 |
| 454 | Ga0496104_0093056 | 3300048907 | Bacteria | 2883 |
| 455 | Ga0496105_0010154 | 3300048908 | Bacteria | 7397 |
| 456 | Ga0496106_0066413 | 3300048909 | Bacteria | 2747 |
| 457 | Ga0496107_0062136 | 3300048910 | Bacteria | 2706 |
| 458 | Ga0496108_0000908 | 3300048911 | Bacteria | 23090 |
| 459 | Ga0496108_0019676 | 3300048911 | Bacteria | 5545 |
| 460 | Ga0496108_0082563 | 3300048911 | Bacteria | 2725 |
| 461 | Ga0496109_0001799 | 3300048912 | Bacteria | 17830 |
| 462 | Ga0496109_0178448 | 3300048912 | Unclassified | 1994 |
| 463 | Ga0496109_0256091 | 3300048912 | Unclassified | 1648 |
| 464 | Ga0496110_0000066 | 3300048913 | Bacteria | 52504 |
| 465 | Ga0496111_0023460 | 3300048914 | Bacteria | 4332 |
| 466 | Ga0496112_0013877 | 3300048915 | Bacteria | 7453 |
| 467 | Ga0496112_0055158 | 3300048915 | Bacteria | 3906 |
| 468 | Ga0496112_0148779 | 3300048915 | Bacteria | 2309 |
| 469 | Ga0496112_0234368 | 3300048915 | Bacteria | 1790 |
| 470 | Ga0496113_0048883 | 3300048916 | Bacteria | 3148 |
| 471 | Ga0496113_0187683 | 3300048916 | Bacteria | 1640 |
| 472 | Ga0496114_0001859 | 3300048917 | Bacteria | 15987 |
| 473 | Ga0496114_0068178 | 3300048917 | Bacteria | 2986 |
| 474 | Ga0496114_0188124 | 3300048917 | Bacteria | 1805 |
| 475 | Ga0501031_0002290 | 3300049568 | Bacteria | 12129 |
| 476 | Ga0501031_0101901 | 3300049568 | Bacteria | 1873 |
| 477 | Ga0501032_0003907 | 3300049569 | Bacteria | 11304 |
| 478 | Ga0501032_0010633 | 3300049569 | Bacteria | 6626 |
| 479 | Ga0501033_0006400 | 3300049570 | Bacteria | 9223 |
| 480 | Ga0501033_0006968 | 3300049570 | Bacteria | 8824 |
| 481 | Ga0501033_0027321 | 3300049570 | Bacteria | 4290 |
| 482 | Ga0501033_0029228 | 3300049570 | Bacteria | 4141 |
| 483 | Ga0501033_0089438 | 3300049570 | Bacteria | 2252 |
| 484 | Ga0501034_0027751 | 3300049571 | Bacteria | 5756 |
| 485 | Ga0501034_0042744 | 3300049571 | Bacteria | 4587 |
| 486 | Ga0501034_0105193 | 3300049571 | Bacteria | 2815 |
| 487 | Ga0501034_0107382 | 3300049571 | Unclassified | 2783 |
| 488 | Ga0501034_0132882 | 3300049571 | Bacteria | 2471 |
| 489 | Ga0501036_0001004 | 3300049572 | Bacteria | 21312 |
| 490 | Ga0501036_0014950 | 3300049572 | Bacteria | 6475 |
| 491 | Ga0501036_0060686 | 3300049572 | Bacteria | 3203 |
| 492 | Ga0501036_0066581 | 3300049572 | Bacteria | 3048 |
| 493 | Ga0501036_0146576 | 3300049572 | Unclassified | 1991 |
| 494 | Ga0501037_0005576 | 3300049573 | Bacteria | 9176 |
| 495 | Ga0501037_0048744 | 3300049573 | Bacteria | 3102 |
| 496 | Ga0501037_0060364 | 3300049573 | Bacteria | 2766 |
| 497 | Ga0501038_0009366 | 3300049574 | Bacteria | 8984 |
| 498 | Ga0501038_0057631 | 3300049574 | Bacteria | 3334 |
| 499 | Ga0501038_0104071 | 3300049574 | Bacteria | 2359 |
| 500 | Ga0501039_0006831 | 3300049575 | Bacteria | 8681 |
| 501 | Ga0501039_0013257 | 3300049575 | Bacteria | 6303 |
| 502 | Ga0501039_0013896 | 3300049575 | Bacteria | 6159 |
| 503 | Ga0501039_0085672 | 3300049575 | Bacteria | 2454 |
| 504 | Ga0501040_0004306 | 3300049576 | Bacteria | 9245 |
| 505 | Ga0501040_0004359 | 3300049576 | Bacteria | 9199 |
| 506 | Ga0501040_0148663 | 3300049576 | Bacteria | 1652 |
| 507 | Ga0501041_0031740 | 3300049577 | Bacteria | 3193 |
| 508 | Ga0501041_0113125 | 3300049577 | Bacteria | 1684 |
| 509 | Ga0501042_0021727 | 3300049578 | Bacteria | 4474 |
| 510 | Ga0501042_0100062 | 3300049578 | Bacteria | 2084 |
| 511 | Ga0501042_0117357 | 3300049578 | Unclassified | 1916 |
| 512 | Ga0501043_0003533 | 3300049579 | Bacteria | 12847 |
| 513 | Ga0501043_0004130 | 3300049579 | Bacteria | 11861 |
| 514 | Ga0501043_0013100 | 3300049579 | Bacteria | 6481 |
| 515 | Ga0501043_0015508 | 3300049579 | Bacteria | 5971 |
| 516 | Ga0501046_0008447 | 3300049580 | Bacteria | 8984 |
| 517 | Ga0501046_0011996 | 3300049580 | Bacteria | 7394 |
| 518 | Ga0501046_0012166 | 3300049580 | Bacteria | 7335 |
| 519 | Ga0501046_0019178 | 3300049580 | Bacteria | 5674 |
| 520 | Ga0501046_0022214 | 3300049580 | Bacteria | 5228 |
| 521 | Ga0501046_0111290 | 3300049580 | Bacteria | 2091 |
| 522 | Ga0501047_0027143 | 3300049581 | Bacteria | 5515 |
| 523 | Ga0501047_0039199 | 3300049581 | Bacteria | 4583 |
| 524 | Ga0501047_0052128 | 3300049581 | Bacteria | 3954 |
| 525 | Ga0501047_0056527 | 3300049581 | Bacteria | 3795 |
| 526 | Ga0501047_0171434 | 3300049581 | Bacteria | 2038 |
| 527 | Ga0501048_0006989 | 3300049582 | Bacteria | 8574 |
| 528 | Ga0501048_0022176 | 3300049582 | Bacteria | 4646 |
| 529 | Ga0501048_0065165 | 3300049582 | Bacteria | 2576 |
| 530 | Ga0501048_0073412 | 3300049582 | Bacteria | 2414 |
| 531 | Ga0501067_0002039 | 3300049583 | Bacteria | 11138 |
| 532 | Ga0501067_0030261 | 3300049583 | Bacteria | 3003 |
| 533 | Ga0501068_0007073 | 3300049584 | Bacteria | 6215 |
| 534 | Ga0501068_0013818 | 3300049584 | Bacteria | 4600 |
| 535 | Ga0501068_0030745 | 3300049584 | Bacteria | 3187 |
| 536 | Ga0501069_0000895 | 3300049585 | Bacteria | 14204 |
| 537 | Ga0501070_0014530 | 3300049586 | Bacteria | 6624 |
| 538 | Ga0501071_0002561 | 3300049587 | Bacteria | 11088 |
| 539 | Ga0501071_0011092 | 3300049587 | Bacteria | 6057 |
| 540 | Ga0501071_0021206 | 3300049587 | Bacteria | 4524 |
| 541 | Ga0501071_0027320 | 3300049587 | Bacteria | 4015 |
| 542 | Ga0501071_0048111 | 3300049587 | Bacteria | 3065 |
| 543 | Ga0501072_0001720 | 3300049588 | Bacteria | 16307 |
| 544 | Ga0501072_0010573 | 3300049588 | Bacteria | 7028 |
| 545 | Ga0501072_0024218 | 3300049588 | Bacteria | 4721 |
| 546 | Ga0501072_0037419 | 3300049588 | Bacteria | 3806 |
| 547 | Ga0501072_0043479 | 3300049588 | Bacteria | 3530 |
| 548 | Ga0501072_0045151 | 3300049588 | Bacteria | 3464 |
| 549 | Ga0501072_0084761 | 3300049588 | Bacteria | 2513 |
| 550 | Ga0501072_0095071 | 3300049588 | Bacteria | 2368 |
| 551 | Ga0501073_0000607 | 3300049589 | Bacteria | 25259 |
| 552 | Ga0501073_0009602 | 3300049589 | Bacteria | 7134 |
| 553 | Ga0501073_0029037 | 3300049589 | Bacteria | 3951 |
| 554 | Ga0501074_0007919 | 3300049590 | Bacteria | 7695 |
| 555 | Ga0501074_0054310 | 3300049590 | Bacteria | 2889 |
| 556 | Ga0501075_0001836 | 3300049591 | Bacteria | 14012 |
| 557 | Ga0501075_0004412 | 3300049591 | Bacteria | 9519 |
| 558 | Ga0501075_0022260 | 3300049591 | Bacteria | 4627 |
| 559 | Ga0501075_0052020 | 3300049591 | Bacteria | 3080 |
| 560 | Ga0501075_0158146 | 3300049591 | Bacteria | 1728 |
| 561 | Ga0501076_0008340 | 3300049592 | Bacteria | 7592 |
| 562 | Ga0501076_0039574 | 3300049592 | Bacteria | 3701 |
| 563 | Ga0501076_0042439 | 3300049592 | Bacteria | 3581 |
| 564 | Ga0501076_0083065 | 3300049592 | Bacteria | 2572 |
| 565 | Ga0501076_0087760 | 3300049592 | Bacteria | 2500 |
| 566 | Ga0501077_0022163 | 3300049593 | Bacteria | 4023 |
| 567 | Ga0501077_0041518 | 3300049593 | Bacteria | 2928 |
| 568 | Ga0501079_0002271 | 3300049741 | Bacteria | 13876 |
| 569 | Ga0501079_0008647 | 3300049741 | Bacteria | 7724 |
| 570 | Ga0501079_0011149 | 3300049741 | Bacteria | 6855 |
| 571 | Ga0501079_0049331 | 3300049741 | Bacteria | 3248 |
| 572 | Ga0501079_0156979 | 3300049741 | Bacteria | 1773 |
| 573 | Ga0501080_0002482 | 3300049742 | Bacteria | 16155 |
| 574 | Ga0501080_0039499 | 3300049742 | Bacteria | 4404 |
| 575 | Ga0501080_0072142 | 3300049742 | Bacteria | 3212 |
| 576 | Ga0501080_0100981 | 3300049742 | Bacteria | 2676 |
| 577 | Ga0501080_0197423 | 3300049742 | Bacteria | 1848 |
| 578 | Ga0501081_0002262 | 3300049743 | Bacteria | 12114 |
| 579 | Ga0501081_0022073 | 3300049743 | Bacteria | 4256 |
| 580 | Ga0501081_0026929 | 3300049743 | Bacteria | 3879 |
| 581 | Ga0501081_0062481 | 3300049743 | Bacteria | 2583 |
| 582 | Ga0501081_0099433 | 3300049743 | Bacteria | 2055 |
| 583 | Ga0501081_0186418 | 3300049743 | Unclassified | 1501 |
| 584 | Ga0501083_0018068 | 3300049744 | Bacteria | 4915 |
| 585 | Ga0501083_0026446 | 3300049744 | Bacteria | 4010 |
| 586 | Ga0501083_0129353 | 3300049744 | Bacteria | 1655 |
| 587 | Ga0501035_0017870 | 3300049822 | Bacteria | 6541 |
| 588 | Ga0501035_0018426 | 3300049822 | Bacteria | 6433 |
