F473791

General Info

Members Datasets Scaffolds Average Seq Length
666 428 1332 307

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0044906|Ga0373924_0044906_603_1658
Length 351
Sequence LRTEYAETRCRGSASFQQSNDGTLARSEDVMITIRLLARAYRTLWPRAAALMMAGTVALLTAASAVEAQQSYETPDEAAAALVSAVRADDQNAELAVLGPDSDDIISSGDKVSDDAIRERFLESYDAKHQITTNGDSKAILVIGDNDYPFPIPLIRKAGKWSFDTEEGRREILYRRIGRNELDAIQVCLAYVDAQDEYAEKDRTGAGAGVYAEHFISNPGKKDGLYWPIAQGDEESPLGELFAKASEEGYKADEGRSPYHGYYYKIITKQGPHADGGAANYVVNGKMIGGFALVAYPAEYRNSGVVTFIVNHTGAVFQKDLGPDTAKLAEKISSFDPDSTWKKVDVTEPAK

Samples

Sample ID Description Type Environment
1 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
107 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
108 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
109 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
168 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
319 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
320 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
321 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
322 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
323 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
327 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
328 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
331 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
337 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
338 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
339 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
340 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
341 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
342 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
343 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
344 2643221733 Bosea sp. Root381 Isolate Unclassified
345 2643221734 Bosea sp. Root670 Isolate Unclassified
346 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
347 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
348 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
349 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
350 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
351 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
352 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
353 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
354 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
355 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
356 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
357 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
358 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
359 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
360 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
361 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
362 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
363 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
364 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
365 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
366 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
367 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
368 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
369 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
370 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
371 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
372 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
373 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
374 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
375 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
376 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
377 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
378 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
379 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
380 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
381 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
382 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
383 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
384 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
385 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
386 2922368715
387 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
388 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
389 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
390 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
391 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
392 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
393 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
394 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
395 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
396 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
397 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
398 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
399 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
400 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
401 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
402 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
403 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
404 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
405 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
406 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
407 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
408 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
409 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
410 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
411 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
412 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
413 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
414 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
415 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
416 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
417 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
418 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
419 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
420 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
421 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
422 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
423 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
424 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
425 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
426 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
427 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
428 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.17
Metatranscriptomes 0
Isolates 13.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.01
Nodule 12.01
Rhizoplane 7.06
Rhizosphere 64.11
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373924_0044906 3300035410 Bacteria 1817
