F473803

General Info

Members Datasets Scaffolds Average Seq Length
666 433 1332 91

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0816038|Ga0496105_0816038_214_540
Length 108
Sequence VGITLDVNHAQRYYPDVIVSFKSAEAEVLANGRRVKRFESIESVARRKLRQLQIASRLDDLRVPPGNRLEALKGDRAGQHSIRVNDQFRVCFRWTPAGAEDVEIVDYH

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
193 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
194 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
195 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
296 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
299 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
300 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
306 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
307 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
308 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
309 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
310 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
311 2516143018 Ensifer sp. BR816 Isolate Nodule
312 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
313 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
314 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
315 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
316 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
317 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
318 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
319 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
320 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
321 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
322 2844163670 Ensifer sp. 1H6 Isolate Unclassified
323 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
324 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
325 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
326 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
327 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
328 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
329 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
330 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
331 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
332 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
333 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
334 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
335 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
336 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
337 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
338 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
339 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
340 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
341 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
342 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
343 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
344 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
345 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
346 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
347 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
348 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
349 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
350 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
351 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
352 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
353 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
354 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
355 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
356 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
357 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
358 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
359 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
360 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
361 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
362 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
363 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
364 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
365 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
366 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
367 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
368 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
369 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
370 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
371 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
372 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
373 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
374 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
375 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
376 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
377 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
378 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
379 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
380 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
381 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
382 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
383 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
384 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
385 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
386 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
387 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
388 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
389 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
390 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
391 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
392 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
393 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
394 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
395 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
396 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
397 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
398 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
399 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
400 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
401 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
402 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
403 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
404 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
405 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
406 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
407 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
408 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
409 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
410 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
411 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
412 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
413 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