| 589 | Ga0501044_0006469 | 3300049823 | Bacteria | 12941 |
| 590 | Ga0501044_0008738 | 3300049823 | Bacteria | 11086 |
| 591 | Ga0501044_0012452 | 3300049823 | Bacteria | 9211 |
| 592 | Ga0501044_0012562 | 3300049823 | Bacteria | 9172 |
| 593 | Ga0501045_0007414 | 3300049824 | Bacteria | 7624 |
| 594 | Ga0501045_0009378 | 3300049824 | Bacteria | 6843 |
| 595 | Ga0501045_0015997 | 3300049824 | Bacteria | 5321 |
| 596 | Ga0501045_0016504 | 3300049824 | Bacteria | 5247 |
| 597 | nmdc:mga00v17_110226_c1 | 3300050491 | Bacteria | 1746 |
| 598 | nmdc:mga00v17_19761_c1 | 3300050491 | Bacteria | 3851 |
| 599 | nmdc:mga0yw44_109745_c1 | 3300050492 | Bacteria | 1767 |
| 600 | nmdc:mga0k408_1720_c1 | 3300050493 | Bacteria | 11742 |
| 601 | nmdc:mga06z11_2791_c1 | 3300050494 | Bacteria | 6692 |
| 602 | nmdc:mga06z11_4578_c1 | 3300050494 | Bacteria | 5454 |
| 603 | nmdc:mga07m45_14244_c1 | 3300050496 | Bacteria | 4232 |
| 604 | nmdc:mga05p37_10810_c1 | 3300050507 | Bacteria | 10836 |
| 605 | nmdc:mga05p37_11594_c1 | 3300050507 | Bacteria | 10504 |
| 606 | nmdc:mga05p37_168627_c1 | 3300050507 | Bacteria | 2671 |
| 607 | nmdc:mga05p37_25261_c1 | 3300050507 | Bacteria | 7225 |
| 608 | nmdc:mga05p37_26005_c1 | 3300050507 | Bacteria | 7116 |
| 609 | nmdc:mga05p37_3259_c1 | 3300050507 | Bacteria | 18905 |
| 610 | nmdc:mga05p37_3329_c1 | 3300050507 | Bacteria | 18756 |
| 611 | nmdc:mga05p37_42381_c1 | 3300050507 | Bacteria | 5592 |
| 612 | nmdc:mga05p37_4435_c1 | 3300050507 | Bacteria | 16400 |
| 613 | nmdc:mga05p37_53213_c1 | 3300050507 | Unclassified | 4978 |
| 614 | nmdc:mga05p37_53_c1 | 3300050507 | Bacteria | 102685 |
| 615 | nmdc:mga05p37_67575_c1 | 3300050507 | Bacteria | 4397 |
| 616 | nmdc:mga05p37_8845_c1 | 3300050507 | Bacteria | 11897 |
| 617 | nmdc:mga09592_2041_c1 | 3300050508 | Bacteria | 16282 |
| 618 | nmdc:mga09592_29716_c1 | 3300050508 | Bacteria | 4544 |
| 619 | nmdc:mga09592_49840_c1 | 3300050508 | Bacteria | 3531 |
| 620 | nmdc:mga09592_61661_c1 | 3300050508 | Bacteria | 3172 |
| 621 | nmdc:mga0qj67_2885_c1 | 3300050509 | Bacteria | 12341 |
| 622 | nmdc:mga0qj67_7285_c1 | 3300050509 | Bacteria | 8175 |
| 623 | nmdc:mga06r32_21282_c1 | 3300050510 | Bacteria | 5986 |
| 624 | nmdc:mga06r32_4790_c1 | 3300050510 | Bacteria | 12175 |
| 625 | nmdc:mga08y16_1010_c1 | 3300050511 | Bacteria | 27520 |
| 626 | nmdc:mga08y16_12198_c1 | 3300050511 | Bacteria | 9034 |
| 627 | nmdc:mga08y16_19487_c1 | 3300050511 | Bacteria | 7152 |
| 628 | nmdc:mga08y16_36347_c1 | 3300050511 | Bacteria | 5173 |
| 629 | nmdc:mga08y16_45778_c1 | 3300050511 | Bacteria | 4583 |
| 630 | nmdc:mga08y16_4948_c1 | 3300050511 | Bacteria | 13920 |
| 631 | nmdc:mga08y16_8502_c1 | 3300050511 | Bacteria | 10749 |
| 632 | nmdc:mga08y16_9_c1 | 3300050511 | Bacteria | 566088 |
| 633 | nmdc:mga0n895_21730_c1 | 3300050512 | Bacteria | 6006 |
| 634 | nmdc:mga0n895_30696_c1 | 3300050512 | Bacteria | 5139 |
| 635 | nmdc:mga0n895_35_c1 | 3300050512 | Bacteria | 79696 |
| 636 | nmdc:mga0rr50_1059_c1 | 3300050513 | Bacteria | 14964 |
| 637 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 638 | nmdc:mga0rr50_3418_c1 | 3300050513 | Bacteria | 9132 |
| 639 | nmdc:mga08x19_41407_c1 | 3300050514 | Unclassified | 2934 |
| 640 | nmdc:mga08x19_4860_c1 | 3300050514 | Bacteria | 7946 |
| 641 | nmdc:mga0a205_121303_c1 | 3300050515 | Bacteria | 2513 |
| 642 | nmdc:mga0a205_12944_c1 | 3300050515 | Bacteria | 7741 |
| 643 | nmdc:mga0a205_17656_c1 | 3300050515 | Bacteria | 6697 |
| 644 | nmdc:mga0a205_23179_c1 | 3300050515 | Bacteria | 5887 |
| 645 | nmdc:mga0a205_7702_c1 | 3300050515 | Bacteria | 7328 |
| 646 | Ga0495601_0022543 | 3300053077 | Bacteria | 3866 |
| 647 | Ga0495619_0053013 | 3300053085 | Bacteria | 2682 |
| 648 | Ga0495619_0148837 | 3300053085 | Bacteria | 1614 |
| 649 | Ga0501084_0006062 | 3300054114 | Bacteria | 9945 |
| 650 | Ga0501084_0011332 | 3300054114 | Bacteria | 7384 |
| 651 | Ga0501084_0046925 | 3300054114 | Bacteria | 3618 |
| 652 | Ga0501084_0165167 | 3300054114 | Bacteria | 1868 |
| 653 | Ga0501084_0165664 | 3300054114 | Bacteria | 1865 |
| 654 | Ga0590071_000118 | 3300059421 | Bacteria | 22283 |
| 655 | Ga0590074_000298 | 3300059423 | Bacteria | 6779 |
| 656 | Ga0590075_000125 | 3300059424 | Bacteria | 19823 |
| 657 | Ga0590077_000080 | 3300059426 | Bacteria | 24623 |
| 658 | Ga0501082_0008037 | 3300060353 | Bacteria | 9106 |
| 659 | Ga0501082_0021986 | 3300060353 | Bacteria | 5499 |
| 660 | Ga0501082_0023210 | 3300060353 | Bacteria | 5351 |
| 661 | Ga0501082_0048993 | 3300060353 | Bacteria | 3642 |
| 662 | Ga0501082_0056889 | 3300060353 | Bacteria | 3369 |
| 663 | Ga0501082_0063505 | 3300060353 | Bacteria | 3180 |
| 664 | Ga0530510_0002245 | 3300061734 | Bacteria | 13247 |
| 665 | Ga0530510_0024129 | 3300061734 | Bacteria | 4338 |
| 666 | Ga0530510_0047198 | 3300061734 | Bacteria | 3112 |
| 667 | Ga0530510_0113008 | 3300061734 | Bacteria | 1990 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025914 | Ga0207671_10320056 | Ga0207671_103200562 | 328 |
| 2 | 3300047471 | Ga0495684_0253525 | Ga0495684_0253525_110_1237 | 328 |
| 3 | 3300026118 | Ga0207675_100138244 | Ga0207675_1001382442 | 351 |
| 4 | 3300009098 | Ga0105245_10261961 | Ga0105245_102619611 | 373 |
| 5 | 3300035092 | Ga0373952_0002000 | Ga0373952_0002000_21_1238 | 377 |
| 6 | 3300005458 | Ga0070681_10020649 | Ga0070681_100206494 | 384 |
| 7 | 3300025912 | Ga0207707_10024587 | Ga0207707_100245873 | 384 |
| 8 | 3300025932 | Ga0207690_10101915 | Ga0207690_101019152 | 384 |
| 9 | 3300005366 | Ga0070659_100043785 | Ga0070659_1000437852 | 386 |
| 10 | 3300005937 | Ga0081455_10017270 | Ga0081455_100172704 | 387 |
| 11 | 3300025921 | Ga0207652_10018502 | Ga0207652_100185023 | 392 |
| 12 | 3300049571 | Ga0501034_0132882 | Ga0501034_0132882_34_1308 | 392 |
| 13 | 3300005330 | Ga0070690_100051254 | Ga0070690_1000512543 | 393 |
| 14 | 3300005340 | Ga0070689_100004045 | Ga0070689_1000040455 | 393 |
| 15 | 3300005355 | Ga0070671_100024333 | Ga0070671_1000243334 | 393 |
| 16 | 3300005438 | Ga0070701_10028064 | Ga0070701_100280643 | 393 |
| 17 | 3300005543 | Ga0070672_100004683 | Ga0070672_1000046836 | 393 |
| 18 | 3300005578 | Ga0068854_100087739 | Ga0068854_1000877393 | 393 |
| 19 | 3300005843 | Ga0068860_100025269 | Ga0068860_1000252692 | 393 |
| 20 | 3300007076 | Ga0075435_100002619 | Ga0075435_1000026198 | 393 |
| 21 | 3300009176 | Ga0105242_10017911 | Ga0105242_100179112 | 393 |
| 22 | 3300013297 | Ga0157378_10030313 | Ga0157378_100303132 | 393 |
| 23 | 3300025904 | Ga0207647_10059036 | Ga0207647_100590361 | 393 |
| 24 | 3300025907 | Ga0207645_10003141 | Ga0207645_100031413 | 393 |
| 25 | 3300025931 | Ga0207644_10024422 | Ga0207644_100244224 | 393 |
| 26 | 3300025933 | Ga0207706_10037640 | Ga0207706_100376404 | 393 |
| 27 | 3300025934 | Ga0207686_10071733 | Ga0207686_100717332 | 393 |
| 28 | 3300025940 | Ga0207691_10002022 | Ga0207691_1000202213 | 393 |
| 29 | 3300025960 | Ga0207651_10025134 | Ga0207651_100251341 | 393 |
| 30 | 3300025961 | Ga0207712_10089853 | Ga0207712_100898532 | 393 |
| 31 | 3300026089 | Ga0207648_10005077 | Ga0207648_100050779 | 393 |
| 32 | 3300035207 | Ga0373942_0011074 | Ga0373942_0011074_149_1420 | 393 |
| 33 | 3300005295 | Ga0065707_10001377 | Ga0065707_100013775 | 394 |
| 34 | 3300005545 | Ga0070695_100037685 | Ga0070695_1000376852 | 394 |
| 35 | 3300005547 | Ga0070693_100021115 | Ga0070693_1000211153 | 394 |
| 36 | 3300005617 | Ga0068859_100146147 | Ga0068859_1001461472 | 394 |
| 37 | 3300005718 | Ga0068866_10037558 | Ga0068866_100375582 | 394 |
| 38 | 3300005842 | Ga0068858_100228784 | Ga0068858_1002287842 | 394 |
| 39 | 3300006931 | Ga0097620_100146147 | Ga0097620_1001461472 | 394 |
| 40 | 3300009174 | Ga0105241_10057507 | Ga0105241_100575073 | 394 |
| 41 | 3300025893 | Ga0207682_10030495 | Ga0207682_100304952 | 394 |
| 42 | 3300025923 | Ga0207681_10080522 | Ga0207681_100805222 | 394 |
| 43 | 3300026075 | Ga0207708_10042030 | Ga0207708_100420303 | 394 |