2 JGI25153J46596_10000390 3300003215 Bacteria 29780
3 JGI25153J46596_10038032 3300003215 Bacteria 1523
4 rootH1_10170955 3300003323 Bacteria 3034
5 JGI25404J52841_10016646 3300003659 Bacteria 1595
6 Ga0055526_1000276 3300003771 Bacteria 43379
7 Ga0055531_10007394 3300003794 Bacteria 6010
8 Ga0055543_1009344 3300004625 Bacteria 2112
9 Ga0065165_1000162 3300005262 Bacteria 116822
10 Ga0065165_1000972 3300005262 Bacteria 35758
11 Ga0065165_1003380 3300005262 Bacteria 11292
12 Ga0070658_10001973 3300005327 Bacteria 17251
13 Ga0070676_10012317 3300005328 Bacteria 4663
14 Ga0070690_100004250 3300005330 Bacteria 7932
15 Ga0070670_100004244 3300005331 Bacteria 11990
16 Ga0070670_100034519 3300005331 Bacteria 4352
17 Ga0068869_100284260 3300005334 Bacteria 1331
18 Ga0070666_10232655 3300005335 Bacteria 1302
19 Ga0070680_100155829 3300005336 Bacteria 1919
20 Ga0070682_100344943 3300005337 Bacteria 1108
21 Ga0068868_100229908 3300005338 Bacteria 1556
22 Ga0070689_100003813 3300005340 Bacteria 10101
23 Ga0070689_100012317 3300005340 Bacteria 6157
24 Ga0070689_100027796 3300005340 Bacteria 4267
25 Ga0070687_100008590 3300005343 Bacteria 4335
26 Ga0070687_100105054 3300005343 Bacteria 1589
27 Ga0070661_100216014 3300005344 Bacteria 1469
28 Ga0070668_100006824 3300005347 Bacteria 8464
29 Ga0070668_100021888 3300005347 Bacteria 4829
30 Ga0070669_100249406 3300005353 Bacteria 1413
31 Ga0070675_100074705 3300005354 Bacteria 2817
32 Ga0070675_100305922 3300005354 Bacteria 1401
33 Ga0070671_100011647 3300005355 Bacteria 7074
34 Ga0070671_100047982 3300005355 Bacteria 3551
35 Ga0070673_100092692 3300005364 Bacteria 2472
36 Ga0070673_100152237 3300005364 Bacteria 1960
37 Ga0070673_100221278 3300005364 Bacteria 1638
38 Ga0070688_100008648 3300005365 Bacteria 5540
39 Ga0070688_100046287 3300005365 Bacteria 2693
40 Ga0070659_100202645 3300005366 Bacteria 1634
41 Ga0070667_100046590 3300005367 Bacteria 3648
42 Ga0070667_100238894 3300005367 Bacteria 1622
43 Ga0070709_10006294 3300005434 Bacteria 6465
44 Ga0070714_100304465 3300005435 Bacteria 1487
45 Ga0070714_100436656 3300005435 Bacteria 1242
46 Ga0070713_100070782 3300005436 Bacteria 2945
47 Ga0070713_100076679 3300005436 Bacteria 2840
48 Ga0070711_100199628 3300005439 Unclassified 1542
49 Ga0070705_100297350 3300005440 Unclassified 1155
50 Ga0070663_100031636 3300005455 Bacteria 3638
51 Ga0070663_100058899 3300005455 Bacteria 2759
52 Ga0070663_100085868 3300005455 Bacteria 2323
53 Ga0070663_100168361 3300005455 Bacteria 1692
54 Ga0070678_100025500 3300005456 Bacteria 3978
55 Ga0070678_100221388 3300005456 Bacteria 1573
56 Ga0070662_100097943 3300005457 Bacteria 2214
57 Ga0070662_100178835 3300005457 Bacteria 1671
58 Ga0070685_10008342 3300005466 Bacteria 5317
59 Ga0070685_10269344 3300005466 Bacteria 1136
60 Ga0070707_100010889 3300005468 Bacteria 8471
61 Ga0070707_100270325 3300005468 Unclassified 1653
62 Ga0070698_100178049 3300005471 Bacteria 2065
63 Ga0070679_100086844 3300005530 Bacteria 3115
64 Ga0070684_100010914 3300005535 Bacteria 7218
65 Ga0070684_100454132 3300005535 Bacteria 1184
66 Ga0070697_100440636 3300005536 Bacteria 1134
67 Ga0070672_100065814 3300005543 Bacteria 2868
68 Ga0070672_100382360 3300005543 Bacteria 1204
69 Ga0070665_100036707 3300005548 Bacteria 4928
70 Ga0070665_100051023 3300005548 Bacteria 4150
71 Ga0070665_100063054 3300005548 Bacteria 3717
72 Ga0070665_100538302 3300005548 Bacteria 1180
73 Ga0070665_100565473 3300005548 Bacteria 1150
74 Ga0070704_100007779 3300005549 Bacteria 6390
75 Ga0068855_100363658 3300005563 Bacteria 1592
76 Ga0070664_100128179 3300005564 Bacteria 2227
77 Ga0070664_100223252 3300005564 Bacteria 1686
78 Ga0070664_100338684 3300005564 Bacteria 1366
79 Ga0068857_100059686 3300005577 Bacteria 3389
80 Ga0068854_100055097 3300005578 Bacteria 2861
81 Ga0068856_100197765 3300005614 Bacteria 2024
82 Ga0068856_100291468 3300005614 Bacteria 1649
83 Ga0068852_100067461 3300005616 Bacteria 3127
84 Ga0068859_100027315 3300005617 Bacteria 5724
85 Ga0068859_100155172 3300005617 Bacteria 2366
86 Ga0068859_100530005 3300005617 Bacteria 1273
87 Ga0068864_100050814 3300005618 Bacteria 3569
88 Ga0068864_100101994 3300005618 Bacteria 2546
89 Ga0068864_100525040 3300005618 Unclassified 1142
90 Ga0068861_100055107 3300005719 Bacteria 3031
91 Ga0068861_100146007 3300005719 Bacteria 1936
92 Ga0068861_100364892 3300005719 Bacteria 1271
93 Ga0068863_100178908 3300005841 Bacteria 2036
94 Ga0068863_100267974 3300005841 Bacteria 1652
95 Ga0068858_100039121 3300005842 Plasmid 4399
96 Ga0068860_100039680 3300005843 Bacteria 4503
97 Ga0068862_100102296 3300005844 Bacteria 2508
98 Ga0068862_100119747 3300005844 Bacteria 2319
99 Ga0081455_10034139 3300005937 Bacteria 4561
100 Ga0081540_1000022 3300005983 Bacteria 161205
101 Ga0081540_1001334 3300005983 Bacteria 21502
102 Ga0081539_10063113 3300005985 Bacteria 2023
103 Ga0070717_10000933 3300006028 Bacteria 19493
104 Ga0070717_10018082 3300006028 Bacteria 5499
105 Ga0070717_10019388 3300006028 Bacteria 5332
106 Ga0075365_10046462 3300006038 Bacteria 2852
107 Ga0075365_10048558 3300006038 Bacteria 2794
108 Ga0075365_10100805 3300006038 Bacteria 1977
109 Ga0075368_10044292 3300006042 Bacteria 1755
110 Ga0075363_100099355 3300006048 Bacteria 1609
111 Ga0070716_100033348 3300006173 Bacteria 2816
112 Ga0070716_100309000 3300006173 Bacteria 1103
113 Ga0070712_100014848 3300006175 Bacteria 5005
114 Ga0070712_100211967 3300006175 Bacteria 1528
115 Ga0075362_10003733 3300006177 Bacteria 5383
116 Ga0075367_10031447 3300006178 Bacteria 3048
117 Ga0075367_10089996 3300006178 Bacteria 1866
118 Ga0075367_10196460 3300006178 Bacteria 1260
119 Ga0075369_10041337 3300006186 Bacteria 1973
120 Ga0075427_10008733 3300006194 Bacteria 1506
121 Ga0075366_10055676 3300006195 Bacteria 2349
122 Ga0075366_10186341 3300006195 Bacteria 1261
123 Ga0075370_10024147 3300006353 Bacteria 3355
124 Ga0068871_100407347 3300006358 Bacteria 1212
125 Ga0068871_100424417 3300006358 Bacteria 1188
126 Ga0075433_10067956 3300006852 Bacteria 3127
127 Ga0075434_100040192 3300006871 Bacteria 4633
128 Ga0075434_100100746 3300006871 Bacteria 2895
129 Ga0075434_100122954 3300006871 Bacteria 2611
130 Ga0075434_100625865 3300006871 Bacteria 1095
131 Ga0097620_100027315 3300006931 Bacteria 5724
132 Ga0097620_100155167 3300006931 Bacteria 2366
133 Ga0097620_100529986 3300006931 Bacteria 1273
134 Ga0099824_1015433 3300006942 Bacteria 7230
135 Ga0075435_100015880 3300007076 Bacteria 5667
136 Ga0075435_100243249 3300007076 Unclassified 1531
137 Ga0099794_10000601 3300007265 Bacteria 12042
138 Ga0099795_10046724 3300007788 Bacteria 1561
139 Ga0105240_10005091 3300009093 Bacteria 19694
140 Ga0105240_10020973 3300009093 Bacteria 8696
141 Ga0105240_10107104 3300009093 Bacteria 3390
142 Ga0105245_10246132 3300009098 Bacteria 1735