414 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
415 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
416 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
417 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
418 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
419 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
420 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
421 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
422 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
423 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
424 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
425 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
426 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
427 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
428 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
429 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
430 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
431 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
432 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
433 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.28
Metatranscriptomes 1.5
Isolates 19.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 19.37
Rhizoplane 1.65
Rhizosphere 71.62
Stem 0
Stem Tuber 0.15
Unclassified 17.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0816038 3300048908 Bacteria 708
2 JGI24736J21556_1008296 3300001904 Bacteria 1727
3 JGI25156J39149_1004137 3300002705 Bacteria 4503
4 rootH2_10140073 3300003320 Bacteria 1186
5 Ga0070658_10029533 3300005327 Bacteria 4405
6 Ga0070658_10111282 3300005327 Bacteria 2269
7 Ga0070676_10080216 3300005328 Bacteria 1978
8 Ga0070690_100044755 3300005330 Bacteria 2811
9 Ga0068869_100618299 3300005334 Unclassified 917
10 Ga0068869_101752903 3300005334 Unclassified 555
11 Ga0070666_10487625 3300005335 Bacteria 893
12 Ga0070666_10738880 3300005335 Bacteria 723
13 Ga0070666_11410774 3300005335 Unclassified 520
14 Ga0070680_100071512 3300005336 Bacteria 2850
15 Ga0070680_100219124 3300005336 Bacteria 1606
16 Ga0070680_100733191 3300005336 Bacteria 851
17 Ga0070680_101751706 3300005336 Unclassified 538
18 Ga0070660_100295796 3300005339 Bacteria 1326
19 Ga0070660_100300667 3300005339 Bacteria 1315
20 Ga0070660_100389834 3300005339 Bacteria 1151
21 Ga0070660_101514580 3300005339 Unclassified 570
22 Ga0070691_10753987 3300005341 Unclassified 589
23 Ga0070687_100001429 3300005343 Bacteria 8388
24 Ga0070661_100179512 3300005344 Unclassified 1610
25 Ga0070668_100698893 3300005347 Bacteria 894
26 Ga0070668_101533677 3300005347 Unclassified 609
27 Ga0070669_100000032 3300005353 Bacteria 153549
28 Ga0070675_100462769 3300005354 Unclassified 1139
29 Ga0070671_100805427 3300005355 Bacteria 818
30 Ga0070674_100277158 3300005356 Bacteria 1328
31 Ga0070673_100165568 3300005364 Unclassified 1883
32 Ga0070688_100668158 3300005365 Bacteria 802
33 Ga0070667_101002367 3300005367 Bacteria 779
34 Ga0070709_10565806 3300005434 Unclassified 871
35 Ga0070714_100215817 3300005435 Bacteria 1761
36 Ga0070714_101910101 3300005435 Bacteria 579
37 Ga0070710_10242490 3300005437 Bacteria 1155
38 Ga0070705_100196445 3300005440 Bacteria 1379
39 Ga0070694_100646778 3300005444 Bacteria 855
40 Ga0070708_100005613 3300005445 Bacteria 9948
41 Ga0070708_101236616 3300005445 Unclassified 698
42 Ga0070663_100083304 3300005455 Bacteria 2355
43 Ga0070663_100113711 3300005455 Bacteria 2037
44 Ga0070662_100215642 3300005457 Unclassified 1529
45 Ga0070662_101455766 3300005457 Unclassified 590
46 Ga0070681_10345645 3300005458 Bacteria 1398
47 Ga0070681_10593793 3300005458 Bacteria 1021
48 Ga0068867_100312591 3300005459 Unclassified 1299
49 Ga0070685_10002795 3300005466 Bacteria 8917
50 Ga0070706_100100035 3300005467 Bacteria 2693
51 Ga0070706_100386171 3300005467 Bacteria 1304
52 Ga0070706_100615930 3300005467 Bacteria 1008
53 Ga0070707_100005144 3300005468 Bacteria 12254
54 Ga0070707_101063757 3300005468 Unclassified 775
55 Ga0070698_100058065 3300005471 Bacteria 3913
56 Ga0070698_100161663 3300005471 Bacteria 2183
57 Ga0070699_100004729 3300005518 Bacteria 12037
58 Ga0070699_100039464 3300005518 Bacteria 4088
59 Ga0070699_100043917 3300005518 Bacteria 3868
60 Ga0070699_101827033 3300005518 Unclassified 556
61 Ga0070679_100051217 3300005530 Bacteria 4112
62 Ga0070679_100072561 3300005530 Bacteria 3434
63 Ga0070697_100000024 3300005536 Bacteria 129765
64 Ga0070697_100006874 3300005536 Bacteria 8838
65 Ga0070697_100160705 3300005536 Bacteria 1898
66 Ga0070697_101013790 3300005536 Unclassified 738
67 Ga0070672_100118109 3300005543 Bacteria 2169
68 Ga0070686_100315050 3300005544 Bacteria 1165
69 Ga0070686_100356617 3300005544 Bacteria 1100
70 Ga0070696_100205935 3300005546 Unclassified 1470
71 Ga0070693_100043030 3300005547 Bacteria 2548
72 Ga0070693_100067586 3300005547 Unclassified 2095
73 Ga0068855_100454500 3300005563 Bacteria 1397
74 Ga0068855_101722740 3300005563 Unclassified 638
75 Ga0068857_100238285 3300005577 Bacteria 1665
76 Ga0068857_101882338 3300005577 Bacteria 586
77 Ga0068854_101052213 3300005578 Bacteria 723
78 Ga0070702_100218203 3300005615 Unclassified 1274
79 Ga0068852_100166198 3300005616 Unclassified 2064
80 Ga0068852_102167579 3300005616 Bacteria 577
81 Ga0068859_100364895 3300005617 Unclassified 1539
82 Ga0068859_100744970 3300005617 Unclassified 1069
83 Ga0068859_101944463 3300005617 Unclassified 649
84 Ga0068864_100150829 3300005618 Unclassified 2105
85 Ga0068864_100967142 3300005618 Unclassified 843
86 Ga0068866_10998820 3300005718 Unclassified 594
87 Ga0068863_100176349 3300005841 Bacteria 2051
88 Ga0068858_100186949 3300005842 Bacteria 1957
89 Ga0068860_101686505 3300005843 Bacteria 656
90 Ga0068862_100000656 3300005844 Bacteria 35489
91 Ga0068862_100180732 3300005844 Bacteria 1893
92 Ga0068862_100663745 3300005844 Bacteria 1007
93 Ga0081539_10214275 3300005985 Bacteria 880
94 Ga0070717_10007144 3300006028 Bacteria 8275
95 Ga0070717_10032626 3300006028 Bacteria 4198
96 Ga0070717_10600793 3300006028 Bacteria 998
97 Ga0070717_10671726 3300006028 Bacteria 941
98 Ga0075365_10232139 3300006038 Bacteria 1295
99 Ga0075368_10102103 3300006042 Bacteria 1178
100 Ga0075368_10123666 3300006042 Bacteria 1073
101 Ga0075363_100137793 3300006048 Bacteria 1372
102 Ga0075364_10051616 3300006051 Bacteria 2686
103 Ga0075366_10460075 3300006195 Bacteria 785
104 Ga0097621_100842649 3300006237 Bacteria 851
105 Ga0097621_101387351 3300006237 Unclassified 665
106 Ga0075370_10197737 3300006353 Bacteria 1185
107 Ga0068871_100625238 3300006358 Bacteria 981
108 Ga0068871_101992262 3300006358 Unclassified 553
109 Ga0075428_100020006 3300006844 Bacteria 7413
110 Ga0075430_100097591 3300006846 Bacteria 2455
111 Ga0075430_100869096 3300006846 Bacteria 743
112 Ga0075431_101532300 3300006847 Bacteria 625
113 Ga0075434_100214827 3300006871 Bacteria 1943
114 Ga0075429_100088637 3300006880 Bacteria 2697