| 44 | 3300026118 | Ga0207675_100024641 | Ga0207675_1000246414 | 394 |
| 45 | 3300005536 | Ga0070697_100022134 | Ga0070697_1000221344 | 395 |
| 46 | 3300006914 | Ga0075436_100042574 | Ga0075436_1000425742 | 395 |
| 47 | 3300013306 | Ga0163162_10265269 | Ga0163162_102652691 | 395 |
| 48 | 3300027907 | Ga0207428_10025669 | Ga0207428_100256692 | 395 |
| 49 | 3300045051 | Ga0451576_0066935 | Ga0451576_0066935_952_2250 | 395 |
| 50 | 3300046516 | Ga0495628_0053130 | Ga0495628_0053130_567_2000 | 395 |
| 51 | 3300005335 | Ga0070666_10176202 | Ga0070666_101762022 | 396 |
| 52 | 3300005353 | Ga0070669_100188684 | Ga0070669_1001886842 | 396 |
| 53 | 3300005356 | Ga0070674_100021777 | Ga0070674_1000217773 | 396 |
| 54 | 3300005364 | Ga0070673_100005813 | Ga0070673_1000058133 | 396 |
| 55 | 3300014326 | Ga0157380_10037082 | Ga0157380_100370822 | 396 |
| 56 | 3300025901 | Ga0207688_10024502 | Ga0207688_100245022 | 396 |
| 57 | 3300025903 | Ga0207680_10057438 | Ga0207680_100574382 | 396 |
| 58 | 3300025960 | Ga0207651_10011390 | Ga0207651_100113904 | 396 |
| 59 | 3300026023 | Ga0207677_10056134 | Ga0207677_100561342 | 396 |
| 60 | 3300026035 | Ga0207703_10286660 | Ga0207703_102866601 | 396 |
| 61 | 3300042876 | Ga0451577_0026012 | Ga0451577_0026012_825_2111 | 396 |
| 62 | 3300048905 | Ga0496102_0020187 | Ga0496102_0020187_4470_5762 | 396 |
| 63 | 3300048906 | Ga0496103_0048379 | Ga0496103_0048379_252_1544 | 396 |
| 64 | 3300048911 | Ga0496108_0082563 | Ga0496108_0082563_153_1445 | 396 |
| 65 | 3300048912 | Ga0496109_0178448 | Ga0496109_0178448_191_1483 | 396 |
| 66 | 3300048915 | Ga0496112_0013877 | Ga0496112_0013877_3610_4902 | 396 |
| 67 | 3300048916 | Ga0496113_0048883 | Ga0496113_0048883_1139_2431 | 396 |
| 68 | 3300049576 | Ga0501040_0004359 | Ga0501040_0004359_28_1329 | 396 |
| 69 | 3300049580 | Ga0501046_0019178 | Ga0501046_0019178_2352_3653 | 396 |
| 70 | 3300049581 | Ga0501047_0056527 | Ga0501047_0056527_858_2162 | 396 |
| 71 | 3300049587 | Ga0501071_0021206 | Ga0501071_0021206_1432_2733 | 396 |
| 72 | 3300049588 | Ga0501072_0024218 | Ga0501072_0024218_1594_2895 | 396 |
| 73 | 3300049591 | Ga0501075_0022260 | Ga0501075_0022260_3301_4602 | 396 |
| 74 | 3300049593 | Ga0501077_0041518 | Ga0501077_0041518_532_1833 | 396 |
| 75 | 3300049741 | Ga0501079_0156979 | Ga0501079_0156979_49_1350 | 396 |
| 76 | 3300049743 | Ga0501081_0022073 | Ga0501081_0022073_1751_3052 | 396 |
| 77 | 3300049824 | Ga0501045_0007414 | Ga0501045_0007414_6269_7570 | 396 |
| 78 | 3300061734 | Ga0530510_0002245 | Ga0530510_0002245_3318_4619 | 396 |
| 79 | 3300005328 | Ga0070676_10015175 | Ga0070676_100151753 | 397 |
| 80 | 3300005331 | Ga0070670_100006560 | Ga0070670_1000065603 | 397 |
| 81 | 3300005341 | Ga0070691_10002086 | Ga0070691_100020862 | 397 |
| 82 | 3300005353 | Ga0070669_100015230 | Ga0070669_1000152301 | 397 |
| 83 | 3300005438 | Ga0070701_10000954 | Ga0070701_1000095411 | 397 |
| 84 | 3300005440 | Ga0070705_100054740 | Ga0070705_1000547402 | 397 |
| 85 | 3300005444 | Ga0070694_100091885 | Ga0070694_1000918852 | 397 |
| 86 | 3300005459 | Ga0068867_100003453 | Ga0068867_1000034534 | 397 |
| 87 | 3300005545 | Ga0070695_100004151 | Ga0070695_1000041518 | 397 |
| 88 | 3300005546 | Ga0070696_100006167 | Ga0070696_1000061677 | 397 |
| 89 | 3300005549 | Ga0070704_100004365 | Ga0070704_1000043656 | 397 |
| 90 | 3300005564 | Ga0070664_100097895 | Ga0070664_1000978952 | 397 |
| 91 | 3300005615 | Ga0070702_100021477 | Ga0070702_1000214773 | 397 |
| 92 | 3300005719 | Ga0068861_100000413 | Ga0068861_10000041311 | 397 |
| 93 | 3300005842 | Ga0068858_100177072 | Ga0068858_1001770722 | 397 |
| 94 | 3300009147 | Ga0114129_10006811 | Ga0114129_1000681113 | 397 |
| 95 | 3300009147 | Ga0114129_10009633 | Ga0114129_100096337 | 397 |
| 96 | 3300009148 | Ga0105243_10006372 | Ga0105243_1000637210 | 397 |
| 97 | 3300025907 | Ga0207645_10003173 | Ga0207645_1000317311 | 397 |
| 98 | 3300025923 | Ga0207681_10071419 | Ga0207681_100714192 | 397 |
| 99 | 3300025925 | Ga0207650_10009788 | Ga0207650_100097885 | 397 |
| 100 | 3300025935 | Ga0207709_10069011 | Ga0207709_100690111 | 397 |
| 101 | 3300026089 | Ga0207648_10009859 | Ga0207648_100098595 | 397 |
| 102 | 3300026116 | Ga0207674_10034107 | Ga0207674_100341074 | 397 |
| 103 | 3300026118 | Ga0207675_100000511 | Ga0207675_10000051119 | 397 |
| 104 | 3300035725 | Ga0373947_0024525 | Ga0373947_0024525_959_2236 | 397 |
| 105 | 3300049568 | Ga0501031_0101901 | Ga0501031_0101901_192_1595 | 397 |
| 106 | 3300049570 | Ga0501033_0029228 | Ga0501033_0029228_237_1640 | 397 |
| 107 | 3300049571 | Ga0501034_0027751 | Ga0501034_0027751_2957_4351 | 397 |
| 108 | 3300049571 | Ga0501034_0105193 | Ga0501034_0105193_203_1606 | 397 |
| 109 | 3300049572 | Ga0501036_0060686 | Ga0501036_0060686_1756_3150 | 397 |
| 110 | 3300049573 | Ga0501037_0048744 | Ga0501037_0048744_439_1842 | 397 |
| 111 | 3300049574 | Ga0501038_0104071 | Ga0501038_0104071_873_2267 | 397 |
| 112 | 3300049575 | Ga0501039_0013896 | Ga0501039_0013896_776_2170 | 397 |
| 113 | 3300049579 | Ga0501043_0004130 | Ga0501043_0004130_3805_5208 | 397 |
| 114 | 3300049580 | Ga0501046_0111290 | Ga0501046_0111290_633_2036 | 397 |
| 115 | 3300049581 | Ga0501047_0039199 | Ga0501047_0039199_2882_4285 | 397 |
| 116 | 3300049582 | Ga0501048_0073412 | Ga0501048_0073412_170_1573 | 397 |
| 117 | 3300049588 | Ga0501072_0010573 | Ga0501072_0010573_850_2244 | 397 |
| 118 | 3300049589 | Ga0501073_0029037 | Ga0501073_0029037_161_1564 | 397 |
| 119 | 3300049742 | Ga0501080_0002482 | Ga0501080_0002482_6489_7883 | 397 |
| 120 | 3300049744 | Ga0501083_0026446 | Ga0501083_0026446_1454_2848 | 397 |
| 121 | 3300049823 | Ga0501044_0012452 | Ga0501044_0012452_6476_7870 | 397 |
| 122 | 3300050507 | nmdc:mga05p37_4435_c1 | nmdc:mga05p37_4435_c1_11974_13278 | 397 |
| 123 | 3300054114 | Ga0501084_0011332 | Ga0501084_0011332_5149_6552 | 397 |
| 124 | 3300054114 | Ga0501084_0165167 | Ga0501084_0165167_16_1410 | 397 |
| 125 | 3300060353 | Ga0501082_0048993 | Ga0501082_0048993_829_2223 | 397 |
| 126 | 3300006852 | Ga0075433_10022893 | Ga0075433_100228933 | 398 |
| 127 | 3300009147 | Ga0114129_10004232 | Ga0114129_100042323 | 398 |
| 128 | 3300036401 | Ga0373937_0103299 | Ga0373937_0103299_1031_2371 | 398 |
| 129 | 3300042008 | Ga0439450_001038 | Ga0439450_001038_283_1578 | 398 |
| 130 | 3300042439 | Ga0439464_0000358 | Ga0439464_0000358_1887_3182 | 398 |
| 131 | 3300044712 | Ga0453684_0017361 | Ga0453684_0017361_944_2230 | 398 |
| 132 | 3300050507 | nmdc:mga05p37_10810_c1 | nmdc:mga05p37_10810_c1_3451_4746 | 398 |
| 133 | 3300050515 | nmdc:mga0a205_12944_c1 | nmdc:mga0a205_12944_c1_2591_3886 | 398 |
| 134 | 3300006844 | Ga0075428_100004161 | Ga0075428_1000041619 | 399 |
| 135 | 3300006847 | Ga0075431_100079221 | Ga0075431_1000792212 | 399 |
| 136 | 3300009147 | Ga0114129_10001979 | Ga0114129_100019799 | 399 |
| 137 | 3300035113 | Ga0373936_0046050 | Ga0373936_0046050_181_1500 | 399 |
| 138 | 3300035170 | Ga0373943_0011113 | Ga0373943_0011113_1182_2501 | 399 |
| 139 | 3300035171 | Ga0373946_0005220 | Ga0373946_0005220_2339_3658 | 399 |
| 140 | 3300035692 | Ga0373935_0021161 | Ga0373935_0021161_845_2164 | 399 |
| 141 | 3300035725 | Ga0373947_0037563 | Ga0373947_0037563_1201_2520 | 399 |
| 142 | 3300037068 | Ga0373925_0104487 | Ga0373925_0104487_845_2164 | 399 |
| 143 | 3300049576 | Ga0501040_0148663 | Ga0501040_0148663_24_1340 | 399 |
| 144 | 3300049577 | Ga0501041_0031740 | Ga0501041_0031740_1597_2913 | 399 |
| 145 | 3300049587 | Ga0501071_0027320 | Ga0501071_0027320_2413_3729 | 399 |
| 146 | 3300049588 | Ga0501072_0043479 | Ga0501072_0043479_2048_3364 | 399 |
| 147 | 3300049591 | Ga0501075_0004412 | Ga0501075_0004412_4297_5613 | 399 |
| 148 | 3300049592 | Ga0501076_0008340 | Ga0501076_0008340_650_1966 | 399 |
| 149 | 3300049743 | Ga0501081_0099433 | Ga0501081_0099433_322_1638 | 399 |
| 150 | 3300050508 | nmdc:mga09592_61661_c1 | nmdc:mga09592_61661_c1_813_2060 | 399 |
| 151 | 3300005354 | Ga0070675_100001360 | Ga0070675_1000013605 | 400 |
| 152 | 3300005530 | Ga0070679_100100370 | Ga0070679_1001003702 | 400 |