143 Ga0105245_10359380 3300009098 Bacteria 1445
144 Ga0105245_10426496 3300009098 Bacteria 1330
145 Ga0105247_10026250 3300009101 Bacteria 3516
146 Ga0105247_10057668 3300009101 Bacteria 2401
147 Ga0114129_10003291 3300009147 Bacteria 22689
148 Ga0105243_10178095 3300009148 Unclassified 1847
149 Ga0105241_10043674 3300009174 Bacteria 3395
150 Ga0105241_10175424 3300009174 Unclassified 1774
151 Ga0105242_10393412 3300009176 Bacteria 1291
152 Ga0105248_10012024 3300009177 Bacteria 9545
153 Ga0105248_10118023 3300009177 Bacteria 2992
154 Ga0105248_10210447 3300009177 Bacteria 2191
155 Ga0105248_10545204 3300009177 Bacteria 1308
156 Ga0105248_10609133 3300009177 Bacteria 1232
157 Ga0105237_10021753 3300009545 Bacteria 6588
158 Ga0105237_10050721 3300009545 Bacteria 4169
159 Ga0105237_10473722 3300009545 Bacteria 1258
160 Ga0105238_10031928 3300009551 Bacteria 5358
161 Ga0105249_10058705 3300009553 Bacteria 3526
162 Ga0105249_10127997 3300009553 Bacteria 2420
163 Ga0105249_10129598 3300009553 Bacteria 2406
164 Ga0105249_10554978 3300009553 Bacteria 1200
165 Ga0099796_10000200 3300010159 Bacteria 9170
166 Ga0105239_10027794 3300010375 Bacteria 6224
167 Ga0105239_10074034 3300010375 Bacteria 3744
168 Ga0105239_10128571 3300010375 Bacteria 2816
169 Ga0105239_10243192 3300010375 Bacteria 2020
170 Ga0105246_10196668 3300011119 Bacteria 1564
171 Ga0157370_10064785 3300013104 Bacteria 3459
172 Ga0171462_1006 3300013250 Bacteria 432986
173 Ga0157374_10039259 3300013296 Bacteria 4357
174 Ga0157374_10128916 3300013296 Bacteria 2447
175 Ga0157374_10375000 3300013296 Bacteria 1417
176 Ga0157378_10014693 3300013297 Bacteria 6859
177 Ga0157378_10385309 3300013297 Bacteria 1378
178 Ga0157378_10679933 3300013297 Bacteria 1047
179 Ga0163162_10057833 3300013306 Bacteria 3905
180 Ga0163162_10092136 3300013306 Bacteria 3114
181 Ga0163162_10381786 3300013306 Bacteria 1542
182 Ga0163162_10509153 3300013306 Bacteria 1334
183 Ga0157372_10082040 3300013307 Bacteria 3650
184 Ga0157375_10024000 3300013308 Bacteria 5637
185 Ga0157375_10072318 3300013308 Bacteria 3464
186 Ga0157375_10286166 3300013308 Bacteria 1811
187 Ga0157375_10435785 3300013308 Bacteria 1476
188 Ga0163163_10031870 3300014325 Bacteria 5091
189 Ga0163163_10032026 3300014325 Bacteria 5077
190 Ga0163163_10099503 3300014325 Bacteria 2929
191 Ga0163163_10463116 3300014325 Bacteria 1328
192 Ga0157380_10406296 3300014326 Unclassified 1294
193 Ga0157380_10468851 3300014326 Bacteria 1214
194 Ga0157379_10220282 3300014968 Bacteria 1719
195 Ga0214544_1000002 3300021320 Bacteria 753857
196 Ga0214544_1003478 3300021320 Bacteria 32528
197 Ga0214542_1000153 3300021321 Bacteria 101854
198 Ga0214542_1003350 3300021321 Bacteria 32785
199 Ga0214542_1044366 3300021321 Bacteria 1007
200 Ga0214545_1000018 3300021324 Bacteria 172019
201 Ga0214545_1001499 3300021324 Bacteria 43692
202 Ga0214545_1032394 3300021324 Bacteria 2005
203 Ga0214543_1000001 3300021327 Bacteria 776921
204 Ga0214543_1032298 3300021327 Bacteria 1995
205 Ga0214543_1032931 3300021327 Bacteria 1910
206 Ga0228598_1000457 3300024227 Bacteria 8320
207 Ga0209563_101288 3300025230 Bacteria 6853
208 Ga0209148_1000274 3300025254 Bacteria 81201
209 Ga0209564_1000023 3300025295 Bacteria 555102
210 Ga0209758_1000024 3300025297 Bacteria 591966
211 Ga0209758_1000131 3300025297 Bacteria 184259
212 Ga0209758_1001383 3300025297 Bacteria 28887
213 Ga0209758_1005184 3300025297 Bacteria 10247
214 Ga0209758_1011519 3300025297 Bacteria 5106
215 Ga0209758_1068018 3300025297 Bacteria 1136
216 Ga0209256_1001434 3300025299 Bacteria 24692
217 Ga0207426_1000598 3300025302 Bacteria 47559
218 Ga0207426_1008540 3300025302 Bacteria 4121
219 Ga0209257_1001033 3300025304 Bacteria 37252
220 Ga0209257_1023849 3300025304 Bacteria 2136
221 Ga0207713_1070986 3300025735 Bacteria 1286
222 Ga0207653_10038083 3300025885 Unclassified 1570
223 Ga0207692_10029813 3300025898 Bacteria 2596
224 Ga0207710_10059871 3300025900 Bacteria 1725
225 Ga0207710_10130674 3300025900 Bacteria 1206
226 Ga0207688_10055603 3300025901 Bacteria 2221
227 Ga0207647_10004150 3300025904 Bacteria 10746
228 Ga0207647_10036932 3300025904 Bacteria 3101
229 Ga0207699_10160906 3300025906 Bacteria 1494
230 Ga0207645_10064021 3300025907 Bacteria 2350
231 Ga0207645_10155216 3300025907 Bacteria 1495
232 Ga0207705_10004993 3300025909 Bacteria 9953
233 Ga0207654_10262876 3300025911 Bacteria 1161
234 Ga0207695_10000015 3300025913 Bacteria 803205
235 Ga0207695_10041025 3300025913 Bacteria 4955
236 Ga0207671_10011599 3300025914 Bacteria 7155
237 Ga0207671_10022447 3300025914 Bacteria 4772
238 Ga0207671_10139504 3300025914 Bacteria 1867
239 Ga0207693_10033808 3300025915 Bacteria 4033
240 Ga0207693_10090665 3300025915 Bacteria 2396
241 Ga0207663_10018049 3300025916 Bacteria 3943
242 Ga0207663_10295292 3300025916 Unclassified 1209
243 Ga0207660_10277593 3300025917 Bacteria 1329
244 Ga0207662_10128985 3300025918 Unclassified 1592
245 Ga0207652_10278632 3300025921 Bacteria 1508
246 Ga0207681_10429190 3300025923 Bacteria 1072
247 Ga0207694_10286295 3300025924 Bacteria 1354
248 Ga0207650_10002975 3300025925 Bacteria 11691
249 Ga0207650_10052587 3300025925 Bacteria 3017
250 Ga0207687_10188853 3300025927 Bacteria 1602
251 Ga0207700_10003532 3300025928 Bacteria 9108
252 Ga0207644_10004416 3300025931 Bacteria 9125
253 Ga0207644_10063490 3300025931 Bacteria 2681
254 Ga0207644_10152858 3300025931 Bacteria 1787
255 Ga0207690_10177018 3300025932 Bacteria 1603
256 Ga0207706_10146163 3300025933 Bacteria 2079
257 Ga0207706_10276671 3300025933 Bacteria 1464
258 Ga0207709_10094218 3300025935 Unclassified 1965
259 Ga0207709_10165547 3300025935 Bacteria 1546
260 Ga0207670_10002523 3300025936 Bacteria 9616
261 Ga0207665_10005155 3300025939 Bacteria 8724
262 Ga0207665_10135239 3300025939 Bacteria 1753
263 Ga0207665_10403973 3300025939 Unclassified 1041
264 Ga0207691_10166202 3300025940 Bacteria 1933
265 Ga0207711_10006272 3300025941 Bacteria 10031
266 Ga0207711_10027075 3300025941 Bacteria 4813
267 Ga0207711_10208345 3300025941 Bacteria 1786
268 Ga0207711_10253408 3300025941 Bacteria 1617
269 Ga0207689_10062753 3300025942 Bacteria 3056
270 Ga0207661_10003397 3300025944 Bacteria 11050
271 Ga0207661_10112381 3300025944 Unclassified 2306
272 Ga0207679_10038465 3300025945 Bacteria 3408
273 Ga0207679_10131964 3300025945 Bacteria 2005
274 Ga0207679_10144971 3300025945 Bacteria 1925
275 Ga0207679_10146523 3300025945 Bacteria 1916
276 Ga0207667_10328680 3300025949 Bacteria 1561
277 Ga0207651_10021962 3300025960 Bacteria 3891
278 Ga0207651_10052247 3300025960 Bacteria 2785
279 Ga0207712_10004348 3300025961 Bacteria 8953
280 Ga0207668_10168305 3300025972 Bacteria 1716
281 Ga0207668_10256683 3300025972 Bacteria 1422
282 Ga0207640_10069237 3300025981 Bacteria 2369
283 Ga0207703_10173151 3300026035 Bacteria 1900
284 Ga0207639_10279702 3300026041 Bacteria 1467