115 Ga0097620_100364902 3300006931 Unclassified 1539
116 Ga0097620_100744935 3300006931 Unclassified 1069
117 Ga0097620_101944439 3300006931 Unclassified 649
118 Ga0079104_1100989 3300006946 Bacteria 577
119 Ga0099826_10534717 3300006948 Bacteria 542
120 Ga0075435_100111188 3300007076 Bacteria 2279
121 Ga0099794_10046233 3300007265 Bacteria 2084
122 Ga0099794_10485340 3300007265 Unclassified 650
123 Ga0099795_10018180 3300007788 Bacteria 2254
124 Ga0099795_10074479 3300007788 Bacteria 1287
125 Ga0099795_10092130 3300007788 Unclassified 1176
126 Ga0099795_10101865 3300007788 Bacteria 1127
127 Ga0105240_10001953 3300009093 Bacteria 34136
128 Ga0105240_10007273 3300009093 Bacteria 16116
129 Ga0105240_10128908 3300009093 Bacteria 3037
130 Ga0105240_10320247 3300009093 Bacteria 1768
131 Ga0105240_10591000 3300009093 Unclassified 1223
132 Ga0105240_12814072 3300009093 Unclassified 500
133 Ga0105245_10188755 3300009098 Unclassified 1973
134 Ga0105247_11470215 3300009101 Bacteria 554
135 Ga0114129_10078068 3300009147 Bacteria 4605
136 Ga0114129_10182262 3300009147 Unclassified 2856
137 Ga0105243_10769108 3300009148 Unclassified 946
138 Ga0105241_10076081 3300009174 Bacteria 2617
139 Ga0105241_12534398 3300009174 Bacteria 514
140 Ga0105242_10132635 3300009176 Bacteria 2152
141 Ga0105237_10045121 3300009545 Bacteria 4437
142 Ga0105237_10190548 3300009545 Unclassified 2051
143 Ga0105238_10033929 3300009551 Bacteria 5193
144 Ga0105238_10466872 3300009551 Bacteria 1260
145 Ga0105238_12192553 3300009551 Unclassified 587
146 Ga0105238_12511927 3300009551 Unclassified 551
147 Ga0105249_10045431 3300009553 Bacteria 3995
148 Ga0105249_12111300 3300009553 Bacteria 636
149 Ga0099796_10011962 3300010159 Bacteria 2436
150 Ga0099796_10057011 3300010159 Bacteria 1373
151 Ga0099796_10232664 3300010159 Bacteria 759
152 Ga0105239_10057310 3300010375 Bacteria 4273
153 Ga0105239_10970936 3300010375 Bacteria 976
154 Ga0105239_11678571 3300010375 Bacteria 735
155 Ga0105239_11678883 3300010375 Bacteria 735
156 Ga0105239_12642703 3300010375 Bacteria 586
157 Ga0157373_10145644 3300013100 Bacteria 1666
158 Ga0157373_10146601 3300013100 Bacteria 1660
159 Ga0157373_10359195 3300013100 Unclassified 1040
160 Ga0157370_10001444 3300013104 Bacteria 29389
161 Ga0157370_10190524 3300013104 Bacteria 1904
162 Ga0157370_10840019 3300013104 Bacteria 835
163 Ga0157370_10881160 3300013104 Unclassified 813
164 Ga0157369_10150443 3300013105 Unclassified 2460
165 Ga0157369_10329279 3300013105 Bacteria 1587
166 Ga0157369_12142198 3300013105 Unclassified 567
167 Ga0157374_10060987 3300013296 Bacteria 3531
168 Ga0157374_10124562 3300013296 Bacteria 2490
169 Ga0157374_10270521 3300013296 Unclassified 1675
170 Ga0157378_10015503 3300013297 Bacteria 6677
171 Ga0157378_12108735 3300013297 Bacteria 614
172 Ga0163162_11295111 3300013306 Unclassified 828
173 Ga0163162_12634399 3300013306 Unclassified 579
174 Ga0157372_10000393 3300013307 Bacteria 48315
175 Ga0157372_10026071 3300013307 Bacteria 6359
176 Ga0157372_10073054 3300013307 Bacteria 3865
177 Ga0157372_10293299 3300013307 Bacteria 1891
178 Ga0157375_10000015 3300013308 Bacteria 308254
179 Ga0157375_10301597 3300013308 Bacteria 1765
180 Ga0157375_11398670 3300013308 Bacteria 824
181 Ga0157375_11594025 3300013308 Bacteria 772
182 Ga0163163_10184593 3300014325 Bacteria 2133
183 Ga0157380_10091158 3300014326 Bacteria 2516
184 Ga0157379_11424933 3300014968 Bacteria 672
185 Ga0157376_10101432 3300014969 Bacteria 2515
186 Ga0197907_11005704 3300020069 Bacteria 1113
187 Ga0206354_10664665 3300020081 Bacteria 1333
188 Ga0206353_11678336 3300020082 Bacteria 1329
189 Ga0213872_10003766 3300021361 Bacteria 8275
190 Ga0213875_10010746 3300021388 Bacteria 4578
191 Ga0224712_10004707 3300022467 Bacteria 3710
192 Ga0228710_1000815 3300022740 Bacteria 43349
193 Ga0207692_10170788 3300025898 Bacteria 1260
194 Ga0207680_10444568 3300025903 Bacteria 920
195 Ga0207680_10516550 3300025903 Bacteria 851
196 Ga0207680_11246462 3300025903 Unclassified 530
197 Ga0207699_10228731 3300025906 Unclassified 1273
198 Ga0207705_10095404 3300025909 Bacteria 2183
199 Ga0207705_10105570 3300025909 Unclassified 2077
200 Ga0207705_10345522 3300025909 Bacteria 1146
201 Ga0207705_10737370 3300025909 Bacteria 765
202 Ga0207684_10010487 3300025910 Bacteria 8154
203 Ga0207684_10027441 3300025910 Bacteria 4852
204 Ga0207654_10104346 3300025911 Bacteria 1752
205 Ga0207707_10010965 3300025912 Bacteria 7882
206 Ga0207707_10140463 3300025912 Bacteria 2112
207 Ga0207707_10177432 3300025912 Bacteria 1861
208 Ga0207707_10550771 3300025912 Bacteria 980
209 Ga0207707_10881101 3300025912 Bacteria 741
210 Ga0207695_10000002 3300025913 Bacteria 2188391
211 Ga0207695_10000007 3300025913 Bacteria 1092551
212 Ga0207695_10046981 3300025913 Bacteria 4572
213 Ga0207695_10500539 3300025913 Bacteria 1097
214 Ga0207671_10056276 3300025914 Bacteria 2914
215 Ga0207671_10145411 3300025914 Unclassified 1829
216 Ga0207671_10368805 3300025914 Bacteria 1140
217 Ga0207660_10168617 3300025917 Bacteria 1693
218 Ga0207660_10239019 3300025917 Bacteria 1430
219 Ga0207660_10874254 3300025917 Bacteria 734
220 Ga0207660_11382169 3300025917 Bacteria 571
221 Ga0207662_10008029 3300025918 Bacteria 5758
222 Ga0207657_10015583 3300025919 Bacteria 7357
223 Ga0207657_10114418 3300025919 Bacteria 2225
224 Ga0207657_10416455 3300025919 Bacteria 1056
225 Ga0207649_10312390 3300025920 Unclassified 1152
226 Ga0207649_10538781 3300025920 Unclassified 892
227 Ga0207652_10078630 3300025921 Unclassified 2880
228 Ga0207652_10152356 3300025921 Unclassified 2071
229 Ga0207652_10722008 3300025921 Bacteria 888
230 Ga0207646_10003637 3300025922 Bacteria 17242
231 Ga0207646_10190020 3300025922 Bacteria 1855
232 Ga0207646_10423197 3300025922 Bacteria 1202
233 Ga0207694_10000425 3300025924 Bacteria 39177
234 Ga0207694_10597880 3300025924 Bacteria 928
235 Ga0207694_11590715 3300025924 Unclassified 551
236 Ga0207659_10009721 3300025926 Bacteria 6015
237 Ga0207687_10547332 3300025927 Bacteria 971
238 Ga0207700_10587495 3300025928 Bacteria 991
239 Ga0207664_10167685 3300025929 Bacteria 1877
240 Ga0207664_11241968 3300025929 Bacteria 664
241 Ga0207664_11286109 3300025929 Bacteria 651
242 Ga0207644_11862804 3300025931 Bacteria 503
243 Ga0207690_10101084 3300025932 Bacteria 2059
244 Ga0207706_10489880 3300025933 Unclassified 1062
245 Ga0207686_10109101 3300025934 Bacteria 1863
246 Ga0207709_10009064 3300025935 Bacteria 5486
247 Ga0207669_10468771 3300025937 Unclassified 1001
248 Ga0207691_10131169 3300025940 Bacteria 2214
249 Ga0207689_10007384 3300025942 Bacteria 9638
250 Ga0207689_11353286 3300025942 Unclassified 597
251 Ga0207661_10002064 3300025944 Bacteria 13826
252 Ga0207661_10427081 3300025944 Bacteria 1204
253 Ga0207661_10561024 3300025944 Bacteria 1046
254 Ga0207667_10068857 3300025949 Bacteria 3684
255 Ga0207667_10200730 3300025949 Eukaryota 2046
256 Ga0207667_10608442 3300025949 Unclassified 1101
257 Ga0207667_10709732 3300025949 Bacteria 1008