| 153 | 3300006237 | Ga0097621_100001586 | Ga0097621_1000015864 | 400 |
| 154 | 3300006358 | Ga0068871_100001365 | Ga0068871_10000136510 | 400 |
| 155 | 3300009147 | Ga0114129_10029670 | Ga0114129_100296706 | 400 |
| 156 | 3300014968 | Ga0157379_10139997 | Ga0157379_101399971 | 400 |
| 157 | 3300025912 | Ga0207707_10021944 | Ga0207707_100219444 | 400 |
| 158 | 3300025949 | Ga0207667_10306731 | Ga0207667_103067312 | 400 |
| 159 | 3300046684 | Ga0495669_0000451 | Ga0495669_0000451_9508_10821 | 400 |
| 160 | 3300050507 | nmdc:mga05p37_3259_c1 | nmdc:mga05p37_3259_c1_4697_6028 | 400 |
| 161 | 3300005290 | Ga0065712_10117712 | Ga0065712_101177122 | 401 |
| 162 | 3300005295 | Ga0065707_10117683 | Ga0065707_101176832 | 401 |
| 163 | 3300005330 | Ga0070690_100057147 | Ga0070690_1000571472 | 401 |
| 164 | 3300005335 | Ga0070666_10039811 | Ga0070666_100398112 | 401 |
| 165 | 3300005338 | Ga0068868_100055744 | Ga0068868_1000557442 | 401 |
| 166 | 3300005343 | Ga0070687_100021027 | Ga0070687_1000210272 | 401 |
| 167 | 3300005347 | Ga0070668_100039083 | Ga0070668_1000390832 | 401 |
| 168 | 3300005353 | Ga0070669_100049939 | Ga0070669_1000499393 | 401 |
| 169 | 3300005354 | Ga0070675_100068176 | Ga0070675_1000681762 | 401 |
| 170 | 3300005468 | Ga0070707_100066645 | Ga0070707_1000666452 | 401 |
| 171 | 3300005471 | Ga0070698_100218919 | Ga0070698_1002189191 | 401 |
| 172 | 3300005544 | Ga0070686_100000398 | Ga0070686_1000003982 | 401 |
| 173 | 3300005578 | Ga0068854_100004892 | Ga0068854_1000048925 | 401 |
| 174 | 3300005841 | Ga0068863_100004381 | Ga0068863_1000043814 | 401 |
| 175 | 3300005843 | Ga0068860_100116559 | Ga0068860_1001165592 | 401 |
| 176 | 3300005844 | Ga0068862_100121508 | Ga0068862_1001215082 | 401 |
| 177 | 3300006051 | Ga0075364_10003347 | Ga0075364_100033475 | 401 |
| 178 | 3300006051 | Ga0075364_10004372 | Ga0075364_100043727 | 401 |
| 179 | 3300006177 | Ga0075362_10000228 | Ga0075362_100002289 | 401 |
| 180 | 3300006178 | Ga0075367_10005874 | Ga0075367_100058749 | 401 |
| 181 | 3300006178 | Ga0075367_10015401 | Ga0075367_100154013 | 401 |
| 182 | 3300006195 | Ga0075366_10003831 | Ga0075366_100038312 | 401 |
| 183 | 3300006353 | Ga0075370_10005896 | Ga0075370_100058964 | 401 |
| 184 | 3300006844 | Ga0075428_100003031 | Ga0075428_1000030319 | 401 |
| 185 | 3300006844 | Ga0075428_100019276 | Ga0075428_1000192762 | 401 |
| 186 | 3300006846 | Ga0075430_100003478 | Ga0075430_1000034782 | 401 |
| 187 | 3300006847 | Ga0075431_100010127 | Ga0075431_1000101276 | 401 |
| 188 | 3300006847 | Ga0075431_100022064 | Ga0075431_1000220642 | 401 |
| 189 | 3300006847 | Ga0075431_100030339 | Ga0075431_1000303394 | 401 |
| 190 | 3300006871 | Ga0075434_100196110 | Ga0075434_1001961102 | 401 |
| 191 | 3300006880 | Ga0075429_100000822 | Ga0075429_1000008226 | 401 |
| 192 | 3300006880 | Ga0075429_100117818 | Ga0075429_1001178182 | 401 |
| 193 | 3300009093 | Ga0105240_10023069 | Ga0105240_100230696 | 401 |
| 194 | 3300009094 | Ga0111539_10002441 | Ga0111539_1000244112 | 401 |
| 195 | 3300009094 | Ga0111539_10172107 | Ga0111539_101721073 | 401 |
| 196 | 3300009147 | Ga0114129_10001494 | Ga0114129_1000149415 | 401 |
| 197 | 3300009147 | Ga0114129_10078021 | Ga0114129_100780212 | 401 |
| 198 | 3300009147 | Ga0114129_10198136 | Ga0114129_101981362 | 401 |
| 199 | 3300009174 | Ga0105241_10191700 | Ga0105241_101917002 | 401 |
| 200 | 3300009177 | Ga0105248_10051860 | Ga0105248_100518603 | 401 |
| 201 | 3300009553 | Ga0105249_10389112 | Ga0105249_103891121 | 401 |
| 202 | 3300014325 | Ga0163163_10269454 | Ga0163163_102694541 | 401 |
| 203 | 3300014326 | Ga0157380_10081302 | Ga0157380_100813022 | 401 |
| 204 | 3300014969 | Ga0157376_10106949 | Ga0157376_101069492 | 401 |
| 205 | 3300025315 | Ga0207697_10000393 | Ga0207697_1000039314 | 401 |
| 206 | 3300025918 | Ga0207662_10077793 | Ga0207662_100777932 | 401 |
| 207 | 3300025926 | Ga0207659_10074984 | Ga0207659_100749841 | 401 |
| 208 | 3300025928 | Ga0207700_10020049 | Ga0207700_100200493 | 401 |
| 209 | 3300025941 | Ga0207711_10043255 | Ga0207711_100432552 | 401 |
| 210 | 3300025981 | Ga0207640_10011564 | Ga0207640_100115643 | 401 |
| 211 | 3300026023 | Ga0207677_10050250 | Ga0207677_100502502 | 401 |
| 212 | 3300026067 | Ga0207678_10050742 | Ga0207678_100507422 | 401 |
| 213 | 3300026088 | Ga0207641_10002396 | Ga0207641_100023964 | 401 |
| 214 | 3300026118 | Ga0207675_100080110 | Ga0207675_1000801103 | 401 |
| 215 | 3300027907 | Ga0207428_10001623 | Ga0207428_1000162314 | 401 |
| 216 | 3300028381 | Ga0268264_10219425 | Ga0268264_102194252 | 401 |
| 217 | 3300031548 | Ga0307408_100003522 | Ga0307408_1000035224 | 401 |
| 218 | 3300031548 | Ga0307408_100042020 | Ga0307408_1000420202 | 401 |
| 219 | 3300031548 | Ga0307408_100074645 | Ga0307408_1000746452 | 401 |
| 220 | 3300031731 | Ga0307405_10088012 | Ga0307405_100880121 | 401 |
| 221 | 3300031901 | Ga0307406_10030987 | Ga0307406_100309871 | 401 |
| 222 | 3300031911 | Ga0307412_10089321 | Ga0307412_100893212 | 401 |
| 223 | 3300032002 | Ga0307416_100004129 | Ga0307416_1000041291 | 401 |
| 224 | 3300032002 | Ga0307416_100025043 | Ga0307416_1000250433 | 401 |
| 225 | 3300032005 | Ga0307411_10016203 | Ga0307411_100162032 | 401 |
| 226 | 3300032005 | Ga0307411_10116247 | Ga0307411_101162472 | 401 |
| 227 | 3300035084 | Ga0373928_0000525 | Ga0373928_0000525_601_1890 | 401 |
| 228 | 3300035085 | Ga0373929_0004174 | Ga0373929_0004174_44_1333 | 401 |
| 229 | 3300035088 | Ga0373940_0000040 | Ga0373940_0000040_5681_6970 | 401 |
| 230 | 3300035091 | Ga0373951_0001092 | Ga0373951_0001092_5353_6642 | 401 |
| 231 | 3300035112 | Ga0373932_0000338 | Ga0373932_0000338_9344_10633 | 401 |
| 232 | 3300035114 | Ga0373939_0000129 | Ga0373939_0000129_612_1901 | 401 |
| 233 | 3300035114 | Ga0373939_0008652 | Ga0373939_0008652_831_2135 | 401 |
| 234 | 3300035121 | Ga0373960_0000070 | Ga0373960_0000070_2414_3703 | 401 |
| 235 | 3300035207 | Ga0373942_0000050 | Ga0373942_0000050_3781_5070 | 401 |
| 236 | 3300035241 | Ga0373961_0000288 | Ga0373961_0000288_2853_4142 | 401 |
| 237 | 3300035242 | Ga0373962_0000753 | Ga0373962_0000753_4192_5481 | 401 |
| 238 | 3300035724 | Ga0373933_0013664 | Ga0373933_0013664_791_2146 | 401 |
| 239 | 3300041999 | Ga0439433_0012485 | Ga0439433_0012485_311_1561 | 401 |
| 240 | 3300042156 | Ga0439446_0005323 | Ga0439446_0005323_1606_2856 | 401 |
| 241 | 3300042435 | Ga0439434_0029164 | Ga0439434_0029164_263_1513 | 401 |
| 242 | 3300042436 | Ga0439435_0030656 | Ga0439435_0030656_102_1400 | 401 |
| 243 | 3300045051 | Ga0451576_0029209 | Ga0451576_0029209_3811_5100 | 401 |
| 244 | 3300048905 | Ga0496102_0088111 | Ga0496102_0088111_101_1390 | 401 |
| 245 | 3300048909 | Ga0496106_0066413 | Ga0496106_0066413_1318_2607 | 401 |
| 246 | 3300049569 | Ga0501032_0010633 | Ga0501032_0010633_1742_3184 | 401 |
| 247 | 3300049570 | Ga0501033_0006968 | Ga0501033_0006968_1287_2729 | 401 |
| 248 | 3300049571 | Ga0501034_0042744 | Ga0501034_0042744_551_1993 | 401 |
| 249 | 3300049572 | Ga0501036_0014950 | Ga0501036_0014950_1313_2755 | 401 |
| 250 | 3300049574 | Ga0501038_0057631 | Ga0501038_0057631_91_1533 | 401 |
| 251 | 3300049575 | Ga0501039_0085672 | Ga0501039_0085672_591_2033 | 401 |
| 252 | 3300049579 | Ga0501043_0003533 | Ga0501043_0003533_5586_7028 | 401 |
| 253 | 3300049580 | Ga0501046_0008447 | Ga0501046_0008447_2723_4165 | 401 |
| 254 | 3300049581 | Ga0501047_0052128 | Ga0501047_0052128_643_1950 | 401 |
| 255 | 3300049581 | Ga0501047_0171434 | Ga0501047_0171434_386_1828 | 401 |
| 256 | 3300049582 | Ga0501048_0006989 | Ga0501048_0006989_5820_7262 | 401 |
| 257 | 3300049584 | Ga0501068_0030745 | Ga0501068_0030745_106_1548 | 401 |
| 258 | 3300049586 | Ga0501070_0014530 | Ga0501070_0014530_3712_5154 | 401 |
| 259 | 3300049588 | Ga0501072_0084761 | Ga0501072_0084761_206_1612 | 401 |
| 260 | 3300049589 | Ga0501073_0009602 | Ga0501073_0009602_3191_4633 | 401 |
| 261 | 3300049592 | Ga0501076_0042439 | Ga0501076_0042439_2120_3526 | 401 |