285 Ga0207678_10042636 3300026067 Bacteria 3930
286 Ga0207678_10057630 3300026067 Bacteria 3343
287 Ga0207678_10087717 3300026067 Bacteria 2659
288 Ga0207641_10189397 3300026088 Bacteria 1890
289 Ga0207648_10117386 3300026089 Bacteria 2338
290 Ga0207676_10070884 3300026095 Bacteria 2796
291 Ga0207676_10353523 3300026095 Bacteria 1359
292 Ga0207674_10286962 3300026116 Bacteria 1594
293 Ga0207675_100020959 3300026118 Bacteria 6095
294 Ga0207675_100080040 3300026118 Bacteria 3062
295 Ga0207675_100376925 3300026118 Bacteria 1394
296 Ga0207683_10002999 3300026121 Bacteria 14743
297 Ga0207683_10020143 3300026121 Bacteria 5702
298 Ga0207683_10477139 3300026121 Bacteria 1151
299 Ga0207698_10438345 3300026142 Bacteria 1258
300 Ga0209389_1000066 3300027296 Bacteria 100317
301 Ga0209389_1000075 3300027296 Bacteria 92887
302 Ga0209589_1000085 3300027357 Bacteria 92543
303 Ga0209489_100062 3300027361 Bacteria 145478
304 Ga0209489_115195 3300027361 Bacteria 4878
305 Ga0209700_100013 3300027363 Bacteria 341906
306 Ga0209813_10032271 3300027866 Bacteria 1551
307 Ga0207428_10002050 3300027907 Bacteria 20323
308 Ga0207428_10002399 3300027907 Bacteria 18724
309 Ga0268266_10001560 3300028379 Bacteria 26820
310 Ga0268266_10052161 3300028379 Bacteria 3512
311 Ga0268266_10077765 3300028379 Bacteria 2885
312 Ga0268266_10111647 3300028379 Bacteria 2422
313 Ga0268266_10268422 3300028379 Bacteria 1583
314 Ga0268266_10454904 3300028379 Bacteria 1217
315 Ga0268265_10062811 3300028380 Bacteria 2855
316 Ga0268264_10038390 3300028381 Bacteria 3952
317 Ga0307515_10373385 3300028794 Bacteria 1062
318 Ga0265325_10000049 3300031241 Bacteria 80854
319 Ga0265316_10133813 3300031344 Bacteria 1866
320 Ga0307513_10064907 3300031456 Bacteria 3843
321 Ga0265313_10006007 3300031595 Bacteria 8771
322 Ga0307508_10000020 3300031616 Bacteria 188730
323 Ga0307516_10000729 3300031730 Bacteria 44867
324 Ga0307406_10326791 3300031901 Bacteria 1189
325 Ga0307416_100477771 3300032002 Unclassified 1306
326 Ga0316580_10009041 3300032139 Bacteria 2992
327 Ga0307510_10067980 3300033180 Bacteria 3581
328 Ga0373926_0055584 3300035083 Bacteria 1435
329 Ga0373928_0035712 3300035084 Bacteria 1121
330 Ga0373929_0008909 3300035085 Bacteria 1854
331 Ga0373944_0034926 3300035089 Bacteria 1530
332 Ga0373941_0116850 3300035115 Unclassified 947
333 Ga0373957_0093409 3300035120 Bacteria 1198
334 Ga0373957_0121712 3300035120 Bacteria 1057
335 Ga0373943_0108541 3300035170 Bacteria 1461
336 Ga0373955_0014441 3300035172 Bacteria 3842
337 Ga0373955_0016599 3300035172 Bacteria 3628
338 Ga0373962_0017941 3300035242 Bacteria 1838
339 Ga0373935_0019713 3300035692 Bacteria 4113
340 Ga0373935_0219422 3300035692 Bacteria 1320
341 Ga0373927_0018489 3300035695 Bacteria 4580
342 Ga0373927_0023609 3300035695 Bacteria 4026
343 Ga0373927_0076888 3300035695 Bacteria 2162
344 Ga0373933_0032358 3300035724 Bacteria 3040
345 Ga0373947_0032340 3300035725 Bacteria 3083
346 Ga0373947_0047190 3300035725 Unclassified 2580
347 Ga0373937_0022527 3300036401 Bacteria 5665
348 Ga0373937_0238853 3300036401 Bacteria 1712
349 Ga0316582_0098364 3300036647 Bacteria 1935
350 Ga0316584_0184021 3300036712 Bacteria 1546
351 Ga0373925_0219604 3300037068 Bacteria 1517
352 Ga0395899_0105215 3300037312 Bacteria 2033
353 Ga0395899_0349142 3300037312 Bacteria 990
354 Ga0395900_0000982 3300037418 Bacteria 37090
355 Ga0395900_0010762 3300037418 Bacteria 9358
356 Ga0395900_0193310 3300037418 Bacteria 2063
357 Ga0395898_0002984 3300037466 Bacteria 19218
358 Ga0395898_0008903 3300037466 Bacteria 10574
359 Ga0395898_0769047 3300037466 Bacteria 904
360 Ga0395905_0031500 3300037471 Bacteria 4993
361 Ga0395905_0168588 3300037471 Bacteria 2057
362 Ga0395905_0194398 3300037471 Bacteria 1902
363 Ga0395901_0082239 3300038443 Bacteria 3364
364 Ga0395901_0243975 3300038443 Bacteria 1873
365 Ga0395901_0340399 3300038443 Bacteria 1550
366 Ga0436365_1845823 3300039437 Bacteria 28721
367 Ga0436363_0721817 3300039450 Bacteria 3897
368 Ga0436362_0274598 3300039453 Bacteria 16081
369 Ga0451798_0583350 3300041458 Bacteria 1333
370 Ga0453684_0598588 3300044712 Bacteria 1209
371 Ga0451576_0421321 3300045051 Bacteria 1401
372 Ga0466967_0046611 3300045976 Bacteria 3775
373 Ga0495592_0015421 3300046454 Bacteria 5796
374 Ga0495592_0018626 3300046454 Bacteria 5284
375 Ga0495603_0014556 3300046455 Bacteria 4759
376 Ga0495629_0004435 3300046459 Bacteria 10516
377 Ga0495629_0155601 3300046459 Bacteria 1588
378 Ga0495641_0037412 3300046461 Bacteria 2274
379 Ga0495651_0110791 3300046462 Bacteria 2030
380 Ga0495582_0027852 3300046473 Bacteria 3099
381 Ga0495608_0112773 3300046511 Bacteria 1747
382 Ga0495610_0029062 3300046512 Bacteria 2916
383 Ga0495618_0040589 3300046514 Bacteria 2929
384 Ga0495618_0103265 3300046514 Bacteria 1825
385 Ga0495628_0008984 3300046516 Bacteria 8548
386 Ga0495630_0000001 3300046517 Bacteria 1687293
387 Ga0495630_0087918 3300046517 Bacteria 2347
388 Ga0495643_0038753 3300046522 Bacteria 2608
389 Ga0495643_0043797 3300046522 Bacteria 2434
390 Ga0495644_0030814 3300046523 Bacteria 2025
391 Ga0495644_0031428 3300046523 Bacteria 2006
392 Ga0495648_0094468 3300046524 Bacteria 1665
393 Ga0495666_0096407 3300046526 Bacteria 1394
394 Ga0495666_0117426 3300046526 Bacteria 1247
395 Ga0495652_0020519 3300046529 Bacteria 5874
396 Ga0495652_0026467 3300046529 Bacteria 5125
397 Ga0495640_0069541 3300046533 Bacteria 2368
398 Ga0495586_0080272 3300046535 Unclassified 1792
399 Ga0495587_0181972 3300046536 Bacteria 1191
400 Ga0495645_0057235 3300046543 Bacteria 2830
401 Ga0495622_0020043 3300046557 Bacteria 3113
402 Ga0495667_0022637 3300046559 Bacteria 4234
403 Ga0495667_0059273 3300046559 Bacteria 2513
404 Ga0495667_0094557 3300046559 Bacteria 1935
405 Ga0495656_0010464 3300046615 Bacteria 3375
406 Ga0495668_0018716 3300046616 Bacteria 4003
407 Ga0495625_0168041 3300046660 Bacteria 1466
408 Ga0495635_0046502 3300046663 Bacteria 2994
409 Ga0495635_0098755 3300046663 Bacteria 1996
410 Ga0495635_0297431 3300046663 Bacteria 1082
411 Ga0495623_0009217 3300046679 Bacteria 6405
412 Ga0495647_0037435 3300046681 Bacteria 1831
413 Ga0495658_0002330 3300046683 Bacteria 9586
414 Ga0495658_0379884 3300046683 Unclassified 899
415 Ga0495669_0025608 3300046684 Bacteria 2573
416 Ga0495613_0204617 3300046689 Bacteria 1390
417 Ga0495670_0139669 3300046691 Bacteria 1266
418 Ga0495649_0062771 3300046694 Bacteria 1997
419 Ga0495600_0009703 3300046809 Bacteria 5949
420 Ga0495600_0110047 3300046809 Bacteria 1794
421 Ga0495581_0160455 3300047315 Unclassified 1314
422 Ga0495604_0046079 3300047317 Bacteria 3400
423 Ga0495604_0139290 3300047317 Bacteria 1735
424 Ga0495680_0010826 3300047322 Bacteria 8118
425 Ga0495680_0027357 3300047322 Bacteria 4688
426 Ga0495680_0039298 3300047322 Bacteria 3776
427 Ga0495680_0199036 3300047322 Bacteria 1438
428 Ga0495687_008090 3300047443 Bacteria 6076