258 Ga0207667_11119292 3300025949 Bacteria 770
259 Ga0207712_10899118 3300025961 Bacteria 782
260 Ga0207668_10529273 3300025972 Unclassified 1018
261 Ga0207640_11308787 3300025981 Bacteria 647
262 Ga0207677_10526072 3300026023 Bacteria 1027
263 Ga0207703_12186395 3300026035 Bacteria 529
264 Ga0207639_10464922 3300026041 Bacteria 1151
265 Ga0207678_10016706 3300026067 Bacteria 6446
266 Ga0207678_10154305 3300026067 Unclassified 1961
267 Ga0207678_10302394 3300026067 Bacteria 1375
268 Ga0207702_11386738 3300026078 Unclassified 697
269 Ga0207641_10128412 3300026088 Unclassified 2273
270 Ga0207641_11810499 3300026088 Unclassified 612
271 Ga0207676_10272631 3300026095 Unclassified 1533
272 Ga0207674_11728222 3300026116 Bacteria 593
273 Ga0207698_10183037 3300026142 Bacteria 1858
274 Ga0207698_10650268 3300026142 Bacteria 1044
275 Ga0207698_12112644 3300026142 Bacteria 577
276 Ga0209281_1001014 3300027111 Bacteria 21986
277 Ga0209281_1030768 3300027111 Bacteria 962
278 Ga0209179_1005096 3300027512 Bacteria 2031
279 Ga0209588_1006853 3300027671 Bacteria 3332
280 Ga0209813_10128285 3300027866 Bacteria 890
281 Ga0207428_10162242 3300027907 Bacteria 1697
282 Ga0265355_1015129 3300028036 Unclassified 651
283 Ga0268266_10262540 3300028379 Bacteria 1601
284 Ga0268265_10000198 3300028380 Bacteria 69954
285 Ga0268265_10404172 3300028380 Bacteria 1263
286 Ga0268265_10689797 3300028380 Bacteria 986
287 Ga0268264_10922490 3300028381 Bacteria 877
288 Ga0268264_12318514 3300028381 Bacteria 544
289 Ga0265319_1001067 3300028563 Bacteria 17103
290 Ga0265318_10016176 3300028577 Bacteria 3086
291 Ga0265323_10115686 3300028653 Bacteria 877
292 Ga0265338_10024689 3300028800 Bacteria 6132
293 Ga0265338_10074052 3300028800 Bacteria 2899
294 Ga0307511_10024179 3300030521 Bacteria 5637
295 Ga0307512_10002240 3300030522 Bacteria 25147
296 Ga0265762_1041039 3300030760 Bacteria 906
297 Ga0265770_1003212 3300030878 Bacteria 2223
298 Ga0265765_1041791 3300030879 Unclassified 610
299 Ga0265760_10010713 3300031090 Unclassified 2618
300 Ga0265330_10000735 3300031235 Bacteria 20673
301 Ga0265330_10030864 3300031235 Bacteria 2403
302 Ga0265330_10049182 3300031235 Unclassified 1853
303 Ga0265332_10066576 3300031238 Bacteria 1537
304 Ga0265320_10005190 3300031240 Bacteria 8403
305 Ga0265325_10006414 3300031241 Bacteria 7136
306 Ga0265340_10446901 3300031247 Bacteria 569
307 Ga0265339_10160372 3300031249 Bacteria 1132
308 Ga0265339_10225129 3300031249 Bacteria 916
309 Ga0265331_10126061 3300031250 Bacteria 1170
310 Ga0265316_10001981 3300031344 Bacteria 21557
311 Ga0265316_10012325 3300031344 Bacteria 7673
312 Ga0265316_10018222 3300031344 Bacteria 6040
313 Ga0265316_10020455 3300031344 Bacteria 5631
314 Ga0265316_10057819 3300031344 Bacteria 3022
315 Ga0265316_10063824 3300031344 Bacteria 2855
316 Ga0307408_100214496 3300031548 Bacteria 1567
317 Ga0265313_10001206 3300031595 Bacteria 24680
318 Ga0316579_10110884 3300031691 Unclassified 1317
319 Ga0316579_10312155 3300031691 Unclassified 760
320 Ga0316579_10664141 3300031691 Bacteria 505
321 Ga0265314_10169774 3300031711 Bacteria 1318
322 Ga0265342_10047265 3300031712 Bacteria 2583
323 Ga0265342_10067092 3300031712 Bacteria 2100
324 Ga0316576_10281989 3300031727 Bacteria 1244
325 Ga0316578_10108650 3300031728 Unclassified 1665
326 Ga0307405_11556046 3300031731 Bacteria 582
327 Ga0316577_10302809 3300031733 Unclassified 906
328 Ga0307410_10373725 3300031852 Bacteria 1145
329 Ga0307407_10439691 3300031903 Bacteria 944
330 Ga0307412_10672119 3300031911 Bacteria 886
331 Ga0315914_1013258 3300031967 Bacteria 9187
332 Ga0307411_10094012 3300032005 Bacteria 2101
333 Ga0307415_100118858 3300032126 Bacteria 1977
334 Ga0307415_101639860 3300032126 Bacteria 619
335 Ga0316580_10137117 3300032139 Bacteria 751
336 Ga0315913_1068154 3300033430 Bacteria 962
337 Ga0315915_1068032 3300033464 Bacteria 962
338 Ga0316212_1031196 3300033547 Unclassified 749
339 Ga0373932_0441510 3300035112 Unclassified 510
340 Ga0373936_0401517 3300035113 Unclassified 629
341 Ga0373954_0684922 3300035118 Unclassified 508
342 Ga0316574_0088578 3300035398 Bacteria 1971
343 Ga0316574_0515389 3300035398 Bacteria 745
344 Ga0373935_0004339 3300035692 Bacteria 8319
345 Ga0373935_0081384 3300035692 Bacteria 2105
346 Ga0373927_0206778 3300035695 Unclassified 1289
347 Ga0373933_0001943 3300035724 Bacteria 11926
348 Ga0373933_0312145 3300035724 Bacteria 1019
349 Ga0373947_0440669 3300035725 Bacteria 882
350 Ga0373937_0028333 3300036401 Bacteria 5067
351 Ga0316584_0078209 3300036712 Unclassified 2477
352 Ga0373925_0030782 3300037068 Bacteria 3940
353 Ga0395900_1598313 3300037418 Unclassified 563
354 Ga0316581_0013787 3300037588 Unclassified 2296
355 Ga0436364_0436140 3300037853 Bacteria 1696
356 Ga0436364_0960317 3300037853 Unclassified 2035
357 Ga0436364_0997962 3300037853 Bacteria 1586
358 Ga0436364_1253029 3300037853 Bacteria 8705
359 Ga0400489_33526 3300039093 Bacteria 2024
360 Ga0436360_0429771 3300039438 Bacteria 2212
361 Ga0436360_0615769 3300039438 Bacteria 870
362 Ga0436361_0036462 3300039447 Bacteria 1521
363 Ga0436361_0651355 3300039447 Bacteria 820
364 Ga0436361_0774915 3300039447 Bacteria 2179
365 Ga0436361_1036084 3300039447 Unclassified 816
366 Ga0436363_0581883 3300039450 Bacteria 1599
367 Ga0436363_1717841 3300039450 Unclassified 889
368 Ga0436362_0764922 3300039453 Unclassified 903
369 Ga0436362_1070300 3300039453 Bacteria 535
370 Ga0439436_0222668 3300041404 Bacteria 543
371 Ga0451807_2421516 3300041486 Bacteria 600
372 Ga0451839_0969563 3300041496 Bacteria 710
373 Ga0439441_062411 3300042001 Bacteria 786
374 Ga0450910_017735 3300042147 Bacteria 1061
375 Ga0450910_038362 3300042147 Bacteria 769
376 Ga0439446_0130399 3300042156 Bacteria 815
377 Ga0450908_025872 3300042184 Bacteria 1024
378 Ga0451577_0009165 3300042876 Bacteria 9547
379 Ga0451577_0016139 3300042876 Bacteria 6923
380 Ga0451577_0017229 3300042876 Bacteria 6679
381 Ga0451577_0181238 3300042876 Bacteria 1899
382 Ga0451577_0277715 3300042876 Bacteria 1517
383 Ga0451577_1405624 3300042876 Bacteria 619
384 Ga0466969_0005083 3300044656 Bacteria 7000
385 Ga0453683_0000145 3300044673 Bacteria 104430
386 Ga0453683_0006802 3300044673 Bacteria 7812
387 Ga0453683_0132130 3300044673 Bacteria 1573
388 Ga0453683_0775814 3300044673 Bacteria 630
389 Ga0466961_0020386 3300044693 Bacteria 4264
390 Ga0466963_0452465 3300044694 Unclassified 906
391 Ga0453684_0000424 3300044712 Bacteria 172336
392 Ga0453684_0012834 3300044712 Bacteria 13731
393 Ga0453684_0042792 3300044712 Bacteria 6099
394 Ga0453684_0052928 3300044712 Bacteria 5303
395 Ga0453684_0086931 3300044712 Bacteria 3877
396 Ga0453684_0280496 3300044712 Unclassified 1900
397 Ga0453684_0333455 3300044712 Bacteria 1715
398 Ga0453684_0389315 3300044712 Bacteria 1564
399 Ga0453684_0415525 3300044712 Bacteria 1504
400 Ga0453684_0535514 3300044712 Bacteria 1292
401 Ga0453684_1045743 3300044712 Bacteria 866
402 Ga0453684_1235821 3300044712 Bacteria 782