| 262 | 3300049742 | Ga0501080_0039499 | Ga0501080_0039499_2262_3704 | 401 |
| 263 | 3300049742 | Ga0501080_0197423 | Ga0501080_0197423_451_1752 | 401 |
| 264 | 3300049743 | Ga0501081_0026929 | Ga0501081_0026929_241_1647 | 401 |
| 265 | 3300049744 | Ga0501083_0129353 | Ga0501083_0129353_170_1471 | 401 |
| 266 | 3300049823 | Ga0501044_0006469 | Ga0501044_0006469_9170_10477 | 401 |
| 267 | 3300050491 | nmdc:mga00v17_110226_c1 | nmdc:mga00v17_110226_c1_119_1429 | 401 |
| 268 | 3300050491 | nmdc:mga00v17_19761_c1 | nmdc:mga00v17_19761_c1_1403_2698 | 401 |
| 269 | 3300050493 | nmdc:mga0k408_1720_c1 | nmdc:mga0k408_1720_c1_9899_11185 | 401 |
| 270 | 3300050494 | nmdc:mga06z11_2791_c1 | nmdc:mga06z11_2791_c1_4322_5632 | 401 |
| 271 | 3300050494 | nmdc:mga06z11_4578_c1 | nmdc:mga06z11_4578_c1_558_1853 | 401 |
| 272 | 3300050496 | nmdc:mga07m45_14244_c1 | nmdc:mga07m45_14244_c1_193_1485 | 401 |
| 273 | 3300050507 | nmdc:mga05p37_11594_c1 | nmdc:mga05p37_11594_c1_3925_5220 | 401 |
| 274 | 3300050507 | nmdc:mga05p37_168627_c1 | nmdc:mga05p37_168627_c1_910_2208 | 401 |
| 275 | 3300050507 | nmdc:mga05p37_25261_c1 | nmdc:mga05p37_25261_c1_405_1709 | 401 |
| 276 | 3300050508 | nmdc:mga09592_2041_c1 | nmdc:mga09592_2041_c1_8615_9910 | 401 |
| 277 | 3300050509 | nmdc:mga0qj67_2885_c1 | nmdc:mga0qj67_2885_c1_6014_7309 | 401 |
| 278 | 3300050509 | nmdc:mga0qj67_7285_c1 | nmdc:mga0qj67_7285_c1_910_2208 | 401 |
| 279 | 3300050510 | nmdc:mga06r32_4790_c1 | nmdc:mga06r32_4790_c1_6631_7926 | 401 |
| 280 | 3300050511 | nmdc:mga08y16_12198_c1 | nmdc:mga08y16_12198_c1_4052_5347 | 401 |
| 281 | 3300059421 | Ga0590071_000118 | Ga0590071_000118_9432_10715 | 401 |
| 282 | 3300059423 | Ga0590074_000298 | Ga0590074_000298_1884_3167 | 401 |
| 283 | 3300059424 | Ga0590075_000125 | Ga0590075_000125_17702_18985 | 401 |
| 284 | 3300059426 | Ga0590077_000080 | Ga0590077_000080_20322_21605 | 401 |
| 285 | 3300060353 | Ga0501082_0056889 | Ga0501082_0056889_147_1589 | 401 |
| 286 | 3300061734 | Ga0530510_0113008 | Ga0530510_0113008_230_1636 | 401 |
| 287 | 3300005334 | Ga0068869_100103708 | Ga0068869_1001037082 | 402 |
| 288 | 3300005365 | Ga0070688_100078098 | Ga0070688_1000780981 | 402 |
| 289 | 3300005445 | Ga0070708_100149137 | Ga0070708_1001491372 | 402 |
| 290 | 3300005843 | Ga0068860_100151713 | Ga0068860_1001517132 | 402 |
| 291 | 3300006038 | Ga0075365_10006494 | Ga0075365_100064946 | 402 |
| 292 | 3300006844 | Ga0075428_100002999 | Ga0075428_1000029998 | 402 |
| 293 | 3300006846 | Ga0075430_100067543 | Ga0075430_1000675432 | 402 |
| 294 | 3300006846 | Ga0075430_100072088 | Ga0075430_1000720882 | 402 |
| 295 | 3300006847 | Ga0075431_100032202 | Ga0075431_1000322023 | 402 |
| 296 | 3300006852 | Ga0075433_10105219 | Ga0075433_101052192 | 402 |
| 297 | 3300006871 | Ga0075434_100029094 | Ga0075434_1000290944 | 402 |
| 298 | 3300006880 | Ga0075429_100002301 | Ga0075429_1000023015 | 402 |
| 299 | 3300006914 | Ga0075436_100006788 | Ga0075436_1000067884 | 402 |
| 300 | 3300013306 | Ga0163162_10007328 | Ga0163162_100073289 | 402 |
| 301 | 3300026095 | Ga0207676_10348754 | Ga0207676_103487541 | 402 |
| 302 | 3300031731 | Ga0307405_10010720 | Ga0307405_100107204 | 402 |
| 303 | 3300031824 | Ga0307413_10162999 | Ga0307413_101629991 | 402 |
| 304 | 3300031852 | Ga0307410_10019796 | Ga0307410_100197962 | 402 |
| 305 | 3300031995 | Ga0307409_100040993 | Ga0307409_1000409931 | 402 |
| 306 | 3300031995 | Ga0307409_100065661 | Ga0307409_1000656612 | 402 |
| 307 | 3300032002 | Ga0307416_100403871 | Ga0307416_1004038711 | 402 |
| 308 | 3300032004 | Ga0307414_10121306 | Ga0307414_101213062 | 402 |
| 309 | 3300032005 | Ga0307411_10010050 | Ga0307411_100100502 | 402 |
| 310 | 3300032005 | Ga0307411_10211915 | Ga0307411_102119151 | 402 |
| 311 | 3300032126 | Ga0307415_100043427 | Ga0307415_1000434272 | 402 |
| 312 | 3300042461 | Ga0439460_0015942 | Ga0439460_0015942_267_1565 | 402 |
| 313 | 3300042876 | Ga0451577_0023812 | Ga0451577_0023812_2122_3384 | 402 |
| 314 | 3300046454 | Ga0495592_0103423 | Ga0495592_0103423_304_1659 | 402 |
| 315 | 3300049592 | Ga0501076_0083065 | Ga0501076_0083065_1011_2264 | 402 |
| 316 | 3300050492 | nmdc:mga0yw44_109745_c1 | nmdc:mga0yw44_109745_c1_128_1402 | 402 |
| 317 | 3300050508 | nmdc:mga09592_49840_c1 | nmdc:mga09592_49840_c1_1795_3093 | 402 |
| 318 | 3300050510 | nmdc:mga06r32_21282_c1 | nmdc:mga06r32_21282_c1_3348_4646 | 402 |
| 319 | 3300050512 | nmdc:mga0n895_30696_c1 | nmdc:mga0n895_30696_c1_315_1604 | 402 |
| 320 | 3300050515 | nmdc:mga0a205_7702_c1 | nmdc:mga0a205_7702_c1_1811_3100 | 402 |
| 321 | 3300061734 | Ga0530510_0024129 | Ga0530510_0024129_330_1583 | 402 |
| 322 | 3300005295 | Ga0065707_10106896 | Ga0065707_101068962 | 403 |
| 323 | 3300005334 | Ga0068869_100061753 | Ga0068869_1000617532 | 403 |
| 324 | 3300005338 | Ga0068868_100144699 | Ga0068868_1001446992 | 403 |
| 325 | 3300005347 | Ga0070668_100133655 | Ga0070668_1001336552 | 403 |
| 326 | 3300005353 | Ga0070669_100000622 | Ga0070669_1000006229 | 403 |
| 327 | 3300005367 | Ga0070667_100033513 | Ga0070667_1000335132 | 403 |
| 328 | 3300005547 | Ga0070693_100006549 | Ga0070693_1000065492 | 403 |
| 329 | 3300005563 | Ga0068855_100297026 | Ga0068855_1002970262 | 403 |
| 330 | 3300005577 | Ga0068857_100094445 | Ga0068857_1000944452 | 403 |
| 331 | 3300005617 | Ga0068859_100023420 | Ga0068859_1000234204 | 403 |
| 332 | 3300005844 | Ga0068862_100092634 | Ga0068862_1000926342 | 403 |
| 333 | 3300006178 | Ga0075367_10006108 | Ga0075367_100061082 | 403 |
| 334 | 3300006237 | Ga0097621_100154988 | Ga0097621_1001549881 | 403 |
| 335 | 3300006844 | Ga0075428_100139456 | Ga0075428_1001394563 | 403 |
| 336 | 3300006880 | Ga0075429_100132721 | Ga0075429_1001327212 | 403 |
| 337 | 3300006931 | Ga0097620_100023420 | Ga0097620_1000234204 | 403 |
| 338 | 3300009094 | Ga0111539_10000341 | Ga0111539_1000034138 | 403 |
| 339 | 3300009094 | Ga0111539_10011360 | Ga0111539_1001136010 | 403 |
| 340 | 3300009147 | Ga0114129_10000162 | Ga0114129_1000016228 | 403 |
| 341 | 3300009177 | Ga0105248_10361829 | Ga0105248_103618292 | 403 |
| 342 | 3300009553 | Ga0105249_10041421 | Ga0105249_100414212 | 403 |
| 343 | 3300014325 | Ga0163163_10000042 | Ga0163163_1000004236 | 403 |
| 344 | 3300025920 | Ga0207649_10102916 | Ga0207649_101029162 | 403 |
| 345 | 3300025923 | Ga0207681_10005978 | Ga0207681_100059786 | 403 |
| 346 | 3300025945 | Ga0207679_10266354 | Ga0207679_102663541 | 403 |
| 347 | 3300026035 | Ga0207703_10084295 | Ga0207703_100842952 | 403 |
| 348 | 3300026116 | Ga0207674_10085973 | Ga0207674_100859732 | 403 |
| 349 | 3300027907 | Ga0207428_10000816 | Ga0207428_100008162 | 403 |
| 350 | 3300027907 | Ga0207428_10000998 | Ga0207428_1000099824 | 403 |
| 351 | 3300028380 | Ga0268265_10070434 | Ga0268265_100704342 | 403 |
| 352 | 3300035086 | Ga0373934_0021084 | Ga0373934_0021084_944_2218 | 403 |
| 353 | 3300035119 | Ga0373956_0001725 | Ga0373956_0001725_2651_3925 | 403 |
| 354 | 3300035724 | Ga0373933_0143171 | Ga0373933_0143171_112_1386 | 403 |
| 355 | 3300036401 | Ga0373937_0000130 | Ga0373937_0000130_3791_5065 | 403 |
| 356 | 3300037068 | Ga0373925_0177187 | Ga0373925_0177187_111_1412 | 403 |
| 357 | 3300042125 | Ga0450923_005080 | Ga0450923_005080_225_1496 | 403 |
| 358 | 3300042132 | Ga0450895_000137 | Ga0450895_000137_763_2034 | 403 |
| 359 | 3300042133 | Ga0450896_001850 | Ga0450896_001850_228_1499 | 403 |
| 360 | 3300042876 | Ga0451577_0032813 | Ga0451577_0032813_1136_2422 | 403 |
| 361 | 3300046462 | Ga0495651_0113611 | Ga0495651_0113611_337_1611 | 403 |
| 362 | 3300046536 | Ga0495587_0115732 | Ga0495587_0115732_42_1316 | 403 |
| 363 | 3300046683 | Ga0495658_0096718 | Ga0495658_0096718_144_1445 | 403 |
| 364 | 3300047319 | Ga0495674_0117734 | Ga0495674_0117734_937_2214 | 403 |
| 365 | 3300048915 | Ga0496112_0234368 | Ga0496112_0234368_89_1375 | 403 |
| 366 | 3300049568 | Ga0501031_0002290 | Ga0501031_0002290_5825_7273 | 403 |
| 367 | 3300049569 | Ga0501032_0003907 | Ga0501032_0003907_5104_6552 | 403 |
| 368 | 3300049570 | Ga0501033_0006400 | Ga0501033_0006400_4494_5942 | 403 |