429 Ga0495675_0154700 3300047444 Bacteria 1415
430 Ga0495684_0042117 3300047471 Bacteria 3498
431 Ga0495602_0017737 3300048088 Bacteria 7128
432 Ga0495602_0296869 3300048088 Bacteria 1184
433 Ga0495602_0552089 3300048088 Bacteria 798
434 Ga0496100_0035442 3300048903 Bacteria 3138
435 Ga0496100_0080844 3300048903 Bacteria 2194
436 Ga0496101_0143541 3300048904 Bacteria 1821
437 Ga0496102_0120071 3300048905 Bacteria 2454
438 Ga0496102_0153365 3300048905 Bacteria 2165
439 Ga0496103_0002759 3300048906 Bacteria 10948
440 Ga0496103_0022114 3300048906 Bacteria 3828
441 Ga0496103_0082850 3300048906 Bacteria 2019
442 Ga0496104_0027336 3300048907 Bacteria 5279
443 Ga0496104_0041943 3300048907 Bacteria 4291
444 Ga0496104_0064598 3300048907 Unclassified 3471
445 Ga0496104_0090002 3300048907 Bacteria 2932
446 Ga0496104_0122705 3300048907 Bacteria 2494
447 Ga0496105_0064859 3300048908 Bacteria 3014
448 Ga0496105_0082312 3300048908 Bacteria 2659
449 Ga0496105_0144913 3300048908 Bacteria 1953
450 Ga0496105_0241108 3300048908 Bacteria 1467
451 Ga0496106_0025401 3300048909 Bacteria 4409
452 Ga0496107_0039797 3300048910 Bacteria 3373
453 Ga0496108_0019693 3300048911 Bacteria 5542
454 Ga0496108_0158846 3300048911 Bacteria 1953
455 Ga0496108_0183465 3300048911 Bacteria 1812
456 Ga0496108_0410020 3300048911 Bacteria 1183
457 Ga0496109_0057883 3300048912 Bacteria 3539
458 Ga0496109_0063699 3300048912 Bacteria 3373
459 Ga0496109_0100826 3300048912 Bacteria 2679
460 Ga0496109_0113214 3300048912 Bacteria 2523
461 Ga0496110_0161755 3300048913 Bacteria 2029
462 Ga0496110_0172690 3300048913 Bacteria 1961
463 Ga0496110_0217489 3300048913 Bacteria 1737
464 Ga0496111_0063877 3300048914 Bacteria 2670
465 Ga0496111_0361312 3300048914 Unclassified 1074
466 Ga0496112_0003215 3300048915 Bacteria 13451
467 Ga0496112_0021485 3300048915 Bacteria 6138
468 Ga0496112_0031180 3300048915 Bacteria 5168
469 Ga0496112_0080813 3300048915 Bacteria 3214
470 Ga0496113_0035264 3300048916 Bacteria 3657
471 Ga0496113_0077573 3300048916 Bacteria 2540
472 Ga0496113_0129779 3300048916 Bacteria 1977
473 Ga0496113_0294188 3300048916 Bacteria 1299
474 Ga0496114_0004878 3300048917 Bacteria 10447
475 Ga0496114_0132756 3300048917 Bacteria 2151
476 Ga0496114_0177795 3300048917 Bacteria 1857
477 Ga0496115_0061418 3300048918 Bacteria 3029
478 Ga0496115_0266713 3300048918 Bacteria 1407
479 Ga0496115_0492064 3300048918 Bacteria 986
480 Ga0496116_0050995 3300048919 Bacteria 2752
481 Ga0496117_0046108 3300048920 Bacteria 3139
482 Ga0496118_0042527 3300048921 Bacteria 3583
483 Ga0496118_0056958 3300048921 Bacteria 2934
484 Ga0496119_0073003 3300048922 Bacteria 2002
485 Ga0496121_0100339 3300048924 Bacteria 2235
486 Ga0496121_0164133 3300048924 Bacteria 1621
487 Ga0496124_0080520 3300048927 Bacteria 2680
488 Ga0496124_0235340 3300048927 Bacteria 1366
489 Ga0496124_0256684 3300048927 Bacteria 1289
490 Ga0496125_0042605 3300048928 Bacteria 3864
491 Ga0496126_0004626 3300048929 Bacteria 16302
492 Ga0496126_0029282 3300048929 Bacteria 5232
493 Ga0496126_0320623 3300048929 Bacteria 1274
494 Ga0501032_0070132 3300049569 Bacteria 2337
495 Ga0501033_0165577 3300049570 Bacteria 1589
496 Ga0501034_0178567 3300049571 Bacteria 2088
497 Ga0501036_0098001 3300049572 Bacteria 2478
498 Ga0501037_0173974 3300049573 Bacteria 1529
499 Ga0501038_0111117 3300049574 Bacteria 2270
500 Ga0501040_0231097 3300049576 Bacteria 1317
501 Ga0501040_0289458 3300049576 Bacteria 1170
502 Ga0501043_0111323 3300049579 Bacteria 2149
503 Ga0501047_0271627 3300049581 Bacteria 1541
504 Ga0501048_0083427 3300049582 Bacteria 2253
505 Ga0501067_0035778 3300049583 Bacteria 2757
506 Ga0501067_0201526 3300049583 Bacteria 1108
507 Ga0501068_0009941 3300049584 Bacteria 5332
508 Ga0501070_0133079 3300049586 Bacteria 2053
509 Ga0501070_0297337 3300049586 Bacteria 1316
510 Ga0501071_0113850 3300049587 Bacteria 2001
511 Ga0501072_0065106 3300049588 Bacteria 2874
512 Ga0501073_0088707 3300049589 Bacteria 2150
513 Ga0501074_0089857 3300049590 Bacteria 2200
514 Ga0501074_0146663 3300049590 Bacteria 1687
515 Ga0501079_0053947 3300049741 Bacteria 3101
516 Ga0501080_0348057 3300049742 Bacteria 1338
517 Ga0501044_0088639 3300049823 Bacteria 3123
518 Ga0501045_0026826 3300049824 Bacteria 4146
519 nmdc:mga03n38_68263_c1 3300050490 Bacteria 1639
520 nmdc:mga0yw44_76812_c1 3300050492 Bacteria 2085
521 nmdc:mga0yw44_97541_c1 3300050492 Bacteria 1867
522 nmdc:mga06z11_119567_c1 3300050494 Bacteria 1468
523 nmdc:mga06z11_21597_c1 3300050494 Bacteria 2994
524 nmdc:mga04h51_35863_c1 3300050495 Bacteria 1592
525 nmdc:mga05p37_2263_c1 3300050507 Bacteria 22436
526 nmdc:mga05p37_3065_c1 3300050507 Bacteria 19411
527 nmdc:mga06r32_8490_c1 3300050510 Bacteria 9260
528 nmdc:mga08y16_58505_c1 3300050511 Bacteria 4028
529 nmdc:mga08y16_7164_c1 3300050511 Bacteria 11705
530 nmdc:mga0n895_128271_c1 3300050512 Bacteria 2561
531 nmdc:mga0n895_3895_c1 3300050512 Bacteria 12132
532 nmdc:mga0n895_4555_c1 3300050512 Bacteria 11413
533 nmdc:mga0n895_563077_c1 3300050512 Bacteria 1145
534 nmdc:mga0rr50_18031_c1 3300050513 Bacteria 4732
535 nmdc:mga0rr50_234483_c1 3300050513 Bacteria 1519
536 nmdc:mga0rr50_460646_c1 3300050513 Bacteria 1078
537 nmdc:mga08x19_74500_c1 3300050514 Bacteria 2218
538 nmdc:mga0a205_26028_c1 3300050515 Bacteria 5574
539 nmdc:mga0a205_9226_c1 3300050515 Bacteria 9007
540 nmdc:mga0sz30_53405_c1 3300050516 Bacteria 1717
541 nmdc:mga0sz30_59976_c1 3300050516 Bacteria 1624
542 Ga0495601_0000575 3300053077 Bacteria 19519
543 Ga0495601_0002970 3300053077 Bacteria 9649
544 Ga0495601_0035681 3300053077 Bacteria 3105
545 Ga0495601_0158575 3300053077 Bacteria 1478
546 Ga0495612_0011581 3300053078 Bacteria 3552
547 Ga0495612_0043516 3300053078 Bacteria 1835
548 Ga0500635_0043678 3300053080 Bacteria 1508
549 Ga0495595_0001273 3300053084 Bacteria 9820
550 Ga0495619_0000698 3300053085 Bacteria 21970
551 Ga0495619_0001094 3300053085 Bacteria 17821
552 Ga0495619_0049756 3300053085 Bacteria 2764
553 Ga0495619_0136459 3300053085 Bacteria 1688
554 Ga0495619_0257865 3300053085 Bacteria 1208
555 Ga0500647_0120559 3300053091 Bacteria 1242
556 Ga0500641_0002478 3300053096 Bacteria 6523
557 Ga0500554_001242 3300053102 Bacteria 4946
558 Ga0500557_000045 3300053105 Bacteria 61505
559 Ga0500642_0000165 3300053130 Bacteria 27331
560 Ga0500577_0066040 3300053142 Bacteria 1406
561 Ga0500590_067288 3300053148 Bacteria 1788
562 Ga0500603_000403 3300053150 Bacteria 11330
563 Ga0500619_024015 3300053154 Bacteria 1788
564 Ga0500620_105132 3300053155 Bacteria 988
565 Ga0500636_0000082 3300053177 Bacteria 47168
566 Ga0500637_0016912 3300053178 Bacteria 3895
567 Ga0500625_000701 3300053729 Bacteria 9882
568 Ga0500601_000102 3300053737 Bacteria 17707
569 Ga0501084_0028532 3300054114 Bacteria 4666
570 Ga0500661_004759 3300055283 Bacteria 2536
571 Ga0501082_0103153 3300060353 Bacteria 2467