403 Ga0453684_2260241 3300044712 Bacteria 542
404 Ga0453684_2338696 3300044712 Bacteria 531
405 Ga0466957_0984649 3300044842 Unclassified 605
406 Ga0466959_0542893 3300045049 Unclassified 784
407 Ga0466959_1093733 3300045049 Bacteria 530
408 Ga0451576_0147741 3300045051 Bacteria 2451
409 Ga0451576_0733909 3300045051 Bacteria 1037
410 Ga0451576_1155358 3300045051 Unclassified 809
411 Ga0451576_1245754 3300045051 Unclassified 776
412 Ga0451576_1601296 3300045051 Bacteria 675
413 Ga0495638_0025975 3300046460 Bacteria 3802
414 Ga0495638_0452679 3300046460 Bacteria 655
415 Ga0495651_0443482 3300046462 Bacteria 840
416 Ga0495580_0038554 3300046472 Bacteria 3421
417 Ga0495580_0170948 3300046472 Unclassified 1503
418 Ga0495632_0402281 3300046519 Bacteria 598
419 Ga0495652_0527205 3300046529 Bacteria 815
420 Ga0495652_0544006 3300046529 Bacteria 799
421 Ga0495621_0051806 3300046539 Bacteria 1470
422 Ga0495625_0571178 3300046660 Bacteria 682
423 Ga0495623_0154414 3300046679 Bacteria 1354
424 Ga0495674_0000095 3300047319 Bacteria 64325
425 Ga0495672_0021252 3300047320 Bacteria 4236
426 Ga0495673_0203238 3300047469 Bacteria 740
427 Ga0495681_0366295 3300047470 Bacteria 545
428 Ga0495686_0004080 3300047472 Bacteria 12188
429 Ga0495602_0342117 3300048088 Unclassified 1082
430 Ga0495602_0493915 3300048088 Bacteria 857
431 Ga0495602_0573596 3300048088 Unclassified 779
432 Ga0495602_0875395 3300048088 Bacteria 599
433 Ga0496101_0049040 3300048904 Unclassified 3036
434 Ga0496102_0085378 3300048905 Bacteria 2914
435 Ga0496107_0241281 3300048910 Unclassified 1345
436 Ga0496110_1897420 3300048913 Unclassified 506
437 Ga0496114_0000012 3300048917 Bacteria 347477
438 Ga0496114_0461844 3300048917 Unclassified 1124
439 Ga0496115_0029491 3300048918 Bacteria 4310
440 Ga0496115_0068969 3300048918 Bacteria 2863
441 Ga0496115_0161535 3300048918 Bacteria 1851
442 Ga0496117_0003038 3300048920 Bacteria 20133
443 Ga0496118_0002834 3300048921 Bacteria 22676
444 Ga0496121_0023186 3300048924 Bacteria 5990
445 Ga0496126_0158690 3300048929 Bacteria 1934
446 Ga0496126_0169633 3300048929 Bacteria 1860
447 Ga0501032_0427745 3300049569 Bacteria 849
448 Ga0501033_0012064 3300049570 Bacteria 6595
449 Ga0501033_0193839 3300049570 Bacteria 1453
450 Ga0501033_0417582 3300049570 Bacteria 934
451 Ga0501033_0650279 3300049570 Unclassified 720
452 Ga0501034_0010837 3300049571 Bacteria 9468
453 Ga0501034_0069917 3300049571 Bacteria 3522
454 Ga0501034_0485368 3300049571 Bacteria 1150
455 Ga0501036_1217493 3300049572 Bacteria 613
456 Ga0501036_1438527 3300049572 Bacteria 558
457 Ga0501036_1583635 3300049572 Unclassified 529
458 Ga0501037_0097717 3300049573 Unclassified 2121
459 Ga0501037_0579084 3300049573 Bacteria 755
460 Ga0501038_0472827 3300049574 Unclassified 961
461 Ga0501040_0449900 3300049576 Unclassified 927
462 Ga0501040_0550317 3300049576 Bacteria 833
463 Ga0501043_0016410 3300049579 Bacteria 5806
464 Ga0501043_0494376 3300049579 Bacteria 914
465 Ga0501043_0936521 3300049579 Bacteria 619
466 Ga0501046_0267950 3300049580 Bacteria 1253
467 Ga0501046_0459863 3300049580 Bacteria 914
468 Ga0501047_0010160 3300049581 Bacteria 8900
469 Ga0501047_0074347 3300049581 Bacteria 3272
470 Ga0501047_0179524 3300049581 Bacteria 1983
471 Ga0501047_0204308 3300049581 Bacteria 1835
472 Ga0501047_0579257 3300049581 Bacteria 945
473 Ga0501047_1136738 3300049581 Bacteria 594
474 Ga0501047_1342572 3300049581 Bacteria 529
475 Ga0501067_0330454 3300049583 Bacteria 849
476 Ga0501068_0276975 3300049584 Unclassified 1072
477 Ga0501068_1109413 3300049584 Bacteria 523
478 Ga0501069_0089498 3300049585 Bacteria 1740
479 Ga0501069_1020010 3300049585 Bacteria 506
480 Ga0501070_0009653 3300049586 Bacteria 8158
481 Ga0501070_0114461 3300049586 Bacteria 2228
482 Ga0501071_0914051 3300049587 Bacteria 677
483 Ga0501072_0906518 3300049588 Unclassified 688
484 Ga0501073_0027891 3300049589 Bacteria 4035
485 Ga0501073_0078193 3300049589 Bacteria 2302
486 Ga0501073_0306795 3300049589 Bacteria 1095
487 Ga0501074_0305222 3300049590 Bacteria 1130
488 Ga0501076_0261682 3300049592 Unclassified 1416
489 Ga0501076_1071282 3300049592 Bacteria 664
490 Ga0501079_0417982 3300049741 Bacteria 1052
491 Ga0501079_0458455 3300049741 Bacteria 1001
492 Ga0501080_0024328 3300049742 Bacteria 5615
493 Ga0501080_0456216 3300049742 Bacteria 1145
494 Ga0501080_0727401 3300049742 Unclassified 874
495 Ga0501081_0025409 3300049743 Unclassified 3983
496 Ga0501081_0676327 3300049743 Bacteria 774
497 Ga0501083_0344661 3300049744 Bacteria 969
498 Ga0501035_0003203 3300049822 Bacteria 15682
499 Ga0501035_0042913 3300049822 Bacteria 4077
500 Ga0501035_0853437 3300049822 Bacteria 724
501 Ga0501035_1318510 3300049822 Bacteria 556
502 Ga0501044_0059971 3300049823 Bacteria 3897
503 nmdc:mga03n38_226765_c1 3300050490 Bacteria 978
504 nmdc:mga03n38_532250_c1 3300050490 Bacteria 663
505 nmdc:mga00v17_455749_c1 3300050491 Bacteria 830
506 nmdc:mga0yw44_380777_c1 3300050492 Bacteria 953
507 nmdc:mga0yw44_491447_c1 3300050492 Bacteria 832
508 nmdc:mga0k408_761209_c1 3300050493 Bacteria 565
509 nmdc:mga06z11_652501_c1 3300050494 Bacteria 641
510 nmdc:mga04h51_150483_c1 3300050495 Bacteria 889
511 nmdc:mga07m45_311812_c1 3300050496 Bacteria 915
512 nmdc:mga05p37_120020_c1 3300050507 Bacteria 3230
513 nmdc:mga05p37_334397_c1 3300050507 Unclassified 1788
514 nmdc:mga05p37_70489_c2 3300050507 Bacteria 1640
515 nmdc:mga05p37_97830_c1 3300050507 Bacteria 3615
516 nmdc:mga09592_190978_c1 3300050508 Bacteria 1773
517 nmdc:mga09592_51624_c1 3300050508 Unclassified 3469
518 nmdc:mga0qj67_120181_c1 3300050509 Unclassified 2125
519 nmdc:mga0qj67_642487_c1 3300050509 Unclassified 847
520 nmdc:mga0qj67_811179_c1 3300050509 Bacteria 740
521 nmdc:mga08y16_275138_c1 3300050511 Bacteria 1738
522 nmdc:mga0n895_13223_c1 3300050512 Bacteria 7437
523 nmdc:mga08x19_31142_c1 3300050514 Bacteria 3354
524 Ga0495595_0030186 3300053084 Bacteria 2430
525 Ga0500651_0057460 3300053093 Bacteria 2435
526 Ga0500572_132677 3300053111 Bacteria 809
527 Ga0500652_289508 3300053131 Bacteria 637
528 Ga0500559_0112035 3300053136 Bacteria 1264
529 Ga0500604_0060001 3300053151 Bacteria 1192
530 Ga0500620_011793 3300053155 Bacteria 2356
531 Ga0500611_014308 3300053727 Bacteria 1381
532 Ga0501084_0179389 3300054114 Bacteria 1788
533 Ga0587066_211011 3300059490 Bacteria 516
534 Ga0587080_034128 3300059503 Bacteria 900
535 Ga0501082_0720555 3300060353 Unclassified 873
536 Ga0501082_0956908 3300060353 Bacteria 749
537 Ga0530510_0076594 3300061734 Bacteria 2430
538 Ga0530510_0360891 3300061734 Bacteria 1092
539 2510307616 2510065057 Bacteria 6649661
540 2513585182 2513237086 Bacteria 7265287
541 2513616959 2513237091 Bacteria 6900273
542 2513884175 2513237140 Bacteria 7076289
543 2513903504 2513237143 Bacteria 6664116
544 2516206420 2516143018 Bacteria 6951533
545 2551679633 2551306084 Bacteria 8942552
546 2551687376 2551306085 Bacteria 7347181
547 2551690203 2551306086 Bacteria 6843938