| 369 | 3300049570 | Ga0501033_0089438 | Ga0501033_0089438_206_1648 | 403 |
| 370 | 3300049571 | Ga0501034_0107382 | Ga0501034_0107382_252_1694 | 403 |
| 371 | 3300049572 | Ga0501036_0001004 | Ga0501036_0001004_18459_19907 | 403 |
| 372 | 3300049572 | Ga0501036_0146576 | Ga0501036_0146576_473_1861 | 403 |
| 373 | 3300049573 | Ga0501037_0005576 | Ga0501037_0005576_3410_4858 | 403 |
| 374 | 3300049574 | Ga0501038_0009366 | Ga0501038_0009366_4075_5523 | 403 |
| 375 | 3300049575 | Ga0501039_0006831 | Ga0501039_0006831_2853_4301 | 403 |
| 376 | 3300049578 | Ga0501042_0021727 | Ga0501042_0021727_1490_2938 | 403 |
| 377 | 3300049578 | Ga0501042_0117357 | Ga0501042_0117357_453_1841 | 403 |
| 378 | 3300049579 | Ga0501043_0013100 | Ga0501043_0013100_186_1628 | 403 |
| 379 | 3300049580 | Ga0501046_0011996 | Ga0501046_0011996_1059_2507 | 403 |
| 380 | 3300049580 | Ga0501046_0012166 | Ga0501046_0012166_4747_6189 | 403 |
| 381 | 3300049581 | Ga0501047_0027143 | Ga0501047_0027143_274_1722 | 403 |
| 382 | 3300049582 | Ga0501048_0022176 | Ga0501048_0022176_121_1569 | 403 |
| 383 | 3300049582 | Ga0501048_0065165 | Ga0501048_0065165_271_1713 | 403 |
| 384 | 3300049583 | Ga0501067_0002039 | Ga0501067_0002039_3829_5277 | 403 |
| 385 | 3300049583 | Ga0501067_0030261 | Ga0501067_0030261_1159_2601 | 403 |
| 386 | 3300049584 | Ga0501068_0007073 | Ga0501068_0007073_4330_5778 | 403 |
| 387 | 3300049585 | Ga0501069_0000895 | Ga0501069_0000895_5795_7243 | 403 |
| 388 | 3300049587 | Ga0501071_0011092 | Ga0501071_0011092_4454_5902 | 403 |
| 389 | 3300049588 | Ga0501072_0037419 | Ga0501072_0037419_2327_3715 | 403 |
| 390 | 3300049588 | Ga0501072_0095071 | Ga0501072_0095071_153_1436 | 403 |
| 391 | 3300049589 | Ga0501073_0000607 | Ga0501073_0000607_22753_24201 | 403 |
| 392 | 3300049590 | Ga0501074_0007919 | Ga0501074_0007919_1520_2968 | 403 |
| 393 | 3300049591 | Ga0501075_0158146 | Ga0501075_0158146_177_1565 | 403 |
| 394 | 3300049741 | Ga0501079_0008647 | Ga0501079_0008647_5874_7157 | 403 |
| 395 | 3300049741 | Ga0501079_0011149 | Ga0501079_0011149_4067_5515 | 403 |
| 396 | 3300049741 | Ga0501079_0049331 | Ga0501079_0049331_1074_2516 | 403 |
| 397 | 3300049742 | Ga0501080_0072142 | Ga0501080_0072142_1341_2789 | 403 |
| 398 | 3300049742 | Ga0501080_0100981 | Ga0501080_0100981_1275_2558 | 403 |
| 399 | 3300049743 | Ga0501081_0186418 | Ga0501081_0186418_55_1338 | 403 |
| 400 | 3300049744 | Ga0501083_0018068 | Ga0501083_0018068_1221_2663 | 403 |
| 401 | 3300049822 | Ga0501035_0017870 | Ga0501035_0017870_3818_5260 | 403 |
| 402 | 3300049822 | Ga0501035_0018426 | Ga0501035_0018426_1576_3024 | 403 |
| 403 | 3300049823 | Ga0501044_0008738 | Ga0501044_0008738_4075_5523 | 403 |
| 404 | 3300049823 | Ga0501044_0012562 | Ga0501044_0012562_6004_7446 | 403 |
| 405 | 3300049824 | Ga0501045_0009378 | Ga0501045_0009378_1422_2810 | 403 |
| 406 | 3300050507 | nmdc:mga05p37_53_c1 | nmdc:mga05p37_53_c1_67485_68756 | 403 |
| 407 | 3300050508 | nmdc:mga09592_29716_c1 | nmdc:mga09592_29716_c1_943_2214 | 403 |
| 408 | 3300050511 | nmdc:mga08y16_1010_c1 | nmdc:mga08y16_1010_c1_13684_14985 | 403 |
| 409 | 3300050511 | nmdc:mga08y16_19487_c1 | nmdc:mga08y16_19487_c1_1789_3186 | 403 |
| 410 | 3300053085 | Ga0495619_0053013 | Ga0495619_0053013_1224_2528 | 403 |
| 411 | 3300054114 | Ga0501084_0046925 | Ga0501084_0046925_1262_2545 | 403 |
| 412 | 3300060353 | Ga0501082_0008037 | Ga0501082_0008037_4708_6156 | 403 |
| 413 | 3300060353 | Ga0501082_0021986 | Ga0501082_0021986_2984_4426 | 403 |
| 414 | 3300061734 | Ga0530510_0047198 | Ga0530510_0047198_137_1525 | 403 |
| 415 | 3300005290 | Ga0065712_10068848 | Ga0065712_100688484 | 404 |
| 416 | 3300005329 | Ga0070683_100002681 | Ga0070683_1000026811 | 404 |
| 417 | 3300005340 | Ga0070689_100075720 | Ga0070689_1000757202 | 404 |
| 418 | 3300005365 | Ga0070688_100039373 | Ga0070688_1000393732 | 404 |
| 419 | 3300005367 | Ga0070667_100162568 | Ga0070667_1001625682 | 404 |
| 420 | 3300005456 | Ga0070678_100131329 | Ga0070678_1001313292 | 404 |
| 421 | 3300005457 | Ga0070662_100040145 | Ga0070662_1000401453 | 404 |
| 422 | 3300005459 | Ga0068867_100130968 | Ga0068867_1001309682 | 404 |
| 423 | 3300005535 | Ga0070684_100000296 | Ga0070684_1000002964 | 404 |
| 424 | 3300005564 | Ga0070664_100018420 | Ga0070664_1000184205 | 404 |
| 425 | 3300005843 | Ga0068860_100223461 | Ga0068860_1002234612 | 404 |
| 426 | 3300005843 | Ga0068860_100236808 | Ga0068860_1002368082 | 404 |
| 427 | 3300006852 | Ga0075433_10026243 | Ga0075433_100262433 | 404 |
| 428 | 3300006852 | Ga0075433_10030578 | Ga0075433_100305784 | 404 |
| 429 | 3300006871 | Ga0075434_100144130 | Ga0075434_1001441302 | 404 |
| 430 | 3300009094 | Ga0111539_10032816 | Ga0111539_100328163 | 404 |
| 431 | 3300009147 | Ga0114129_10013735 | Ga0114129_100137355 | 404 |
| 432 | 3300009177 | Ga0105248_10009770 | Ga0105248_100097706 | 404 |
| 433 | 3300009553 | Ga0105249_10021108 | Ga0105249_100211085 | 404 |
| 434 | 3300014326 | Ga0157380_10123434 | Ga0157380_101234342 | 404 |
| 435 | 3300025933 | Ga0207706_10149531 | Ga0207706_101495312 | 404 |
| 436 | 3300025936 | Ga0207670_10016523 | Ga0207670_100165232 | 404 |
| 437 | 3300025944 | Ga0207661_10000429 | Ga0207661_1000042920 | 404 |
| 438 | 3300025944 | Ga0207661_10104141 | Ga0207661_101041412 | 404 |
| 439 | 3300025945 | Ga0207679_10006877 | Ga0207679_100068772 | 404 |
| 440 | 3300025961 | Ga0207712_10018526 | Ga0207712_100185263 | 404 |
| 441 | 3300025986 | Ga0207658_10137274 | Ga0207658_101372742 | 404 |
| 442 | 3300026067 | Ga0207678_10028860 | Ga0207678_100288604 | 404 |
| 443 | 3300026121 | Ga0207683_10047807 | Ga0207683_100478073 | 404 |
| 444 | 3300028381 | Ga0268264_10148062 | Ga0268264_101480622 | 404 |
| 445 | 3300031901 | Ga0307406_10144779 | Ga0307406_101447791 | 404 |
| 446 | 3300032126 | Ga0307415_100159639 | Ga0307415_1001596391 | 404 |
| 447 | 3300048904 | Ga0496101_0208576 | Ga0496101_0208576_129_1430 | 404 |
| 448 | 3300048908 | Ga0496105_0010154 | Ga0496105_0010154_4966_6267 | 404 |
| 449 | 3300048911 | Ga0496108_0000908 | Ga0496108_0000908_16352_17653 | 404 |
| 450 | 3300048912 | Ga0496109_0001799 | Ga0496109_0001799_9580_10881 | 404 |
| 451 | 3300048913 | Ga0496110_0000066 | Ga0496110_0000066_31463_32764 | 404 |
| 452 | 3300048914 | Ga0496111_0023460 | Ga0496111_0023460_760_2061 | 404 |
| 453 | 3300049570 | Ga0501033_0027321 | Ga0501033_0027321_906_2177 | 404 |
| 454 | 3300049573 | Ga0501037_0060364 | Ga0501037_0060364_826_2097 | 404 |
| 455 | 3300049575 | Ga0501039_0013257 | Ga0501039_0013257_632_1903 | 404 |
| 456 | 3300049576 | Ga0501040_0004306 | Ga0501040_0004306_6724_7995 | 404 |
| 457 | 3300049577 | Ga0501041_0113125 | Ga0501041_0113125_231_1502 | 404 |
| 458 | 3300049579 | Ga0501043_0015508 | Ga0501043_0015508_1123_2394 | 404 |
| 459 | 3300049580 | Ga0501046_0022214 | Ga0501046_0022214_1229_2500 | 404 |
| 460 | 3300049584 | Ga0501068_0013818 | Ga0501068_0013818_1698_2969 | 404 |
| 461 | 3300049587 | Ga0501071_0002561 | Ga0501071_0002561_1221_2492 | 404 |
| 462 | 3300049588 | Ga0501072_0045151 | Ga0501072_0045151_1051_2322 | 404 |
| 463 | 3300049591 | Ga0501075_0001836 | Ga0501075_0001836_10064_11335 | 404 |
| 464 | 3300049592 | Ga0501076_0039574 | Ga0501076_0039574_619_1890 | 404 |
| 465 | 3300049593 | Ga0501077_0022163 | Ga0501077_0022163_1531_2802 | 404 |
| 466 | 3300049741 | Ga0501079_0002271 | Ga0501079_0002271_9357_10628 | 404 |
| 467 | 3300049743 | Ga0501081_0002262 | Ga0501081_0002262_9584_10855 | 404 |
| 468 | 3300049824 | Ga0501045_0015997 | Ga0501045_0015997_3223_4494 | 404 |
| 469 | 3300050507 | nmdc:mga05p37_26005_c1 | nmdc:mga05p37_26005_c1_2311_3663 | 404 |
| 470 | 3300050511 | nmdc:mga08y16_45778_c1 | nmdc:mga08y16_45778_c1_2854_4293 | 404 |
| 471 | 3300050515 | nmdc:mga0a205_121303_c1 | nmdc:mga0a205_121303_c1_826_2178 | 404 |
| 472 | 3300050515 | nmdc:mga0a205_23179_c1 | nmdc:mga0a205_23179_c1_2491_3795 | 404 |
| 473 | 3300054114 | Ga0501084_0006062 | Ga0501084_0006062_7449_8720 | 404 |