572 Ga0530510_0011121 3300061734 Bacteria 6313
573 Ga0530510_0435491 3300061734 Bacteria 990
574 2513646971 2513237095 Bacteria 8976980
575 2513671899 2513237098 Bacteria 9902361
576 2514015763 2513237161 Bacteria 8871253
577 2517101556 2517093001 Bacteria 9002274
578 2524437184 2524023205 Bacteria 8918781
579 2524463788 2524023210 Bacteria 9029266
580 2528851699 2528768022 Bacteria 10457665
581 2617376066 2617270741 Bacteria 8201522
582 2644729000 2643221733 Bacteria 5690728
583 2644737704 2643221734 Bacteria 5365412
584 2745076403 2744054633 Bacteria 8678936
585 2793060725 2791355196 Bacteria 7323613
586 2793070073 2791355197 Bacteria 8420563
587 2818236008 2816332527 Bacteria 8933356
588 2824607254 2824600985 Bacteria 8488197
589 2824610673 2824609381 Bacteria 8672835
590 2824654049 2824653114 Bacteria 8493680
591 2824665756 2824661429 Bacteria 9877870
592 2824676449 2824671348 Bacteria 8369588
593 2824680472 2824679649 Bacteria 8248951
594 2824692854 2824687955 Bacteria 8360029
595 2824737351 2824732956 Bacteria 7810675
596 2824753033 2824746037 Bacteria 7911610
597 2838123238 2838122688 Bacteria 8803140
598 2841946513 2841941048 Bacteria 8688029
599 2841954244 2841949485 Bacteria 8680857
600 2841958370 2841957949 Bacteria 8652217
601 2841969616 2841966195 Bacteria 8673214
602 2841978946 2841974524 Bacteria 8931498
603 2841983937 2841983080 Bacteria 8395090
604 2842039421 2842038055 Bacteria 8002051
605 2842047633 2842045827 Bacteria 8006841
606 2844318729 2844315083 Bacteria 8138177
607 2847933696 2847930680 Bacteria 9342022
608 2876763915 2876761206 Bacteria 10111113
609 2879087232 2879083081 Bacteria 8587928
610 2879105235 2879099564 Bacteria 10442239
611 2881668862 2881665667 Bacteria 8175609
612 2885367944 2885366525 Bacteria 8326213
613 2885389032 2885383462 Bacteria 9473874
614 2885417219 2885409591 Bacteria 9235467
615 2888384897 2888378607 Bacteria 9652610
616 2888388876 2888388044 Bacteria 7304136
617 2888425096 2888419890 Bacteria 7857137
618 2903728860 2903727486 Bacteria 8281579
619 2903777898 2903768456 Bacteria 9749579
620 2906604442 2906602504 Bacteria 8295279
621 2906647910 2906643746 Bacteria 8722424
622 2908779855 2908775508 Bacteria 8092255
623 2917704391 2917699015 Bacteria 7043791
624 2922371743
625 2922397627 2922393267 Bacteria 8285685
626 2932790626 2932784394 Bacteria 9704911
627 2932811823 2932809354 Bacteria 9135765
628 2932822691 2932818245 Bacteria 9955613
629 2932835523 2932828146 Bacteria 9745859
630 2935624862 2935616580 Bacteria 9032984
631 2935646192 2935638405 Bacteria 10015038
632 2935670761 2935665750 Bacteria 9571747
633 2935679500 2935675223 Bacteria 9928132
634 2935691484 2935684952 Bacteria 9590419
635 2935701869 2935694250 Bacteria 9291695
636 2935704485 2935703347 Bacteria 10242284
637 2935719318 2935713505 Bacteria 9608509
638 2935729082 2935722832 Bacteria 9608746
639 2935737677 2935732158 Bacteria 9706831
640 2935747053 2935741537 Bacteria 9707219
641 2935758147 2935750917 Bacteria 9590372
642 2935766783 2935760218 Bacteria 9817913
643 2935809115 2935801545 Bacteria 9301974
644 2935816530 2935810662 Bacteria 9401221
645 2935835430 2935827899 Bacteria 10038562
646 2935845806 2935837841 Bacteria 9454360
647 2935863493 2935855204 Bacteria 9035059
648 2935872697 2935864058 Bacteria 9784707
649 2935882572 2935873716 Bacteria 9632195
650 2936000710 2935992306 Bacteria 9802711
651 2936009659 2936002035 Bacteria 9362176
652 2936042518 2936037263 Bacteria 9446081
653 2940563942 2940556831 Bacteria 9590747
654 2941537643 2941531003 Bacteria 7653939
655 2941545980 2941538514 Bacteria 9402094
656 3005508137 3005506211 Bacteria 6943378
657 3005712882 3005710791 Bacteria 7622528
658 3005721924 3005718088 Bacteria 8283608
659 8016516014 8016511872 Bacteria 9921665
660 8017060501 8017057580 Bacteria 10023680
661 8019579980 8019576017 Bacteria 10049540
662 8019587691 8019586578 Bacteria 10212056
663 8019603636 8019597564 Bacteria 10041141
664 8019614891 8019608314 Bacteria 10042931
665 8019657836 8019648815 Bacteria 10014479
666 8056973103 8056967851 Bacteria 9038162
667 Ga0373924_0044906
668 JGI25153J46596_10000390
669 JGI25153J46596_10038032
670 rootH1_10170955
671 JGI25404J52841_10016646
672 Ga0055526_1000276
673 Ga0055531_10007394
674 Ga0055543_1009344
675 Ga0065165_1000162
676 Ga0065165_1000972
677 Ga0065165_1003380
678 Ga0070658_10001973
679 Ga0070676_10012317
680 Ga0070690_100004250
681 Ga0070670_100004244
682 Ga0070670_100034519
683 Ga0068869_100284260
684 Ga0070666_10232655
685 Ga0070680_100155829
686 Ga0070682_100344943
687 Ga0068868_100229908
688 Ga0070689_100003813
689 Ga0070689_100012317
690 Ga0070689_100027796
691 Ga0070687_100008590
692 Ga0070687_100105054
693 Ga0070661_100216014
694 Ga0070668_100006824
695 Ga0070668_100021888
696 Ga0070669_100249406
697 Ga0070675_100074705
698 Ga0070675_100305922
699 Ga0070671_100011647
700 Ga0070671_100047982
701 Ga0070673_100092692
702 Ga0070673_100152237
703 Ga0070673_100221278
704 Ga0070688_100008648
705 Ga0070688_100046287
706 Ga0070659_100202645
707 Ga0070667_100046590
708 Ga0070667_100238894
709 Ga0070709_10006294
710 Ga0070714_100304465
711 Ga0070714_100436656
712 Ga0070713_100070782
713 Ga0070713_100076679
714 Ga0070711_100199628
715 Ga0070705_100297350
716 Ga0070663_100031636
717 Ga0070663_100058899
718 Ga0070663_100085868
719 Ga0070663_100168361
720 Ga0070678_100025500
721 Ga0070678_100221388
722 Ga0070662_100097943
723 Ga0070662_100178835
724 Ga0070685_10008342
725 Ga0070685_10269344
726 Ga0070707_100010889
727 Ga0070707_100270325
728 Ga0070698_100178049
729 Ga0070679_100086844
730 Ga0070684_100010914
731 Ga0070684_100454132
732 Ga0070697_100440636
733 Ga0070672_100065814
734 Ga0070672_100382360
735 Ga0070665_100036707
736 Ga0070665_100051023
737 Ga0070665_100063054
738 Ga0070665_100538302
739 Ga0070665_100565473
740 Ga0070704_100007779
741 Ga0068855_100363658
742 Ga0070664_100128179
743 Ga0070664_100223252
744 Ga0070664_100338684
745 Ga0068857_100059686
746 Ga0068854_100055097
747 Ga0068856_100197765
748 Ga0068856_100291468
749 Ga0068852_100067461
750 Ga0068859_100027315
751 Ga0068859_100155172
752 Ga0068859_100530005
753 Ga0068864_100050814
754 Ga0068864_100101994
755 Ga0068864_100525040
756 Ga0068861_100055107
757 Ga0068861_100146007
758 Ga0068861_100364892
759 Ga0068863_100178908
760 Ga0068863_100267974
761 Ga0068858_100039121
762 Ga0068860_100039680
763 Ga0068862_100102296
764 Ga0068862_100119747
765 Ga0081455_10034139
766 Ga0081540_1000022
767 Ga0081540_1001334
768 Ga0081539_10063113
769 Ga0070717_10000933
770 Ga0070717_10018082
771 Ga0070717_10019388
772 Ga0075365_10046462
773 Ga0075365_10048558
774 Ga0075365_10100805
775 Ga0075368_10044292
776 Ga0075363_100099355
777 Ga0070716_100033348
778 Ga0070716_100309000
779 Ga0070712_100014848
780 Ga0070712_100211967
781 Ga0075362_10003733