548 2551700720 2551306087 Bacteria 7351905
549 2551715515 2551306089 Bacteria 7162724
550 2551723029 2551306090 Bacteria 7953713
551 2551726791 2551306091 Bacteria 7086830
552 2551736010 2551306092 Bacteria 6992595
553 2551744713 2551306093 Bacteria 7064773
554 2588518341 2588253730 Bacteria 6881675
555 2844169383 2844163670 Bacteria 7266046
556 2855842649 2855839649 Bacteria 7135830
557 2856323428 2856320880 Bacteria 7263508
558 2858803460 2858800743 Bacteria 6603254
559 2869282907 2869278585 Bacteria 7077053
560 2874142568 2874139085 Bacteria 7021506
561 2899371596 2899370129 Bacteria 6781179
562 2915991163 2915986958 Bacteria 6739310
563 2916007198 2916000859 Bacteria 6865702
564 2916033539 2916028427 Bacteria 6748433
565 2916047015 2916041962 Bacteria 6820487
566 2916052832 2916048683 Bacteria 6543552
567 2916059544 2916055098 Bacteria 6758838
568 2916071219 2916068649 Bacteria 6943657
569 2916078058 2916076590 Bacteria 6596108
570 2921202497 2921201388 Bacteria 6926299
571 2921262127 2921257292 Bacteria 6808382
572 2921288810 2921282425 Bacteria 6826397
573 2921296341 2921289301 Bacteria 7316391
574 2924170222 2924165586 Bacteria 7260590
575 2924191579 2924186466 Bacteria 6876637
576 2924720463 2924718760 Bacteria 6331356
577 2937007594 2937002841 Bacteria 6934057
578 2937024767 2937023124 Bacteria 6815156
579 2937049243 2937042894 Bacteria 6741576
580 2937061421 2937056579 Bacteria 7107896
581 2937069216 2937063883 Bacteria 7199456
582 2937076310 2937071275 Bacteria 6984483
583 2937106250 2937098957 Bacteria 7249374
584 2937121745 2937119839 Bacteria 6597547
585 2937127840 2937126314 Bacteria 6771275
586 2937880815 2937877337 Bacteria 7246526
587 2937977007 2937972304 Bacteria 7532020
588 2957400532 2957395598 Bacteria 6822399
589 2957424471 2957422303 Bacteria 7172205
590 2957435958 2957430029 Bacteria 7022557
591 2957449064 2957443900 Bacteria 6869977
592 2957462785 2957457609 Bacteria 6967680
593 2957467503 2957464669 Bacteria 6568877
594 2957482483 2957478035 Bacteria 6756658
595 2957497289 2957491536 Bacteria 6695180
596 2957504674 2957498199 Bacteria 7126688
597 2957510702 2957505466 Bacteria 7253085
598 2958039690 2958034702 Bacteria 6989922
599 2958052681 2958041894 Bacteria 13082850
600 2958069396 2958064165 Bacteria 7158582
601 2958088629 2958084443 Bacteria 7312792
602 2958093656 2958092219 Bacteria 6861151
603 2958145861 2958144490 Bacteria 6677056
604 2960584330 2960584000 Bacteria 6864594
605 2960609056 2960603979 Bacteria 6898737
606 2960612169 2960610863 Bacteria 6691244
607 2960618178 2960617483 Bacteria 6727748
608 2960629921 2960624210 Bacteria 6875384
609 2960638287 2960637947 Bacteria 7296468
610 2960650756 2960645483 Bacteria 7211087
611 2960665725 2960660292 Bacteria 7041660
612 2960672037 2960667422 Bacteria 6763020
613 2960678016 2960674078 Bacteria 6609048
614 2960693684 2960687367 Bacteria 6535474
615 2964609641 2964607997 Bacteria 7101408
616 2964619693 2964615318 Bacteria 6809089
617 2964626223 2964621998 Bacteria 6834995
618 2964636457 2964636051 Bacteria 7091832
619 2964652697 2964649959 Bacteria 6675118
620 2964672778 2964670856 Bacteria 6851364
621 2964691419 2964685014 Bacteria 6839111
622 2964696564 2964691889 Bacteria 6802758
623 2964702199 2964698721 Bacteria 6765331
624 2964712479 2964705432 Bacteria 7114648
625 2964720233 2964719344 Bacteria 7286602
626 2967670992 2967664464 Bacteria 6948836
627 2967672030 2967671571 Bacteria 7021409
628 2967684871 2967678726 Bacteria 7264382
629 2967705883 2967699805 Bacteria 6854538
630 2967727145 2967721400 Bacteria 7073753
631 2967744117 2967742019 Bacteria 6794534
632 2967749889 2967748971 Bacteria 6733771
633 2967756238 2967755722 Bacteria 6814706
634 2967773793 2967769361 Bacteria 6587838
635 2967778528 2967775926 Bacteria 6738189
636 2968021020 2968016561 Bacteria 7022047
637 2968173266 2968171901 Bacteria 6894245
638 2970026275 2970019648 Bacteria 7072033
639 2970038839 2970033650 Bacteria 7118744
640 2970045684 2970040964 Bacteria 6731123
641 2970052369 2970047711 Bacteria 7088379
642 2970059728 2970054988 Bacteria 6611507
643 2970062311 2970061556 Bacteria 7099761
644 2970075606 2970068827 Bacteria 7123112
645 2970086386 2970082768 Bacteria 6183754
646 2970101813 2970095765 Bacteria 6936963
647 2970106874 2970102677 Bacteria 6812532
648 2970111446 2970109326 Bacteria 6863976
649 2970121499 2970116247 Bacteria 6501857
650 2970138144 2970136068 Bacteria 7207982
651 2970154407 2970149975 Bacteria 6779706
652 2970157581 2970156795 Bacteria 7168044
653 2970176838 2970170962 Bacteria 6876229
654 2970180217 2970177841 Bacteria 6768001
655 2970189605 2970184632 Bacteria 7054431
656 2970196884 2970191845 Bacteria 7032787
657 2970474317 2970469710 Bacteria 6969209
658 2970597516 2970593180 Bacteria 7073582
659 2977553313 2977551784 Bacteria 7125765
660 2977565497 2977558990 Bacteria 6863948
661 2977585476 2977579622 Bacteria 6772100
662 2996313460 2996310559 Bacteria 6357320
663 2996352347 2996348954 Bacteria 7239054
664 3004279029 3004275668 Bacteria 7114440
665 648737089 648276728 Bacteria 6968865
666 8003995231 8003992118 Bacteria 7266902
667 Ga0496105_0816038
668 JGI24736J21556_1008296
669 JGI25156J39149_1004137
670 rootH2_10140073
671 Ga0070658_10029533
672 Ga0070658_10111282
673 Ga0070676_10080216
674 Ga0070690_100044755
675 Ga0068869_100618299
676 Ga0068869_101752903
677 Ga0070666_10487625
678 Ga0070666_10738880
679 Ga0070666_11410774
680 Ga0070680_100071512
681 Ga0070680_100219124
682 Ga0070680_100733191
683 Ga0070680_101751706
684 Ga0070660_100295796
685 Ga0070660_100300667
686 Ga0070660_100389834
687 Ga0070660_101514580
688 Ga0070691_10753987
689 Ga0070687_100001429
690 Ga0070661_100179512
691 Ga0070668_100698893
692 Ga0070668_101533677
693 Ga0070669_100000032
694 Ga0070675_100462769
695 Ga0070671_100805427
696 Ga0070674_100277158
697 Ga0070673_100165568
698 Ga0070688_100668158
699 Ga0070667_101002367
700 Ga0070709_10565806
701 Ga0070714_100215817
702 Ga0070714_101910101
703 Ga0070710_10242490
704 Ga0070705_100196445
705 Ga0070694_100646778
706 Ga0070708_100005613
707 Ga0070708_101236616
708 Ga0070663_100083304
709 Ga0070663_100113711
710 Ga0070662_100215642
711 Ga0070662_101455766
712 Ga0070681_10345645
713 Ga0070681_10593793
714 Ga0068867_100312591
715 Ga0070685_10002795
716 Ga0070706_100100035
717 Ga0070706_100386171
718 Ga0070706_100615930
719 Ga0070707_100005144
720 Ga0070707_101063757
721 Ga0070698_100058065
722 Ga0070698_100161663
723 Ga0070699_100004729
724 Ga0070699_100039464
725 Ga0070699_100043917
726 Ga0070699_101827033
727 Ga0070679_100051217
728 Ga0070679_100072561
729 Ga0070697_100000024
730 Ga0070697_100006874
731 Ga0070697_100160705
732 Ga0070697_101013790
733 Ga0070672_100118109
734 Ga0070686_100315050
735 Ga0070686_100356617
736 Ga0070696_100205935
737 Ga0070693_100043030
738 Ga0070693_100067586
739 Ga0068855_100454500
740 Ga0068855_101722740
741 Ga0068857_100238285
742 Ga0068857_101882338
743 Ga0068854_101052213