| 474 | 3300060353 | Ga0501082_0023210 | Ga0501082_0023210_1158_2429 | 404 |
| 475 | 3300005347 | Ga0070668_100164549 | Ga0070668_1001645491 | 405 |
| 476 | 3300005549 | Ga0070704_100044031 | Ga0070704_1000440312 | 405 |
| 477 | 3300005937 | Ga0081455_10066961 | Ga0081455_100669612 | 405 |
| 478 | 3300009098 | Ga0105245_10055351 | Ga0105245_100553512 | 405 |
| 479 | 3300049572 | Ga0501036_0066581 | Ga0501036_0066581_288_1661 | 405 |
| 480 | 3300049578 | Ga0501042_0100062 | Ga0501042_0100062_536_1909 | 405 |
| 481 | 3300049587 | Ga0501071_0048111 | Ga0501071_0048111_247_1620 | 405 |
| 482 | 3300049588 | Ga0501072_0001720 | Ga0501072_0001720_13365_14738 | 405 |
| 483 | 3300049590 | Ga0501074_0054310 | Ga0501074_0054310_74_1363 | 405 |
| 484 | 3300049591 | Ga0501075_0052020 | Ga0501075_0052020_413_1786 | 405 |
| 485 | 3300049592 | Ga0501076_0087760 | Ga0501076_0087760_595_1968 | 405 |
| 486 | 3300049743 | Ga0501081_0062481 | Ga0501081_0062481_690_2063 | 405 |
| 487 | 3300049824 | Ga0501045_0016504 | Ga0501045_0016504_1295_2668 | 405 |
| 488 | 3300054114 | Ga0501084_0165664 | Ga0501084_0165664_295_1668 | 405 |
| 489 | 3300060353 | Ga0501082_0063505 | Ga0501082_0063505_1253_2626 | 405 |
| 490 | 3300005356 | Ga0070674_100005846 | Ga0070674_1000058464 | 406 |
| 491 | 3300005459 | Ga0068867_100053704 | Ga0068867_1000537042 | 406 |
| 492 | 3300005719 | Ga0068861_100088694 | Ga0068861_1000886942 | 406 |
| 493 | 3300005842 | Ga0068858_100034888 | Ga0068858_1000348883 | 406 |
| 494 | 3300009094 | Ga0111539_10065903 | Ga0111539_100659032 | 406 |
| 495 | 3300025937 | Ga0207669_10004136 | Ga0207669_100041363 | 406 |
| 496 | 3300025972 | Ga0207668_10095231 | Ga0207668_100952312 | 406 |
| 497 | 3300026035 | Ga0207703_10056825 | Ga0207703_100568253 | 406 |
| 498 | 3300026089 | Ga0207648_10069175 | Ga0207648_100691752 | 406 |
| 499 | 3300026118 | Ga0207675_100120274 | Ga0207675_1001202742 | 406 |
| 500 | 3300026118 | Ga0207675_100212155 | Ga0207675_1002121552 | 406 |
| 501 | 3300047673 | Ga0495593_0086771 | Ga0495593_0086771_47_1357 | 406 |
| 502 | 3300005290 | Ga0065712_10069564 | Ga0065712_100695643 | 407 |
| 503 | 3300005436 | Ga0070713_100006103 | Ga0070713_1000061037 | 407 |
| 504 | 3300005440 | Ga0070705_100030206 | Ga0070705_1000302062 | 407 |
| 505 | 3300005471 | Ga0070698_100056026 | Ga0070698_1000560263 | 407 |
| 506 | 3300005544 | Ga0070686_100138497 | Ga0070686_1001384972 | 407 |
| 507 | 3300005546 | Ga0070696_100101850 | Ga0070696_1001018502 | 407 |
| 508 | 3300006028 | Ga0070717_10043490 | Ga0070717_100434902 | 407 |
| 509 | 3300006871 | Ga0075434_100036218 | Ga0075434_1000362182 | 407 |
| 510 | 3300007076 | Ga0075435_100000679 | Ga0075435_10000067918 | 407 |
| 511 | 3300009094 | Ga0111539_10004791 | Ga0111539_100047918 | 407 |
| 512 | 3300009147 | Ga0114129_10055038 | Ga0114129_100550384 | 407 |
| 513 | 3300025928 | Ga0207700_10121147 | Ga0207700_101211472 | 407 |
| 514 | 3300026035 | Ga0207703_10048095 | Ga0207703_100480953 | 407 |
| 515 | 3300026118 | Ga0207675_100058162 | Ga0207675_1000581622 | 407 |
| 516 | 3300046517 | Ga0495630_0005297 | Ga0495630_0005297_7488_8807 | 407 |
| 517 | 3300046536 | Ga0495587_0031483 | Ga0495587_0031483_80_1399 | 407 |
| 518 | 3300046559 | Ga0495667_0138216 | Ga0495667_0138216_164_1483 | 407 |
| 519 | 3300046689 | Ga0495613_0009377 | Ga0495613_0009377_1424_2743 | 407 |
| 520 | 3300047317 | Ga0495604_0010365 | Ga0495604_0010365_5573_6892 | 407 |
| 521 | 3300047471 | Ga0495684_0000549 | Ga0495684_0000549_21411_22730 | 407 |
| 522 | 3300050507 | nmdc:mga05p37_42381_c1 | nmdc:mga05p37_42381_c1_2609_3901 | 407 |
| 523 | 3300050511 | nmdc:mga08y16_8502_c1 | nmdc:mga08y16_8502_c1_2069_3361 | 407 |
| 524 | 3300050512 | nmdc:mga0n895_21730_c1 | nmdc:mga0n895_21730_c1_3854_5179 | 407 |
| 525 | 3300050513 | nmdc:mga0rr50_1059_c1 | nmdc:mga0rr50_1059_c1_6133_7458 | 407 |
| 526 | 3300053077 | Ga0495601_0022543 | Ga0495601_0022543_386_1708 | 407 |
| 527 | 3300053085 | Ga0495619_0148837 | Ga0495619_0148837_259_1578 | 407 |
| 528 | 3300005331 | Ga0070670_100032413 | Ga0070670_1000324134 | 408 |
| 529 | 3300005340 | Ga0070689_100181020 | Ga0070689_1001810201 | 408 |
| 530 | 3300005354 | Ga0070675_100139288 | Ga0070675_1001392882 | 408 |
| 531 | 3300005365 | Ga0070688_100055951 | Ga0070688_1000559512 | 408 |
| 532 | 3300005459 | Ga0068867_100136177 | Ga0068867_1001361772 | 408 |
| 533 | 3300005535 | Ga0070684_100049573 | Ga0070684_1000495733 | 408 |
| 534 | 3300005548 | Ga0070665_100159982 | Ga0070665_1001599822 | 408 |
| 535 | 3300005842 | Ga0068858_100001614 | Ga0068858_10000161414 | 408 |
| 536 | 3300005843 | Ga0068860_100056083 | Ga0068860_1000560833 | 408 |
| 537 | 3300006237 | Ga0097621_100038470 | Ga0097621_1000384702 | 408 |
| 538 | 3300006844 | Ga0075428_100000034 | Ga0075428_10000003467 | 408 |
| 539 | 3300007076 | Ga0075435_100005712 | Ga0075435_1000057128 | 408 |
| 540 | 3300009094 | Ga0111539_10000014 | Ga0111539_10000014222 | 408 |
| 541 | 3300009098 | Ga0105245_10017071 | Ga0105245_100170715 | 408 |
| 542 | 3300009101 | Ga0105247_10053301 | Ga0105247_100533013 | 408 |
| 543 | 3300009147 | Ga0114129_10127174 | Ga0114129_101271742 | 408 |
| 544 | 3300009176 | Ga0105242_10058986 | Ga0105242_100589862 | 408 |
| 545 | 3300009176 | Ga0105242_10166578 | Ga0105242_101665781 | 408 |
| 546 | 3300009177 | Ga0105248_10036771 | Ga0105248_100367712 | 408 |
| 547 | 3300013308 | Ga0157375_10184391 | Ga0157375_101843912 | 408 |
| 548 | 3300014969 | Ga0157376_10252474 | Ga0157376_102524742 | 408 |
| 549 | 3300025893 | Ga0207682_10019050 | Ga0207682_100190502 | 408 |
| 550 | 3300025901 | Ga0207688_10049866 | Ga0207688_100498662 | 408 |
| 551 | 3300026035 | Ga0207703_10071876 | Ga0207703_100718762 | 408 |
| 552 | 3300026089 | Ga0207648_10033008 | Ga0207648_100330083 | 408 |
| 553 | 3300026118 | Ga0207675_100152372 | Ga0207675_1001523722 | 408 |
| 554 | 3300026121 | Ga0207683_10072146 | Ga0207683_100721462 | 408 |
| 555 | 3300027907 | Ga0207428_10000005 | Ga0207428_1000000524 | 408 |
| 556 | 3300028379 | Ga0268266_10069550 | Ga0268266_100695503 | 408 |
| 557 | 3300028380 | Ga0268265_10088139 | Ga0268265_100881392 | 408 |
| 558 | 3300050507 | nmdc:mga05p37_3329_c1 | nmdc:mga05p37_3329_c1_1409_2689 | 408 |
| 559 | 3300050511 | nmdc:mga08y16_9_c1 | nmdc:mga08y16_9_c1_530961_532292 | 408 |
| 560 | 3300050513 | nmdc:mga0rr50_3418_c1 | nmdc:mga0rr50_3418_c1_6873_8162 | 408 |
| 561 | 3300050515 | nmdc:mga0a205_17656_c1 | nmdc:mga0a205_17656_c1_735_2015 | 408 |
| 562 | 3300002459 | JGI24751J29686_10001158 | JGI24751J29686_100011582 | 409 |
| 563 | 3300005335 | Ga0070666_10049715 | Ga0070666_100497152 | 409 |
| 564 | 3300005353 | Ga0070669_100102880 | Ga0070669_1001028802 | 409 |
| 565 | 3300005468 | Ga0070707_100257523 | Ga0070707_1002575232 | 409 |
| 566 | 3300005518 | Ga0070699_100000613 | Ga0070699_10000061315 | 409 |
| 567 | 3300005518 | Ga0070699_100261693 | Ga0070699_1002616932 | 409 |
| 568 | 3300005548 | Ga0070665_100002176 | Ga0070665_1000021769 | 409 |
| 569 | 3300005548 | Ga0070665_100022887 | Ga0070665_1000228873 | 409 |
| 570 | 3300005563 | Ga0068855_100039380 | Ga0068855_1000393806 | 409 |
| 571 | 3300005563 | Ga0068855_100174372 | Ga0068855_1001743722 | 409 |
| 572 | 3300005617 | Ga0068859_100003307 | Ga0068859_10000330711 | 409 |
| 573 | 3300005617 | Ga0068859_100281755 | Ga0068859_1002817552 | 409 |
| 574 | 3300005618 | Ga0068864_100002493 | Ga0068864_1000024937 | 409 |
| 575 | 3300005618 | Ga0068864_100021764 | Ga0068864_1000217645 | 409 |
| 576 | 3300005841 | Ga0068863_100025405 | Ga0068863_1000254054 | 409 |
| 577 | 3300005842 | Ga0068858_100007374 | Ga0068858_1000073743 | 409 |
| 578 | 3300005842 | Ga0068858_100021865 | Ga0068858_1000218653 | 409 |
| 579 | 3300005985 | Ga0081539_10010419 | Ga0081539_100104193 | 409 |
| 580 | 3300006163 | Ga0070715_10030456 | Ga0070715_100304563 | 409 |
| 581 | 3300006237 | Ga0097621_100000956 | Ga0097621_1000009562 | 409 |
| 582 | 3300006358 | Ga0068871_100018930 | Ga0068871_1000189304 | 409 |