782 Ga0075367_10031447
783 Ga0075367_10089996
784 Ga0075367_10196460
785 Ga0075369_10041337
786 Ga0075427_10008733
787 Ga0075366_10055676
788 Ga0075366_10186341
789 Ga0075370_10024147
790 Ga0068871_100407347
791 Ga0068871_100424417
792 Ga0075433_10067956
793 Ga0075434_100040192
794 Ga0075434_100100746
795 Ga0075434_100122954
796 Ga0075434_100625865
797 Ga0097620_100027315
798 Ga0097620_100155167
799 Ga0097620_100529986
800 Ga0099824_1015433
801 Ga0075435_100015880
802 Ga0075435_100243249
803 Ga0099794_10000601
804 Ga0099795_10046724
805 Ga0105240_10005091
806 Ga0105240_10020973
807 Ga0105240_10107104
808 Ga0105245_10246132
809 Ga0105245_10359380
810 Ga0105245_10426496
811 Ga0105247_10026250
812 Ga0105247_10057668
813 Ga0114129_10003291
814 Ga0105243_10178095
815 Ga0105241_10043674
816 Ga0105241_10175424
817 Ga0105242_10393412
818 Ga0105248_10012024
819 Ga0105248_10118023
820 Ga0105248_10210447
821 Ga0105248_10545204
822 Ga0105248_10609133
823 Ga0105237_10021753
824 Ga0105237_10050721
825 Ga0105237_10473722
826 Ga0105238_10031928
827 Ga0105249_10058705
828 Ga0105249_10127997
829 Ga0105249_10129598
830 Ga0105249_10554978
831 Ga0099796_10000200
832 Ga0105239_10027794
833 Ga0105239_10074034
834 Ga0105239_10128571
835 Ga0105239_10243192
836 Ga0105246_10196668
837 Ga0157370_10064785
838 Ga0171462_1006
839 Ga0157374_10039259
840 Ga0157374_10128916
841 Ga0157374_10375000
842 Ga0157378_10014693
843 Ga0157378_10385309
844 Ga0157378_10679933
845 Ga0163162_10057833
846 Ga0163162_10092136
847 Ga0163162_10381786
848 Ga0163162_10509153
849 Ga0157372_10082040
850 Ga0157375_10024000
851 Ga0157375_10072318
852 Ga0157375_10286166
853 Ga0157375_10435785
854 Ga0163163_10031870
855 Ga0163163_10032026
856 Ga0163163_10099503
857 Ga0163163_10463116
858 Ga0157380_10406296
859 Ga0157380_10468851
860 Ga0157379_10220282
861 Ga0214544_1000002
862 Ga0214544_1003478
863 Ga0214542_1000153
864 Ga0214542_1003350
865 Ga0214542_1044366
866 Ga0214545_1000018
867 Ga0214545_1001499
868 Ga0214545_1032394
869 Ga0214543_1000001
870 Ga0214543_1032298
871 Ga0214543_1032931
872 Ga0228598_1000457
873 Ga0209563_101288
874 Ga0209148_1000274
875 Ga0209564_1000023
876 Ga0209758_1000024
877 Ga0209758_1000131
878 Ga0209758_1001383
879 Ga0209758_1005184
880 Ga0209758_1011519
881 Ga0209758_1068018
882 Ga0209256_1001434
883 Ga0207426_1000598
884 Ga0207426_1008540
885 Ga0209257_1001033
886 Ga0209257_1023849
887 Ga0207713_1070986
888 Ga0207653_10038083
889 Ga0207692_10029813
890 Ga0207710_10059871
891 Ga0207710_10130674
892 Ga0207688_10055603
893 Ga0207647_10004150
894 Ga0207647_10036932
895 Ga0207699_10160906
896 Ga0207645_10064021
897 Ga0207645_10155216
898 Ga0207705_10004993
899 Ga0207654_10262876
900 Ga0207695_10000015
901 Ga0207695_10041025
902 Ga0207671_10011599
903 Ga0207671_10022447
904 Ga0207671_10139504
905 Ga0207693_10033808
906 Ga0207693_10090665
907 Ga0207663_10018049
908 Ga0207663_10295292
909 Ga0207660_10277593
910 Ga0207662_10128985
911 Ga0207652_10278632
912 Ga0207681_10429190
913 Ga0207694_10286295
914 Ga0207650_10002975
915 Ga0207650_10052587
916 Ga0207687_10188853
917 Ga0207700_10003532
918 Ga0207644_10004416
919 Ga0207644_10063490
920 Ga0207644_10152858
921 Ga0207690_10177018
922 Ga0207706_10146163
923 Ga0207706_10276671
924 Ga0207709_10094218
925 Ga0207709_10165547
926 Ga0207670_10002523
927 Ga0207665_10005155
928 Ga0207665_10135239
929 Ga0207665_10403973
930 Ga0207691_10166202
931 Ga0207711_10006272
932 Ga0207711_10027075
933 Ga0207711_10208345
934 Ga0207711_10253408
935 Ga0207689_10062753
936 Ga0207661_10003397
937 Ga0207661_10112381
938 Ga0207679_10038465
939 Ga0207679_10131964
940 Ga0207679_10144971
941 Ga0207679_10146523
942 Ga0207667_10328680
943 Ga0207651_10021962
944 Ga0207651_10052247
945 Ga0207712_10004348
946 Ga0207668_10168305
947 Ga0207668_10256683
948 Ga0207640_10069237
949 Ga0207703_10173151
950 Ga0207639_10279702
951 Ga0207678_10042636
952 Ga0207678_10057630
953 Ga0207678_10087717
954 Ga0207641_10189397
955 Ga0207648_10117386
956 Ga0207676_10070884
957 Ga0207676_10353523
958 Ga0207674_10286962
959 Ga0207675_100020959
960 Ga0207675_100080040
961 Ga0207675_100376925
962 Ga0207683_10002999
963 Ga0207683_10020143
964 Ga0207683_10477139
965 Ga0207698_10438345
966 Ga0209389_1000066
967 Ga0209389_1000075
968 Ga0209589_1000085
969 Ga0209489_100062
970 Ga0209489_115195
971 Ga0209700_100013
972 Ga0209813_10032271
973 Ga0207428_10002050
974 Ga0207428_10002399
975 Ga0268266_10001560
976 Ga0268266_10052161
977 Ga0268266_10077765
978 Ga0268266_10111647
979 Ga0268266_10268422
980 Ga0268266_10454904
981 Ga0268265_10062811
982 Ga0268264_10038390
983 Ga0307515_10373385
984 Ga0265325_10000049
985 Ga0265316_10133813
986 Ga0307513_10064907
987 Ga0265313_10006007
988 Ga0307508_10000020
989 Ga0307516_10000729
990 Ga0307406_10326791
991 Ga0307416_100477771
992 Ga0316580_10009041
993 Ga0307510_10067980
994 Ga0373926_0055584
995 Ga0373928_0035712
996 Ga0373929_0008909
997 Ga0373944_0034926
998 Ga0373941_0116850
999 Ga0373957_0093409
1000 Ga0373957_0121712
1001 Ga0373943_0108541
1002 Ga0373955_0014441
1003 Ga0373955_0016599
1004 Ga0373962_0017941
1005 Ga0373935_0019713
1006 Ga0373935_0219422
1007 Ga0373927_0018489
1008 Ga0373927_0023609
1009 Ga0373927_0076888
1010 Ga0373933_0032358
1011 Ga0373947_0032340
1012 Ga0373947_0047190
1013 Ga0373937_0022527
1014 Ga0373937_0238853
1015 Ga0316582_0098364
1016 Ga0316584_0184021
1017 Ga0373925_0219604
1018 Ga0395899_0105215
1019 Ga0395899_0349142
1020 Ga0395900_0000982
1021 Ga0395900_0010762
1022 Ga0395900_0193310
1023 Ga0395898_0002984
1024 Ga0395898_0008903
1025 Ga0395898_0769047
1026 Ga0395905_0031500
1027 Ga0395905_0168588
1028 Ga0395905_0194398
1029 Ga0395901_0082239
1030 Ga0395901_0243975
1031 Ga0395901_0340399
1032 Ga0436365_1845823
1033 Ga0436363_0721817
1034 Ga0436362_0274598
1035 Ga0451798_0583350
1036 Ga0453684_0598588
1037 Ga0451576_0421321
1038 Ga0466967_0046611
1039 Ga0495592_0015421
1040 Ga0495592_0018626
1041 Ga0495603_0014556
1042 Ga0495629_0004435
1043 Ga0495629_0155601
1044 Ga0495641_0037412
1045 Ga0495651_0110791
1046 Ga0495582_0027852
1047 Ga0495608_0112773
1048 Ga0495610_0029062
1049 Ga0495618_0040589
1050 Ga0495618_0103265
1051 Ga0495628_0008984
1052 Ga0495630_0000001
1053 Ga0495630_0087918
1054 Ga0495643_0038753
1055 Ga0495643_0043797
1056 Ga0495644_0030814
1057 Ga0495644_0031428
1058 Ga0495648_0094468
1059 Ga0495666_0096407
1060 Ga0495666_0117426
1061 Ga0495652_0020519
1062 Ga0495652_0026467
1063 Ga0495640_0069541
1064 Ga0495586_0080272
1065 Ga0495587_0181972
1066 Ga0495645_0057235
1067 Ga0495622_0020043
1068 Ga0495667_0022637
1069 Ga0495667_0059273
1070 Ga0495667_0094557
1071 Ga0495656_0010464
1072 Ga0495668_0018716
1073 Ga0495625_0168041
1074 Ga0495635_0046502
1075 Ga0495635_0098755
1076 Ga0495635_0297431
1077 Ga0495623_0009217
1078 Ga0495647_0037435
1079 Ga0495658_0002330
1080 Ga0495658_0379884
1081 Ga0495669_0025608
1082 Ga0495613_0204617
1083 Ga0495670_0139669
1084 Ga0495649_0062771
1085 Ga0495600_0009703
1086 Ga0495600_0110047
1087 Ga0495581_0160455
1088 Ga0495604_0046079
1089 Ga0495604_0139290
1090 Ga0495680_0010826
1091 Ga0495680_0027357
1092 Ga0495680_0039298
1093 Ga0495680_0199036
1094 Ga0495687_008090
1095 Ga0495675_0154700
1096 Ga0495684_0042117
1097 Ga0495602_0017737
1098 Ga0495602_0296869
1099 Ga0495602_0552089
1100 Ga0496100_0035442
1101 Ga0496100_0080844
1102 Ga0496101_0143541
1103 Ga0496102_0120071
1104 Ga0496102_0153365
1105 Ga0496103_0002759
1106 Ga0496103_0022114
1107 Ga0496103_0082850
1108 Ga0496104_0027336
1109 Ga0496104_0041943
1110 Ga0496104_0064598
1111 Ga0496104_0090002
1112 Ga0496104_0122705
1113 Ga0496105_0064859
1114 Ga0496105_0082312
1115 Ga0496105_0144913
1116 Ga0496105_0241108
1117 Ga0496106_0025401
1118 Ga0496107_0039797
1119 Ga0496108_0019693
1120 Ga0496108_0158846
1121 Ga0496108_0183465
1122 Ga0496108_0410020
1123 Ga0496109_0057883
1124 Ga0496109_0063699
1125 Ga0496109_0100826
1126 Ga0496109_0113214
1127 Ga0496110_0161755
1128 Ga0496110_0172690
1129 Ga0496110_0217489
1130 Ga0496111_0063877
1131 Ga0496111_0361312
1132 Ga0496112_0003215
1133 Ga0496112_0021485
1134 Ga0496112_0031180
1135 Ga0496112_0080813
1136 Ga0496113_0035264
1137 Ga0496113_0077573
1138 Ga0496113_0129779
1139 Ga0496113_0294188
1140 Ga0496114_0004878
1141 Ga0496114_0132756
1142 Ga0496114_0177795
1143 Ga0496115_0061418
1144 Ga0496115_0266713
1145 Ga0496115_0492064
1146 Ga0496116_0050995
1147 Ga0496117_0046108
1148 Ga0496118_0042527
1149 Ga0496118_0056958
1150 Ga0496119_0073003
1151 Ga0496121_0100339
1152 Ga0496121_0164133
1153 Ga0496124_0080520
1154 Ga0496124_0235340
1155 Ga0496124_0256684
1156 Ga0496125_0042605
1157 Ga0496126_0004626
1158 Ga0496126_0029282
1159 Ga0496126_0320623
1160 Ga0501032_0070132
1161 Ga0501033_0165577
1162 Ga0501034_0178567
1163 Ga0501036_0098001
1164 Ga0501037_0173974
1165 Ga0501038_0111117
1166 Ga0501040_0231097
1167 Ga0501040_0289458
1168 Ga0501043_0111323
1169 Ga0501047_0271627
1170 Ga0501048_0083427
1171 Ga0501067_0035778
1172 Ga0501067_0201526
1173 Ga0501068_0009941
1174 Ga0501070_0133079
1175 Ga0501070_0297337
1176 Ga0501071_0113850
1177 Ga0501072_0065106
1178 Ga0501073_0088707
1179 Ga0501074_0089857
1180 Ga0501074_0146663
1181 Ga0501079_0053947
1182 Ga0501080_0348057
1183 Ga0501044_0088639
1184 Ga0501045_0026826
1185 nmdc:mga03n38_68263_c1
1186 nmdc:mga0yw44_76812_c1
1187 nmdc:mga0yw44_97541_c1
1188 nmdc:mga06z11_119567_c1
1189 nmdc:mga06z11_21597_c1
1190 nmdc:mga04h51_35863_c1
1191 nmdc:mga05p37_2263_c1
1192 nmdc:mga05p37_3065_c1
1193 nmdc:mga06r32_8490_c1
1194 nmdc:mga08y16_58505_c1
1195 nmdc:mga08y16_7164_c1
1196 nmdc:mga0n895_128271_c1
1197 nmdc:mga0n895_3895_c1
1198 nmdc:mga0n895_4555_c1
1199 nmdc:mga0n895_563077_c1
1200 nmdc:mga0rr50_18031_c1
1201 nmdc:mga0rr50_234483_c1
1202 nmdc:mga0rr50_460646_c1
1203 nmdc:mga08x19_74500_c1
1204 nmdc:mga0a205_26028_c1
1205 nmdc:mga0a205_9226_c1
1206 nmdc:mga0sz30_53405_c1
1207 nmdc:mga0sz30_59976_c1
1208 Ga0495601_0000575
1209 Ga0495601_0002970
1210 Ga0495601_0035681
1211 Ga0495601_0158575
1212 Ga0495612_0011581
1213 Ga0495612_0043516
1214 Ga0500635_0043678
1215 Ga0495595_0001273
1216 Ga0495619_0000698
1217 Ga0495619_0001094
1218 Ga0495619_0049756
1219 Ga0495619_0136459
1220 Ga0495619_0257865
1221 Ga0500647_0120559
1222 Ga0500641_0002478
1223 Ga0500554_001242
1224 Ga0500557_000045
1225 Ga0500642_0000165
1226 Ga0500577_0066040
1227 Ga0500590_067288
1228 Ga0500603_000403
1229 Ga0500619_024015
1230 Ga0500620_105132
1231 Ga0500636_0000082
1232 Ga0500637_0016912
1233 Ga0500625_000701
1234 Ga0500601_000102
1235 Ga0501084_0028532
1236 Ga0500661_004759
1237 Ga0501082_0103153
1238 Ga0530510_0011121
1239 Ga0530510_0435491
1240 2513646971
1241 2513671899
1242 2514015763
1243 2517101556
1244 2524437184
1245 2524463788
1246 2528851699
1247 2617376066
1248 2644729000
1249 2644737704
1250 2745076403
1251 2793060725
1252 2793070073
1253 2818236008
1254 2824607254
1255 2824610673
1256 2824654049
1257 2824665756
1258 2824676449
1259 2824680472
1260 2824692854
1261 2824737351
1262 2824753033
1263 2838123238
1264 2841946513
1265 2841954244
1266 2841958370
1267 2841969616
1268 2841978946
1269 2841983937
1270 2842039421
1271 2842047633
1272 2844318729
1273 2847933696
1274 2876763915
1275 2879087232
1276 2879105235
1277 2881668862
1278 2885367944
1279 2885389032
1280 2885417219
1281 2888384897
1282 2888388876
1283 2888425096
1284 2903728860
1285 2903777898
1286 2906604442
1287 2906647910
1288 2908779855
1289 2917704391
1290 2922371743
1291 2922397627
1292 2932790626
1293 2932811823
1294 2932822691
1295 2932835523
1296 2935624862
1297 2935646192
1298 2935670761
1299 2935679500
1300 2935691484
1301 2935701869
1302 2935704485
1303 2935719318
1304 2935729082
1305 2935737677
1306 2935747053
1307 2935758147
1308 2935766783
1309 2935809115
1310 2935816530
1311 2935835430
1312 2935845806
1313 2935863493
1314 2935872697
1315 2935882572
1316 2936000710
1317 2936009659
1318 2936042518
1319 2940563942
1320 2941537643
1321 2941545980
1322 3005508137
1323 3005712882
1324 3005721924
1325 8016516014
1326 8017060501
1327 8019579980
1328 8019587691
1329 8019603636
1330 8019614891
1331 8019657836
1332 8056973103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11453

DUF2950

Protein of unknown function (DUF2950)

69

344

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bm9-assembly1.cif.gz_A directed evolutionary changes in mbl super family - vim-2 round 10 0.6191 84 119
1m27-assembly1.cif.gz_A crystal structure of sap/fynsh3/slam ternary complex 0.5894 85 123
8faz-assembly1.cif.gz_X cryo-em structure of the human bcdx2 complex 0.5755 87 121
2f1h-assembly1.cif.gz_A recombinase in complex with amp-pnp and potassium 0.5749 87 120
3ewa-assembly1.cif.gz_A rada recombinase from methanococcus maripaludis in complex with amppnp and ammonium ions 0.574 87 120
ID Description Score Start End Superfamily
af_Q7XH24_134_378_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6581 218 279 2.130.10.10
af_P08370_15_132_3.30.700.10 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.655 84 122 3.30.700.10
af_Q4DHX3_666_834_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6522 84 116 2.130.10.10
af_Q4DUL5_677_856_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6518 84 116 2.130.10.10
af_Q8I5F0_277_381_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6385 262 278 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A363TLY4-F1-model_v4 DUF2950 domain-containing protein 0.9488 52 301
AF-A0A0C1QX42-F1-model_v4 DUF2950 domain-containing protein 0.9395 20 304
AF-A0A354H362-F1-model_v4 DUF2950 domain-containing protein 0.9357 24 301
AF-A0A348ZUS6-F1-model_v4 DUF2950 domain-containing protein 0.9328 15 305
AF-A0A7C4IZU8-F1-model_v4 DUF2950 family protein 0.9324 12 301

Map