744 Ga0070702_100218203
745 Ga0068852_100166198
746 Ga0068852_102167579
747 Ga0068859_100364895
748 Ga0068859_100744970
749 Ga0068859_101944463
750 Ga0068864_100150829
751 Ga0068864_100967142
752 Ga0068866_10998820
753 Ga0068863_100176349
754 Ga0068858_100186949
755 Ga0068860_101686505
756 Ga0068862_100000656
757 Ga0068862_100180732
758 Ga0068862_100663745
759 Ga0081539_10214275
760 Ga0070717_10007144
761 Ga0070717_10032626
762 Ga0070717_10600793
763 Ga0070717_10671726
764 Ga0075365_10232139
765 Ga0075368_10102103
766 Ga0075368_10123666
767 Ga0075363_100137793
768 Ga0075364_10051616
769 Ga0075366_10460075
770 Ga0097621_100842649
771 Ga0097621_101387351
772 Ga0075370_10197737
773 Ga0068871_100625238
774 Ga0068871_101992262
775 Ga0075428_100020006
776 Ga0075430_100097591
777 Ga0075430_100869096
778 Ga0075431_101532300
779 Ga0075434_100214827
780 Ga0075429_100088637
781 Ga0097620_100364902
782 Ga0097620_100744935
783 Ga0097620_101944439
784 Ga0079104_1100989
785 Ga0099826_10534717
786 Ga0075435_100111188
787 Ga0099794_10046233
788 Ga0099794_10485340
789 Ga0099795_10018180
790 Ga0099795_10074479
791 Ga0099795_10092130
792 Ga0099795_10101865
793 Ga0105240_10001953
794 Ga0105240_10007273
795 Ga0105240_10128908
796 Ga0105240_10320247
797 Ga0105240_10591000
798 Ga0105240_12814072
799 Ga0105245_10188755
800 Ga0105247_11470215
801 Ga0114129_10078068
802 Ga0114129_10182262
803 Ga0105243_10769108
804 Ga0105241_10076081
805 Ga0105241_12534398
806 Ga0105242_10132635
807 Ga0105237_10045121
808 Ga0105237_10190548
809 Ga0105238_10033929
810 Ga0105238_10466872
811 Ga0105238_12192553
812 Ga0105238_12511927
813 Ga0105249_10045431
814 Ga0105249_12111300
815 Ga0099796_10011962
816 Ga0099796_10057011
817 Ga0099796_10232664
818 Ga0105239_10057310
819 Ga0105239_10970936
820 Ga0105239_11678571
821 Ga0105239_11678883
822 Ga0105239_12642703
823 Ga0157373_10145644
824 Ga0157373_10146601
825 Ga0157373_10359195
826 Ga0157370_10001444
827 Ga0157370_10190524
828 Ga0157370_10840019
829 Ga0157370_10881160
830 Ga0157369_10150443
831 Ga0157369_10329279
832 Ga0157369_12142198
833 Ga0157374_10060987
834 Ga0157374_10124562
835 Ga0157374_10270521
836 Ga0157378_10015503
837 Ga0157378_12108735
838 Ga0163162_11295111
839 Ga0163162_12634399
840 Ga0157372_10000393
841 Ga0157372_10026071
842 Ga0157372_10073054
843 Ga0157372_10293299
844 Ga0157375_10000015
845 Ga0157375_10301597
846 Ga0157375_11398670
847 Ga0157375_11594025
848 Ga0163163_10184593
849 Ga0157380_10091158
850 Ga0157379_11424933
851 Ga0157376_10101432
852 Ga0197907_11005704
853 Ga0206354_10664665
854 Ga0206353_11678336
855 Ga0213872_10003766
856 Ga0213875_10010746
857 Ga0224712_10004707
858 Ga0228710_1000815
859 Ga0207692_10170788
860 Ga0207680_10444568
861 Ga0207680_10516550
862 Ga0207680_11246462
863 Ga0207699_10228731
864 Ga0207705_10095404
865 Ga0207705_10105570
866 Ga0207705_10345522
867 Ga0207705_10737370
868 Ga0207684_10010487
869 Ga0207684_10027441
870 Ga0207654_10104346
871 Ga0207707_10010965
872 Ga0207707_10140463
873 Ga0207707_10177432
874 Ga0207707_10550771
875 Ga0207707_10881101
876 Ga0207695_10000002
877 Ga0207695_10000007
878 Ga0207695_10046981
879 Ga0207695_10500539
880 Ga0207671_10056276
881 Ga0207671_10145411
882 Ga0207671_10368805
883 Ga0207660_10168617
884 Ga0207660_10239019
885 Ga0207660_10874254
886 Ga0207660_11382169
887 Ga0207662_10008029
888 Ga0207657_10015583
889 Ga0207657_10114418
890 Ga0207657_10416455
891 Ga0207649_10312390
892 Ga0207649_10538781
893 Ga0207652_10078630
894 Ga0207652_10152356
895 Ga0207652_10722008
896 Ga0207646_10003637
897 Ga0207646_10190020
898 Ga0207646_10423197
899 Ga0207694_10000425
900 Ga0207694_10597880
901 Ga0207694_11590715
902 Ga0207659_10009721
903 Ga0207687_10547332
904 Ga0207700_10587495
905 Ga0207664_10167685
906 Ga0207664_11241968
907 Ga0207664_11286109
908 Ga0207644_11862804
909 Ga0207690_10101084
910 Ga0207706_10489880
911 Ga0207686_10109101
912 Ga0207709_10009064
913 Ga0207669_10468771
914 Ga0207691_10131169
915 Ga0207689_10007384
916 Ga0207689_11353286
917 Ga0207661_10002064
918 Ga0207661_10427081
919 Ga0207661_10561024
920 Ga0207667_10068857
921 Ga0207667_10200730
922 Ga0207667_10608442
923 Ga0207667_10709732
924 Ga0207667_11119292
925 Ga0207712_10899118
926 Ga0207668_10529273
927 Ga0207640_11308787
928 Ga0207677_10526072
929 Ga0207703_12186395
930 Ga0207639_10464922
931 Ga0207678_10016706
932 Ga0207678_10154305
933 Ga0207678_10302394
934 Ga0207702_11386738
935 Ga0207641_10128412
936 Ga0207641_11810499
937 Ga0207676_10272631
938 Ga0207674_11728222
939 Ga0207698_10183037
940 Ga0207698_10650268
941 Ga0207698_12112644
942 Ga0209281_1001014
943 Ga0209281_1030768
944 Ga0209179_1005096
945 Ga0209588_1006853
946 Ga0209813_10128285
947 Ga0207428_10162242
948 Ga0265355_1015129
949 Ga0268266_10262540
950 Ga0268265_10000198
951 Ga0268265_10404172
952 Ga0268265_10689797
953 Ga0268264_10922490
954 Ga0268264_12318514
955 Ga0265319_1001067
956 Ga0265318_10016176
957 Ga0265323_10115686
958 Ga0265338_10024689
959 Ga0265338_10074052
960 Ga0307511_10024179
961 Ga0307512_10002240
962 Ga0265762_1041039
963 Ga0265770_1003212
964 Ga0265765_1041791
965 Ga0265760_10010713
966 Ga0265330_10000735
967 Ga0265330_10030864
968 Ga0265330_10049182
969 Ga0265332_10066576
970 Ga0265320_10005190
971 Ga0265325_10006414
972 Ga0265340_10446901
973 Ga0265339_10160372
974 Ga0265339_10225129
975 Ga0265331_10126061
976 Ga0265316_10001981
977 Ga0265316_10012325
978 Ga0265316_10018222
979 Ga0265316_10020455
980 Ga0265316_10057819
981 Ga0265316_10063824
982 Ga0307408_100214496
983 Ga0265313_10001206
984 Ga0316579_10110884
985 Ga0316579_10312155
986 Ga0316579_10664141
987 Ga0265314_10169774
988 Ga0265342_10047265
989 Ga0265342_10067092
990 Ga0316576_10281989
991 Ga0316578_10108650
992 Ga0307405_11556046
993 Ga0316577_10302809
994 Ga0307410_10373725
995 Ga0307407_10439691
996 Ga0307412_10672119
997 Ga0315914_1013258
998 Ga0307411_10094012
999 Ga0307415_100118858
1000 Ga0307415_101639860
1001 Ga0316580_10137117
1002 Ga0315913_1068154
1003 Ga0315915_1068032
1004 Ga0316212_1031196
1005 Ga0373932_0441510
1006 Ga0373936_0401517
1007 Ga0373954_0684922
1008 Ga0316574_0088578
1009 Ga0316574_0515389
1010 Ga0373935_0004339
1011 Ga0373935_0081384
1012 Ga0373927_0206778
1013 Ga0373933_0001943
1014 Ga0373933_0312145
1015 Ga0373947_0440669
1016 Ga0373937_0028333
1017 Ga0316584_0078209
1018 Ga0373925_0030782
1019 Ga0395900_1598313
1020 Ga0316581_0013787
1021 Ga0436364_0436140
1022 Ga0436364_0960317
1023 Ga0436364_0997962
1024 Ga0436364_1253029
1025 Ga0400489_33526
1026 Ga0436360_0429771
1027 Ga0436360_0615769
1028 Ga0436361_0036462
1029 Ga0436361_0651355
1030 Ga0436361_0774915
1031 Ga0436361_1036084
1032 Ga0436363_0581883
1033 Ga0436363_1717841
1034 Ga0436362_0764922
1035 Ga0436362_1070300
1036 Ga0439436_0222668
1037 Ga0451807_2421516
1038 Ga0451839_0969563
1039 Ga0439441_062411
1040 Ga0450910_017735
1041 Ga0450910_038362
1042 Ga0439446_0130399
1043 Ga0450908_025872
1044 Ga0451577_0009165
1045 Ga0451577_0016139
1046 Ga0451577_0017229
1047 Ga0451577_0181238
1048 Ga0451577_0277715
1049 Ga0451577_1405624
1050 Ga0466969_0005083
1051 Ga0453683_0000145
1052 Ga0453683_0006802
1053 Ga0453683_0132130
1054 Ga0453683_0775814
1055 Ga0466961_0020386
1056 Ga0466963_0452465
1057 Ga0453684_0000424
1058 Ga0453684_0012834
1059 Ga0453684_0042792
1060 Ga0453684_0052928
1061 Ga0453684_0086931
1062 Ga0453684_0280496
1063 Ga0453684_0333455
1064 Ga0453684_0389315
1065 Ga0453684_0415525
1066 Ga0453684_0535514
1067 Ga0453684_1045743
1068 Ga0453684_1235821
1069 Ga0453684_2260241
1070 Ga0453684_2338696
1071 Ga0466957_0984649
1072 Ga0466959_0542893
1073 Ga0466959_1093733
1074 Ga0451576_0147741
1075 Ga0451576_0733909
1076 Ga0451576_1155358
1077 Ga0451576_1245754
1078 Ga0451576_1601296
1079 Ga0495638_0025975
1080 Ga0495638_0452679
1081 Ga0495651_0443482
1082 Ga0495580_0038554
1083 Ga0495580_0170948
1084 Ga0495632_0402281
1085 Ga0495652_0527205
1086 Ga0495652_0544006
1087 Ga0495621_0051806
1088 Ga0495625_0571178
1089 Ga0495623_0154414
1090 Ga0495674_0000095
1091 Ga0495672_0021252
1092 Ga0495673_0203238
1093 Ga0495681_0366295
1094 Ga0495686_0004080
1095 Ga0495602_0342117
1096 Ga0495602_0493915
1097 Ga0495602_0573596
1098 Ga0495602_0875395
1099 Ga0496101_0049040
1100 Ga0496102_0085378
1101 Ga0496107_0241281
1102 Ga0496110_1897420
1103 Ga0496114_0000012
1104 Ga0496114_0461844
1105 Ga0496115_0029491
1106 Ga0496115_0068969
1107 Ga0496115_0161535
1108 Ga0496117_0003038
1109 Ga0496118_0002834
1110 Ga0496121_0023186
1111 Ga0496126_0158690
1112 Ga0496126_0169633
1113 Ga0501032_0427745
1114 Ga0501033_0012064
1115 Ga0501033_0193839
1116 Ga0501033_0417582
1117 Ga0501033_0650279
1118 Ga0501034_0010837
1119 Ga0501034_0069917
1120 Ga0501034_0485368
1121 Ga0501036_1217493
1122 Ga0501036_1438527
1123 Ga0501036_1583635
1124 Ga0501037_0097717
1125 Ga0501037_0579084
1126 Ga0501038_0472827
1127 Ga0501040_0449900
1128 Ga0501040_0550317
1129 Ga0501043_0016410
1130 Ga0501043_0494376
1131 Ga0501043_0936521
1132 Ga0501046_0267950
1133 Ga0501046_0459863
1134 Ga0501047_0010160
1135 Ga0501047_0074347
1136 Ga0501047_0179524
1137 Ga0501047_0204308
1138 Ga0501047_0579257
1139 Ga0501047_1136738
1140 Ga0501047_1342572
1141 Ga0501067_0330454
1142 Ga0501068_0276975
1143 Ga0501068_1109413
1144 Ga0501069_0089498
1145 Ga0501069_1020010
1146 Ga0501070_0009653
1147 Ga0501070_0114461
1148 Ga0501071_0914051
1149 Ga0501072_0906518
1150 Ga0501073_0027891
1151 Ga0501073_0078193
1152 Ga0501073_0306795
1153 Ga0501074_0305222
1154 Ga0501076_0261682
1155 Ga0501076_1071282
1156 Ga0501079_0417982
1157 Ga0501079_0458455
1158 Ga0501080_0024328
1159 Ga0501080_0456216
1160 Ga0501080_0727401
1161 Ga0501081_0025409
1162 Ga0501081_0676327
1163 Ga0501083_0344661
1164 Ga0501035_0003203
1165 Ga0501035_0042913
1166 Ga0501035_0853437
1167 Ga0501035_1318510
1168 Ga0501044_0059971
1169 nmdc:mga03n38_226765_c1
1170 nmdc:mga03n38_532250_c1
1171 nmdc:mga00v17_455749_c1
1172 nmdc:mga0yw44_380777_c1
1173 nmdc:mga0yw44_491447_c1
1174 nmdc:mga0k408_761209_c1
1175 nmdc:mga06z11_652501_c1
1176 nmdc:mga04h51_150483_c1
1177 nmdc:mga07m45_311812_c1
1178 nmdc:mga05p37_120020_c1
1179 nmdc:mga05p37_334397_c1
1180 nmdc:mga05p37_70489_c2
1181 nmdc:mga05p37_97830_c1
1182 nmdc:mga09592_190978_c1
1183 nmdc:mga09592_51624_c1
1184 nmdc:mga0qj67_120181_c1
1185 nmdc:mga0qj67_642487_c1
1186 nmdc:mga0qj67_811179_c1
1187 nmdc:mga08y16_275138_c1
1188 nmdc:mga0n895_13223_c1
1189 nmdc:mga08x19_31142_c1
1190 Ga0495595_0030186
1191 Ga0500651_0057460
1192 Ga0500572_132677
1193 Ga0500652_289508
1194 Ga0500559_0112035
1195 Ga0500604_0060001
1196 Ga0500620_011793
1197 Ga0500611_014308
1198 Ga0501084_0179389
1199 Ga0587066_211011
1200 Ga0587080_034128
1201 Ga0501082_0720555
1202 Ga0501082_0956908
1203 Ga0530510_0076594
1204 Ga0530510_0360891
1205 2510307616
1206 2513585182
1207 2513616959
1208 2513884175
1209 2513903504
1210 2516206420
1211 2551679633
1212 2551687376
1213 2551690203
1214 2551700720
1215 2551715515
1216 2551723029
1217 2551726791
1218 2551736010
1219 2551744713
1220 2588518341
1221 2844169383
1222 2855842649
1223 2856323428
1224 2858803460
1225 2869282907
1226 2874142568
1227 2899371596
1228 2915991163
1229 2916007198
1230 2916033539
1231 2916047015
1232 2916052832
1233 2916059544
1234 2916071219
1235 2916078058
1236 2921202497
1237 2921262127
1238 2921288810
1239 2921296341
1240 2924170222
1241 2924191579
1242 2924720463
1243 2937007594
1244 2937024767
1245 2937049243
1246 2937061421
1247 2937069216
1248 2937076310
1249 2937106250
1250 2937121745
1251 2937127840
1252 2937880815
1253 2937977007
1254 2957400532
1255 2957424471
1256 2957435958
1257 2957449064
1258 2957462785
1259 2957467503
1260 2957482483
1261 2957497289
1262 2957504674
1263 2957510702
1264 2958039690
1265 2958052681
1266 2958069396
1267 2958088629
1268 2958093656
1269 2958145861
1270 2960584330
1271 2960609056
1272 2960612169
1273 2960618178
1274 2960629921
1275 2960638287
1276 2960650756
1277 2960665725
1278 2960672037
1279 2960678016
1280 2960693684
1281 2964609641
1282 2964619693
1283 2964626223
1284 2964636457
1285 2964652697
1286 2964672778
1287 2964691419
1288 2964696564
1289 2964702199
1290 2964712479
1291 2964720233
1292 2967670992
1293 2967672030
1294 2967684871
1295 2967705883
1296 2967727145
1297 2967744117
1298 2967749889
1299 2967756238
1300 2967773793
1301 2967778528
1302 2968021020
1303 2968173266
1304 2970026275
1305 2970038839
1306 2970045684
1307 2970052369
1308 2970059728
1309 2970062311
1310 2970075606
1311 2970086386
1312 2970101813
1313 2970106874
1314 2970111446
1315 2970121499
1316 2970138144
1317 2970154407
1318 2970157581
1319 2970176838
1320 2970180217
1321 2970189605
1322 2970196884
1323 2970474317
1324 2970597516
1325 2977553313
1326 2977565497
1327 2977585476
1328 2996313460
1329 2996352347
1330 3004279029
1331 648737089
1332 8003995231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

20

108

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9358 1 92
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9305 1 91
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9262 1 92
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9242 1 92
6f8s-assembly1.cif.gz_D toxin-antitoxin complex grata 0.9212 25 92
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8993 1 92 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8911 2 90 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8901 1 92 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8818 2 90 3.30.2310.20
af_A0A0P0XRK1_75_338_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7177 63 90 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A4R2MMH4-F1-model_v4 deleted 0.9986 1 92
AF-T0ZM08-F1-model_v4 Plasmid maintenance system killer 0.9977 2 92
AF-A0A6P1E8X9-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9951 1 77
AF-A0A838LSA4-F1-model_v4 Excinuclease ABC subunit A 0.9941 1 92
AF-A0A2G2MX15-F1-model_v4 Excinuclease ABC subunit A 0.9937 1 92

Map