| 583 | 3300006358 | Ga0068871_100107878 | Ga0068871_1001078782 | 409 |
| 584 | 3300006844 | Ga0075428_100054654 | Ga0075428_1000546544 | 409 |
| 585 | 3300006871 | Ga0075434_100000878 | Ga0075434_1000008786 | 409 |
| 586 | 3300006881 | Ga0068865_100010765 | Ga0068865_1000107653 | 409 |
| 587 | 3300006914 | Ga0075436_100015343 | Ga0075436_1000153434 | 409 |
| 588 | 3300006914 | Ga0075436_100023673 | Ga0075436_1000236734 | 409 |
| 589 | 3300006931 | Ga0097620_100003307 | Ga0097620_1000033074 | 409 |
| 590 | 3300006931 | Ga0097620_100281756 | Ga0097620_1002817562 | 409 |
| 591 | 3300007076 | Ga0075435_100000346 | Ga0075435_1000003462 | 409 |
| 592 | 3300007076 | Ga0075435_100004536 | Ga0075435_1000045365 | 409 |
| 593 | 3300009094 | Ga0111539_10087941 | Ga0111539_100879413 | 409 |
| 594 | 3300009098 | Ga0105245_10007142 | Ga0105245_100071423 | 409 |
| 595 | 3300009101 | Ga0105247_10027016 | Ga0105247_100270163 | 409 |
| 596 | 3300009101 | Ga0105247_10089183 | Ga0105247_100891831 | 409 |
| 597 | 3300009147 | Ga0114129_10003915 | Ga0114129_1000391511 | 409 |
| 598 | 3300009147 | Ga0114129_10010441 | Ga0114129_100104413 | 409 |
| 599 | 3300009147 | Ga0114129_10052603 | Ga0114129_100526034 | 409 |
| 600 | 3300009147 | Ga0114129_10232177 | Ga0114129_102321772 | 409 |
| 601 | 3300009176 | Ga0105242_10004909 | Ga0105242_100049092 | 409 |
| 602 | 3300009176 | Ga0105242_10141024 | Ga0105242_101410242 | 409 |
| 603 | 3300009177 | Ga0105248_10027721 | Ga0105248_100277213 | 409 |
| 604 | 3300009177 | Ga0105248_10253545 | Ga0105248_102535452 | 409 |
| 605 | 3300009545 | Ga0105237_10358350 | Ga0105237_103583501 | 409 |
| 606 | 3300013308 | Ga0157375_10246973 | Ga0157375_102469732 | 409 |
| 607 | 3300014325 | Ga0163163_10006204 | Ga0163163_100062043 | 409 |
| 608 | 3300014325 | Ga0163163_10111182 | Ga0163163_101111822 | 409 |
| 609 | 3300014968 | Ga0157379_10041814 | Ga0157379_100418142 | 409 |
| 610 | 3300014968 | Ga0157379_10118462 | Ga0157379_101184622 | 409 |
| 611 | 3300014968 | Ga0157379_10130196 | Ga0157379_101301962 | 409 |
| 612 | 3300014969 | Ga0157376_10063670 | Ga0157376_100636702 | 409 |
| 613 | 3300014969 | Ga0157376_10304445 | Ga0157376_103044451 | 409 |
| 614 | 3300025900 | Ga0207710_10012971 | Ga0207710_100129713 | 409 |
| 615 | 3300025922 | Ga0207646_10223324 | Ga0207646_102233241 | 409 |
| 616 | 3300025923 | Ga0207681_10102419 | Ga0207681_101024192 | 409 |
| 617 | 3300025934 | Ga0207686_10001273 | Ga0207686_100012734 | 409 |
| 618 | 3300025938 | Ga0207704_10002599 | Ga0207704_100025992 | 409 |
| 619 | 3300025938 | Ga0207704_10129605 | Ga0207704_101296052 | 409 |
| 620 | 3300025941 | Ga0207711_10026403 | Ga0207711_100264033 | 409 |
| 621 | 3300025941 | Ga0207711_10061858 | Ga0207711_100618582 | 409 |
| 622 | 3300025941 | Ga0207711_10102191 | Ga0207711_101021912 | 409 |
| 623 | 3300025945 | Ga0207679_10029141 | Ga0207679_100291413 | 409 |
| 624 | 3300025986 | Ga0207658_10032995 | Ga0207658_100329954 | 409 |
| 625 | 3300026023 | Ga0207677_10019524 | Ga0207677_100195245 | 409 |
| 626 | 3300026035 | Ga0207703_10004455 | Ga0207703_100044556 | 409 |
| 627 | 3300026035 | Ga0207703_10004637 | Ga0207703_100046374 | 409 |
| 628 | 3300026075 | Ga0207708_10094975 | Ga0207708_100949752 | 409 |
| 629 | 3300026088 | Ga0207641_10024194 | Ga0207641_100241942 | 409 |
| 630 | 3300026088 | Ga0207641_10129657 | Ga0207641_101296572 | 409 |
| 631 | 3300026089 | Ga0207648_10087812 | Ga0207648_100878122 | 409 |
| 632 | 3300027907 | Ga0207428_10128369 | Ga0207428_101283692 | 409 |
| 633 | 3300028379 | Ga0268266_10002791 | Ga0268266_100027918 | 409 |
| 634 | 3300028379 | Ga0268266_10002943 | Ga0268266_1000294311 | 409 |
| 635 | 3300035089 | Ga0373944_0005125 | Ga0373944_0005125_272_1579 | 409 |
| 636 | 3300035241 | Ga0373961_0019233 | Ga0373961_0019233_34_1335 | 409 |
| 637 | 3300036401 | Ga0373937_0037893 | Ga0373937_0037893_227_1534 | 409 |
| 638 | 3300036401 | Ga0373937_0107582 | Ga0373937_0107582_904_2244 | 409 |
| 639 | 3300046459 | Ga0495629_0135150 | Ga0495629_0135150_67_1374 | 409 |
| 640 | 3300046535 | Ga0495586_0139750 | Ga0495586_0139750_30_1337 | 409 |
| 641 | 3300046539 | Ga0495621_0025842 | Ga0495621_0025842_209_1504 | 409 |
| 642 | 3300046543 | Ga0495645_0001908 | Ga0495645_0001908_4141_5448 | 409 |
| 643 | 3300046681 | Ga0495647_0002504 | Ga0495647_0002504_2168_3475 | 409 |
| 644 | 3300046683 | Ga0495658_0020116 | Ga0495658_0020116_1106_2413 | 409 |
| 645 | 3300046683 | Ga0495658_0080835 | Ga0495658_0080835_121_1428 | 409 |
| 646 | 3300048904 | Ga0496101_0001942 | Ga0496101_0001942_5254_6570 | 409 |
| 647 | 3300048907 | Ga0496104_0011320 | Ga0496104_0011320_3595_4902 | 409 |
| 648 | 3300048907 | Ga0496104_0068648 | Ga0496104_0068648_1797_3113 | 409 |
| 649 | 3300048907 | Ga0496104_0093056 | Ga0496104_0093056_1022_2368 | 409 |
| 650 | 3300048910 | Ga0496107_0062136 | Ga0496107_0062136_246_1562 | 409 |
| 651 | 3300048911 | Ga0496108_0019676 | Ga0496108_0019676_384_1691 | 409 |
| 652 | 3300048912 | Ga0496109_0256091 | Ga0496109_0256091_160_1467 | 409 |
| 653 | 3300048915 | Ga0496112_0055158 | Ga0496112_0055158_2169_3476 | 409 |
| 654 | 3300048915 | Ga0496112_0148779 | Ga0496112_0148779_759_2105 | 409 |
| 655 | 3300048916 | Ga0496113_0187683 | Ga0496113_0187683_24_1331 | 409 |
| 656 | 3300048917 | Ga0496114_0001859 | Ga0496114_0001859_1823_3139 | 409 |
| 657 | 3300048917 | Ga0496114_0068178 | Ga0496114_0068178_237_1544 | 409 |
| 658 | 3300048917 | Ga0496114_0188124 | Ga0496114_0188124_334_1641 | 409 |
| 659 | 3300050507 | nmdc:mga05p37_53213_c1 | nmdc:mga05p37_53213_c1_2969_4258 | 409 |
| 660 | 3300050507 | nmdc:mga05p37_67575_c1 | nmdc:mga05p37_67575_c1_2422_3729 | 409 |
| 661 | 3300050507 | nmdc:mga05p37_8845_c1 | nmdc:mga05p37_8845_c1_3476_4780 | 409 |
| 662 | 3300050511 | nmdc:mga08y16_36347_c1 | nmdc:mga08y16_36347_c1_2915_4219 | 409 |
| 663 | 3300050511 | nmdc:mga08y16_4948_c1 | nmdc:mga08y16_4948_c1_10565_11881 | 409 |
| 664 | 3300050512 | nmdc:mga0n895_35_c1 | nmdc:mga0n895_35_c1_26334_27632 | 409 |
| 665 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_26334_27632 | 409 |
| 666 | 3300050514 | nmdc:mga08x19_41407_c1 | nmdc:mga08x19_41407_c1_1021_2328 | 409 |
| 667 | 3300050514 | nmdc:mga08x19_4860_c1 | nmdc:mga08x19_4860_c1_1111_2409 | 409 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6me5-assembly1.cif.gz_A | xfel crystal structure of human melatonin receptor mt1 in complex with agomelatine | 0.8095 | 226 | 386 |
| 3qhp-assembly1.cif.gz_A | crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori | 0.7973 | 237 | 386 |
| 6tpk-assembly1.cif.gz_A | crystal structure of the human oxytocin receptor | 0.7938 | 226 | 388 |
| 6kqi-assembly1.cif.gz_A | structure of an allosteric modulator bound to the cb1 cannabinoid receptor | 0.7926 | 226 | 405 |
| 4s0v-assembly1.cif.gz_A | crystal structure of the human ox2 orexin receptor bound to the insomnia drug suvorexant | 0.7846 | 226 | 386 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59002_191_368_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8897 | 229 | 389 | 3.40.50.2000 |
| af_Q2G0L3_321_481_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.868 | 243 | 386 | 3.40.50.2000 |
| af_P96407_190_356_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8609 | 236 | 385 | 3.40.50.2000 |
| 3okaA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8537 | 226 | 386 | 3.40.50.2000 |
| af_P9WMY9_212_374_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8505 | 237 | 385 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521T918-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9964 | 1 | 180 |
|
| AF-A0A497PN64-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9816 | 1 | 165 |
GO:0016740
|
| AF-A0A521T918-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9801 | 1 | 180 |
|
| AF-A0A2V7V5Z4-F1-model_v4 | Hexosyltransferase | 0.9776 | 1 | 167 |
GO:0016740
|
| AF-A0A832TGL2-F1-model_v4 | Glycosyltransferase family 4 protein | 0.9714 | 1 | 73 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar