F473785

General Info

Members Datasets Scaffolds Average Seq Length
666 355 1332 164

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10443609|Ga0207707_104436092
Length 176
Sequence MLIEKRQDLGHTHPIAILPPSQAANGLSPVPQLAGVVIGVNMTLMKLAIQTLPGTEVDSAYSASLAYEKEIAAARDQDERHWKIDAHVERVAPNGATLQIEARDSKGRPMAGLTFQGRFERPTDRRADLSVVLAEVGNGIYRGSTPAIGPGQWDLVLEGLTAGQRMFLSKNRVLLN

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
308 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
318 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
327 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
328 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
329 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
330 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
331 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
338 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
339 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
340 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
341 2791355199
342 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
343 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
344 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
345 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
346 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
347 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
348 2904699407
349 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
350 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
351 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
352 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
353 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
354 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
355 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.71
Nodule 2.1
Rhizoplane 8.41
Rhizosphere 73.42
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10443609 3300025912 Bacteria 1111
2 JGI24737J22298_10004204 3300001990 Bacteria 5034
3 JGI24750J21931_1053744 3300002070 Bacteria 633
4 rootH1_10076789 3300003323 Bacteria 1796
5 Ga0070676_10959834 3300005328 Bacteria 640
6 Ga0070690_101247742 3300005330 Bacteria 594
7 Ga0070670_100615230 3300005331 Bacteria 973
8 Ga0070670_101450593 3300005331 Bacteria 630
9 Ga0068869_100100565 3300005334 Bacteria 2186
10 Ga0068869_100152048 3300005334 Bacteria 1796
11 Ga0070666_10085468 3300005335 Bacteria 2161
12 Ga0070666_10480986 3300005335 Bacteria 899
13 Ga0068868_100010220 3300005338 Bacteria 6785
14 Ga0068868_100570240 3300005338 Bacteria 1000
15 Ga0070660_100314550 3300005339 Bacteria 1285
16 Ga0070660_100405402 3300005339 Bacteria 1128
17 Ga0070691_10322628 3300005341 Bacteria 850
18 Ga0070661_100117437 3300005344 Bacteria 1990
19 Ga0070661_100354557 3300005344 Bacteria 1152
20 Ga0070661_100488379 3300005344 Bacteria 984
21 Ga0070692_10343716 3300005345 Bacteria 925
22 Ga0070668_100020138 3300005347 Bacteria 5030
23 Ga0070668_100082807 3300005347 Bacteria 2517
24 Ga0070668_100149222 3300005347 Bacteria 1889
25 Ga0070668_101030286 3300005347 Bacteria 741
26 Ga0070668_101740121 3300005347 Bacteria 573
27 Ga0070675_100629680 3300005354 Bacteria 974
28 Ga0070675_100955713 3300005354 Bacteria 786
29 Ga0070675_100992953 3300005354 Bacteria 771
30 Ga0070671_100199444 3300005355 Bacteria 1697
31 Ga0070671_100293049 3300005355 Bacteria 1385
32 Ga0070671_100700038 3300005355 Bacteria 879
33 Ga0070671_101399592 3300005355 Bacteria 618
34 Ga0070674_100012892 3300005356 Bacteria 5148
35 Ga0070674_100725433 3300005356 Bacteria 852
36 Ga0070674_101076238 3300005356 Bacteria 709
37 Ga0070673_100594469 3300005364 Bacteria 1009
38 Ga0070688_101271248 3300005365 Bacteria 593
39 Ga0070659_100054064 3300005366 Bacteria 3162
40 Ga0070667_100866577 3300005367 Bacteria 840
41 Ga0070667_101780338 3300005367 Bacteria 580
42 Ga0070709_10094317 3300005434 Bacteria 1980
43 Ga0070714_100119792 3300005435 Bacteria 2340
44 Ga0070713_100674350 3300005436 Bacteria 986
45 Ga0070713_100846209 3300005436 Bacteria 878
46 Ga0070711_100148707 3300005439 Bacteria 1764
47 Ga0070705_100516534 3300005440 Bacteria 909
48 Ga0070708_100366968 3300005445 Bacteria 1357
49 Ga0070663_100027234 3300005455 Bacteria 3879
50 Ga0070663_100042566 3300005455 Bacteria 3192
51 Ga0070663_100084169 3300005455 Bacteria 2344
52 Ga0070663_100104819 3300005455 Bacteria 2115
53 Ga0070663_100108695 3300005455 Bacteria 2081
54 Ga0070663_100824392 3300005455 Bacteria 797
55 Ga0070663_100948401 3300005455 Bacteria 746
56 Ga0070678_100010735 3300005456 Bacteria 5610
57 Ga0070678_100192691 3300005456 Bacteria 1677
58 Ga0070678_100226667 3300005456 Bacteria 1556
59 Ga0070678_100365827 3300005456 Bacteria 1244
60 Ga0070678_100554488 3300005456 Bacteria 1021
61 Ga0070681_11459141 3300005458 Bacteria 608
62 Ga0068867_100289215 3300005459 Bacteria 1347
63 Ga0068867_100297791 3300005459 Bacteria 1329
64 Ga0068867_101419350 3300005459 Bacteria 644
65 Ga0068867_101681634 3300005459 Bacteria 595
66 Ga0070698_100114046 3300005471 Bacteria 2667
67 Ga0070699_100291309 3300005518 Bacteria 1464
68 Ga0070684_100056833 3300005535 Bacteria 3416
69 Ga0068853_100099542 3300005539 Bacteria 2568
70 Ga0068853_100159297 3300005539 Bacteria 2036
71 Ga0068853_100183956 3300005539 Bacteria 1896
72 Ga0070672_100398198 3300005543 Bacteria 1180
73 Ga0070672_100637914 3300005543 Bacteria 930
74 Ga0070672_100774919 3300005543 Bacteria 843
75 Ga0070686_100032442 3300005544 Bacteria 3203
76 Ga0070686_100965924 3300005544 Bacteria 697
77 Ga0070693_100892213 3300005547 Bacteria 666
78 Ga0070665_100012119 3300005548 Bacteria 8699
79 Ga0070665_100020627 3300005548 Bacteria 6621
80 Ga0070665_100049165 3300005548 Bacteria 4231
81 Ga0070665_100079003 3300005548 Bacteria 3296
82 Ga0070665_100209162 3300005548 Bacteria 1951
83 Ga0070665_100437233 3300005548 Bacteria 1317
84 Ga0068855_100032685 3300005563 Bacteria 6212
85 Ga0068855_100044257 3300005563 Bacteria 5269
86 Ga0070664_100254507 3300005564 Bacteria 1579
87 Ga0070664_101591426 3300005564 Bacteria 619
88 Ga0068857_100017606 3300005577 Bacteria 6264
89 Ga0068857_100049245 3300005577 Bacteria 3738
90 Ga0068857_100294536 3300005577 Bacteria 1495
91 Ga0068854_100011322 3300005578 Bacteria 5801
92 Ga0068856_100017676 3300005614 Bacteria 6913
93 Ga0068856_100029867 3300005614 Bacteria 5327
94 Ga0068856_100038322 3300005614 Bacteria 4705
95 Ga0068856_100200080 3300005614 Bacteria 2012
96 Ga0068856_101157036 3300005614 Bacteria 790
97 Ga0068856_101286381 3300005614 Bacteria 747
98 Ga0070702_100366181 3300005615 Bacteria 1020
99 Ga0068852_100010356 3300005616 Bacteria 6964
100 Ga0068852_100299168 3300005616 Bacteria 1557
101 Ga0068852_100416072 3300005616 Bacteria 1325
102 Ga0068859_100128041 3300005617 Bacteria 2609
103 Ga0068859_101234155 3300005617 Bacteria 823
104 Ga0068864_100008346 3300005618 Bacteria 8547
105 Ga0068864_100096309 3300005618 Bacteria 2619
106 Ga0068866_10357806 3300005718 Bacteria 929
107 Ga0068861_100015059 3300005719 Bacteria 5442
108 Ga0068861_100043296 3300005719 Bacteria 3378
109 Ga0068861_100223322 3300005719 Bacteria 1593
110 Ga0068851_10004632 3300005834 Bacteria 6209
111 Ga0068851_10136216 3300005834 Bacteria 1332
112 Ga0068851_10499890 3300005834 Bacteria 729
113 Ga0068870_10048842 3300005840 Bacteria 2230
114 Ga0068870_10054425 3300005840 Bacteria 2128
115 Ga0068863_100290262 3300005841 Bacteria 1585
116 Ga0068858_100072200 3300005842 Bacteria 3202
117 Ga0068858_100866408 3300005842 Bacteria 882
118 Ga0068858_101033756 3300005842 Bacteria 806
119 Ga0068860_100418695 3300005843 Bacteria 1327
120 Ga0068860_100428046 3300005843 Bacteria 1313
121 Ga0068862_100040575 3300005844 Bacteria 3956
122 Ga0068862_100438182 3300005844 Bacteria 1229
123 Ga0068862_100491203 3300005844 Bacteria 1164
124 Ga0068862_100672706 3300005844 Bacteria 1000
125 Ga0068862_101080779 3300005844 Bacteria 797
126 Ga0081455_10017511 3300005937 Bacteria 6865
127 Ga0081455_10097190 3300005937 Bacteria 2373
128 Ga0081455_10250098 3300005937 Bacteria 1297
129 Ga0081540_1002910 3300005983 Bacteria 13803
130 Ga0081540_1019255 3300005983 Bacteria 4156
131 Ga0081540_1033394 3300005983 Bacteria 2795
132 Ga0081540_1040498 3300005983 Bacteria 2428
133 Ga0081540_1073868 3300005983 Bacteria 1565
134 Ga0081539_10153687 3300005985 Bacteria 1104
135 Ga0075365_10127645 3300006038 Bacteria 1758
136 Ga0075365_10429149 3300006038 Bacteria 933
137 Ga0075368_10026913 3300006042 Bacteria 2214
138 Ga0075363_100018622 3300006048 Bacteria 3463
139 Ga0075364_10014703 3300006051 Bacteria 4840
140 Ga0070716_100201767 3300006173 Bacteria 1323
141 Ga0070712_101364142 3300006175 Bacteria 618
142 Ga0075367_10120808 3300006178 Bacteria 1614
143 Ga0075367_10263713 3300006178 Bacteria 1082
144 Ga0075369_10019242 3300006186 Bacteria 2786
145 Ga0097621_100128336 3300006237 Bacteria 2156
146 Ga0097621_100690948 3300006237 Bacteria 939
147 Ga0075370_10129298 3300006353 Bacteria 1473
148 Ga0075370_10284329 3300006353 Bacteria 983
149 Ga0075370_10303386 3300006353 Bacteria 950
150 Ga0075428_100776917 3300006844 Bacteria 1019
151 Ga0075434_100103752 3300006871 Bacteria 2852
152 Ga0068865_100244156 3300006881 Bacteria 1414
153 Ga0068865_100487988 3300006881 Bacteria 1025
154 Ga0068865_100842515 3300006881 Bacteria 794
155 Ga0068865_100879824 3300006881 Bacteria 778
156 Ga0097620_100128041 3300006931 Bacteria 2609
157 Ga0097620_100912233 3300006931 Bacteria 963
158 Ga0097620_101234172 3300006931 Bacteria 823
159 Ga0105250_10126513 3300009092 Bacteria 1053
160 Ga0105240_10039455 3300009093 Bacteria 6048
161 Ga0105240_10068104 3300009093 Bacteria 4410
162 Ga0105240_10095898 3300009093 Bacteria 3616
163 Ga0111539_10151936 3300009094 Bacteria 2710
164 Ga0105245_10019388 3300009098 Bacteria 5957
165 Ga0105245_10521037 3300009098 Bacteria 1207
166 Ga0105247_10119455 3300009101 Bacteria 1706
167 Ga0105247_10196799 3300009101 Bacteria 1352
168 Ga0105247_11299599 3300009101 Bacteria 584
169 Ga0105243_10017890 3300009148 Bacteria 5362
170 Ga0105243_10385080 3300009148 Bacteria 1298
171 Ga0105243_10436678 3300009148 Bacteria 1225
172 Ga0105243_10869015 3300009148 Bacteria 894
173 Ga0105241_10001591 3300009174 Bacteria 17365
174 Ga0105241_10006113 3300009174 Bacteria 8873
175 Ga0105241_11236147 3300009174 Bacteria 709
176 Ga0105242_10081456 3300009176 Bacteria 2707
177 Ga0105242_10381808 3300009176 Bacteria 1310
178 Ga0105248_10008167 3300009177 Bacteria 11498
179 Ga0105248_10054220 3300009177 Bacteria 4496
180 Ga0105248_10738984 3300009177 Bacteria 1110
181 Ga0105248_10846780 3300009177 Bacteria 1032
182 Ga0105237_10015594 3300009545 Bacteria 7904
183 Ga0105237_10047056 3300009545 Bacteria 4337
184 Ga0105237_11525884 3300009545 Bacteria 675
185 Ga0105238_10001649 3300009551 Bacteria 22390
186 Ga0105238_10002262 3300009551 Bacteria 19393
187 Ga0105238_10530362 3300009551 Bacteria 1180
188 Ga0105238_10604592 3300009551 Bacteria 1105
189 Ga0105238_10754764 3300009551 Bacteria 987
190 Ga0105238_11703356 3300009551 Bacteria 661
191 Ga0105249_10145916 3300009553 Bacteria 2274
192 Ga0105249_11676705 3300009553 Bacteria 708
193 Ga0105239_10034643 3300010375 Bacteria 5546
194 Ga0105239_10038968 3300010375 Bacteria 5205
195 Ga0105239_10063799 3300010375 Bacteria 4044
196 Ga0105239_11007042 3300010375 Bacteria 958
197 Ga0105246_10034347 3300011119 Bacteria 3378
198 Ga0105246_10120031 3300011119 Bacteria 1946
199 Ga0105246_10239680 3300011119 Bacteria 1433
200 Ga0157370_10126430 3300013104 Bacteria 2386
201 Ga0157374_10020966 3300013296 Bacteria 5807
202 Ga0157378_11884872 3300013297 Unclassified 647
203 Ga0163162_10306185 3300013306 Bacteria 1721
204 Ga0163162_11025497 3300013306 Bacteria 933
205 Ga0163162_11176027 3300013306 Bacteria 870
206 Ga0157375_10008608 3300013308 Bacteria 8934
207 Ga0157375_10489571 3300013308 Bacteria 1394
208 Ga0157375_10576272 3300013308 Bacteria 1286
209 Ga0157375_10576410 3300013308 Bacteria 1286
210 Ga0157375_11280238 3300013308 Bacteria 861
211 Ga0157375_11436425 3300013308 Bacteria 813
212 Ga0163163_10022575 3300014325 Bacteria 5962
213 Ga0163163_10069756 3300014325 Bacteria 3500
214 Ga0163163_10284783 3300014325 Bacteria 1704
215 Ga0157380_10167044 3300014326 Bacteria 1918
216 Ga0157380_11442347 3300014326 Bacteria 740
217 Ga0157377_10083329 3300014745 Bacteria 1873
218 Ga0157377_10241924 3300014745 Bacteria 1165
219 Ga0157377_10253983 3300014745 Bacteria 1141
220 Ga0157377_10938933 3300014745 Bacteria 650
221 Ga0157379_10031034 3300014968 Bacteria 4761
222 Ga0157379_10141903 3300014968 Bacteria 2165
223 Ga0157379_10162634 3300014968 Bacteria 2015
224 Ga0157379_10343402 3300014968 Bacteria 1366
225 Ga0157376_10003124 3300014969 Bacteria 11381
226 Ga0157376_10297542 3300014969 Bacteria 1526
227 Ga0157376_10831801 3300014969 Bacteria 938
228 Ga0163161_10027466 3300017792 Bacteria 4037
229 Ga0163161_10251644 3300017792 Bacteria 1377
230 Ga0163161_11570310 3300017792 Bacteria 579
231 Ga0213872_10058614 3300021361 Bacteria 1743
232 Ga0213874_10004410 3300021377 Bacteria 3211
233 Ga0213876_10123176 3300021384 Bacteria 1377
234 Ga0209758_1030732 3300025297 Bacteria 2218
235 Ga0207697_10281314 3300025315 Bacteria 737
236 Ga0207656_10081505 3300025321 Bacteria 1455
237 Ga0207696_1135086 3300025711 Bacteria 662
238 Ga0207653_10198563 3300025885 Bacteria 756
239 Ga0207642_10413781 3300025899 Bacteria 809
240 Ga0207710_10065340 3300025900 Bacteria 1658
241 Ga0207688_10202401 3300025901 Bacteria 1191
242 Ga0207688_10204360 3300025901 Bacteria 1185
243 Ga0207688_10968556 3300025901 Bacteria 538
244 Ga0207680_10247954 3300025903 Bacteria 1229
245 Ga0207680_10280992 3300025903 Bacteria 1156
246 Ga0207647_10000650 3300025904 Bacteria 27172
247 Ga0207645_10199550 3300025907 Bacteria 1316
248 Ga0207643_10036580 3300025908 Bacteria 2753
249 Ga0207643_10154273 3300025908 Bacteria 1379
250 Ga0207684_10979638 3300025910 Bacteria 708
251 Ga0207654_10000525 3300025911 Bacteria 21963
252 Ga0207654_10021653 3300025911 Bacteria 3421
253 Ga0207695_10001482 3300025913 Bacteria 39262
254 Ga0207695_10138646 3300025913 Bacteria 2384
255 Ga0207671_10611850 3300025914 Bacteria 868
256 Ga0207671_10893439 3300025914 Unclassified 703
257 Ga0207693_10802161 3300025915 Bacteria 726
258 Ga0207663_10235603 3300025916 Bacteria 1340
259 Ga0207662_11025810 3300025918 Bacteria 586
260 Ga0207657_10175558 3300025919 Bacteria 1734
261 Ga0207657_10273548 3300025919 Bacteria 1342
262 Ga0207649_10149745 3300025920 Bacteria 1606
263 Ga0207649_10313076 3300025920 Bacteria 1151
264 Ga0207649_10609194 3300025920 Bacteria 840
265 Ga0207681_10441236 3300025923 Bacteria 1058
266 Ga0207694_10000952 3300025924 Bacteria 25574
267 Ga0207694_10028384 3300025924 Bacteria 4266
268 Ga0207694_10372724 3300025924 Bacteria 1184
269 Ga0207694_10804453 3300025924 Bacteria 794
270 Ga0207694_10900492 3300025924 Bacteria 748
271 Ga0207650_10472443 3300025925 Bacteria 1046
272 Ga0207650_10569131 3300025925 Bacteria 951
273 Ga0207687_10025205 3300025927 Bacteria 3979
274 Ga0207687_10386932 3300025927 Bacteria 1147
275 Ga0207700_10572565 3300025928 Bacteria 1004
276 Ga0207664_11456313 3300025929 Bacteria 606
277 Ga0207644_10087423 3300025931 Bacteria 2317
278 Ga0207644_10374721 3300025931 Bacteria 1160
279 Ga0207690_10689565 3300025932 Bacteria 839
280 Ga0207690_10844954 3300025932 Bacteria 758
281 Ga0207706_10461970 3300025933 Bacteria 1098
282 Ga0207706_10502466 3300025933 Bacteria 1047
283 Ga0207686_10036156 3300025934 Bacteria 2971
284 Ga0207686_10267205 3300025934 Bacteria 1257
285 Ga0207709_10074330 3300025935 Bacteria 2168
286 Ga0207709_10381232 3300025935 Bacteria 1073
287 Ga0207670_10169659 3300025936 Bacteria 1635
288 Ga0207669_10002209 3300025937 Bacteria 8269
289 Ga0207669_10518941 3300025937 Bacteria 956
290 Ga0207704_10105399 3300025938 Bacteria 1891
291 Ga0207704_10321608 3300025938 Bacteria 1194
292 Ga0207691_10355177 3300025940 Bacteria 1253
293 Ga0207711_10029080 3300025941 Bacteria 4658
294 Ga0207711_10151196 3300025941 Bacteria 2095
295 Ga0207711_10867927 3300025941 Bacteria 839
296 Ga0207689_10012651 3300025942 Bacteria 7209
297 Ga0207689_10033276 3300025942 Bacteria 4284
298 Ga0207689_10109667 3300025942 Bacteria 2268
299 Ga0207689_10160860 3300025942 Bacteria 1850
300 Ga0207661_10172390 3300025944 Bacteria 1884
301 Ga0207667_10009603 3300025949 Bacteria 11382
302 Ga0207667_10026327 3300025949 Bacteria 6357
303 Ga0207667_10359550 3300025949 Bacteria 1484
304 Ga0207651_10173494 3300025960 Bacteria 1703
305 Ga0207668_10003350 3300025972 Bacteria 9390
306 Ga0207668_10373272 3300025972 Bacteria 1198
307 Ga0207668_10657831 3300025972 Bacteria 917
308 Ga0207668_10847354 3300025972 Bacteria 811
309 Ga0207668_11140572 3300025972 Bacteria 699
310 Ga0207640_10003151 3300025981 Bacteria 8878
311 Ga0207658_10571751 3300025986 Bacteria 1013
312 Ga0207658_11039170 3300025986 Bacteria 748
313 Ga0207677_10056622 3300026023 Bacteria 2687
314 Ga0207677_10472573 3300026023 Bacteria 1079
315 Ga0207677_10489947 3300026023 Bacteria 1061
316 Ga0207703_10027121 3300026035 Bacteria 4511
317 Ga0207703_11532139 3300026035 Bacteria 641
318 Ga0207639_10136854 3300026041 Bacteria 2036
319 Ga0207639_10180491 3300026041 Bacteria 1795
320 Ga0207639_10270610 3300026041 Bacteria 1490
321 Ga0207639_10275847 3300026041 Bacteria 1477
322 Ga0207639_10508340 3300026041 Bacteria 1102
323 Ga0207678_10012691 3300026067 Bacteria 7401
324 Ga0207678_10016243 3300026067 Bacteria 6533
325 Ga0207678_10041577 3300026067 Bacteria 3986
326 Ga0207678_10054978 3300026067 Bacteria 3428
327 Ga0207678_10095783 3300026067 Bacteria 2536
328 Ga0207678_10114669 3300026067 Bacteria 2299
329 Ga0207678_10201279 3300026067 Bacteria 1703
330 Ga0207678_10287054 3300026067 Bacteria 1413
331 Ga0207678_10406637 3300026067 Bacteria 1179
332 Ga0207678_10408922 3300026067 Bacteria 1176
333 Ga0207678_10725466 3300026067 Bacteria 875
334 Ga0207702_10000093 3300026078 Bacteria 103678
335 Ga0207702_10019431 3300026078 Bacteria 5622
336 Ga0207641_10375193 3300026088 Bacteria 1361
337 Ga0207648_10097140 3300026089 Bacteria 2578
338 Ga0207648_10330673 3300026089 Bacteria 1371
339 Ga0207648_10630968 3300026089 Bacteria 989
340 Ga0207648_10696892 3300026089 Bacteria 941
341 Ga0207648_11770985 3300026089 Bacteria 579
342 Ga0207676_10028673 3300026095 Bacteria 4160
343 Ga0207676_10084538 3300026095 Bacteria 2587
344 Ga0207676_11335768 3300026095 Bacteria 712
345 Ga0207674_10011067 3300026116 Bacteria 10144
346 Ga0207674_10015216 3300026116 Bacteria 8464
347 Ga0207674_10070390 3300026116 Bacteria 3517
348 Ga0207675_100030583 3300026118 Bacteria 5016
349 Ga0207675_100057302 3300026118 Bacteria 3635
350 Ga0207675_100471043 3300026118 Bacteria 1247
351 Ga0207683_10004913 3300026121 Bacteria 11497
352 Ga0207683_10026290 3300026121 Bacteria 5023
353 Ga0207683_10178095 3300026121 Bacteria 1927
354 Ga0207683_10239422 3300026121 Bacteria 1655
355 Ga0207683_10335362 3300026121 Bacteria 1386
356 Ga0207683_10352808 3300026121 Bacteria 1350
357 Ga0207698_10060013 3300026142 Bacteria 2956
358 Ga0207698_11254532 3300026142 Bacteria 755
359 Ga0268266_10026661 3300028379 Bacteria 4916
360 Ga0268266_10030100 3300028379 Bacteria 4612
361 Ga0268266_10064177 3300028379 Bacteria 3172
362 Ga0268266_10506176 3300028379 Bacteria 1153
363 Ga0268265_10075534 3300028380 Bacteria 2640
364 Ga0268265_10327299 3300028380 Bacteria 1390
365 Ga0268265_10355826 3300028380 Bacteria 1338
366 Ga0268265_10788015 3300028380 Bacteria 925
367 Ga0268264_10197903 3300028381 Bacteria 1836
368 Ga0268264_10377107 3300028381 Bacteria 1357
369 Ga0307517_10141563 3300028786 Bacteria 1686
370 Ga0307512_10162228 3300030522 Bacteria 1306
371 Ga0307512_10352279 3300030522 Bacteria 648
372 Ga0307512_10396356 3300030522 Bacteria 582
373 Ga0307513_10055674 3300031456 Bacteria 4230
374 Ga0307513_10212331 3300031456 Bacteria 1765
375 Ga0307509_10047106 3300031507 Bacteria 4638
376 Ga0307408_100143638 3300031548 Bacteria 1876
377 Ga0307508_10025902 3300031616 Bacteria 5318
378 Ga0265314_10088928 3300031711 Bacteria 2016
379 Ga0307516_10129782 3300031730 Bacteria 2301
380 Ga0307516_10160922 3300031730 Bacteria 1995
381 Ga0307405_10212002 3300031731 Bacteria 1415
382 Ga0307409_100815680 3300031995 Bacteria 942
383 Ga0307416_100413809 3300032002 Bacteria 1390
384 Ga0307416_100641226 3300032002 Bacteria 1146
385 Ga0307414_10326628 3300032004 Bacteria 1308
386 Ga0307411_10234625 3300032005 Bacteria 1432
387 Ga0307411_10564259 3300032005 Bacteria 973
388 Ga0307415_100157630 3300032126 Bacteria 1755
389 Ga0307415_100167848 3300032126 Bacteria 1708
390 Ga0307415_100222401 3300032126 Bacteria 1514
391 Ga0307415_101111332 3300032126 Bacteria 740
392 Ga0307507_10287978 3300033179 Bacteria 1020
393 Ga0307510_10035347 3300033180 Bacteria 5582
394 Ga0373938_0030655 3300034957 Bacteria 1149
395 Ga0373929_0023534 3300035085 Bacteria 1266
396 Ga0373944_0052875 3300035089 Bacteria 1284
397 Ga0373951_0121456 3300035091 Bacteria 711
398 Ga0373936_0082535 3300035113 Bacteria 1340
399 Ga0373936_0201931 3300035113 Bacteria 878
400 Ga0373924_0146515 3300035410 Bacteria 1032
401 Ga0373931_0073457 3300035691 Bacteria 1871
402 Ga0373931_0169703 3300035691 Bacteria 1285
403 Ga0373927_0030540 3300035695 Bacteria 3515
404 Ga0373927_0152905 3300035695 Bacteria 1511
405 Ga0373927_0271261 3300035695 Bacteria 1116
406 Ga0373947_0105455 3300035725 Bacteria 1776
407 Ga0373947_0352338 3300035725 Bacteria 988
408 Ga0373925_0181332 3300037068 Bacteria 1667
409 Ga0373925_1086655 3300037068 Bacteria 658
410 Ga0395900_0701099 3300037418 Bacteria 946
411 Ga0395898_0037844 3300037466 Bacteria 4783
412 Ga0395905_0108394 3300037471 Bacteria 2607
413 Ga0395905_0144208 3300037471 Bacteria 2241
414 Ga0395901_0480452 3300038443 Bacteria 1267
415 Ga0436365_0218335 3300039437 Bacteria 2698
416 Ga0436361_0718305 3300039447 Bacteria 877
417 Ga0436363_1481065 3300039450 Bacteria 5785
418 Ga0451789_0087561 3300041443 Unclassified 587
419 Ga0451797_1499889 3300041453 Bacteria 766
420 Ga0451798_0753749 3300041458 Bacteria 520
421 Ga0451800_0050083 3300041459 Bacteria 584
422 Ga0451807_1860363 3300041486 Bacteria 1278
423 Ga0451839_1140605 3300041496 Bacteria 600
424 Ga0451851_1318226 3300041507 Bacteria 1705
425 Ga0451843_1590620 3300041509 Bacteria 664
426 Ga0451853_4097277 3300041512 Bacteria 661
427 Ga0439431_0061232 3300041997 Bacteria 990
428 Ga0466969_0054980 3300044656 Bacteria 1949
429 Ga0466959_0048207 3300045049 Bacteria 3131
430 Ga0495617_109187 3300046452 Bacteria 895
431 Ga0495603_0016916 3300046455 Bacteria 4413
432 Ga0495603_0091876 3300046455 Bacteria 1774
433 Ga0495629_0187375 3300046459 Bacteria 1433
434 Ga0495638_0522269 3300046460 Bacteria 594
435 Ga0495641_0123125 3300046461 Bacteria 1157
436 Ga0495651_0217530 3300046462 Bacteria 1325
437 Ga0495580_0354230 3300046472 Bacteria 994
438 Ga0495582_0570051 3300046473 Bacteria 655
439 Ga0495605_0194100 3300046474 Bacteria 887
440 Ga0495639_0017157 3300046475 Bacteria 3145
441 Ga0495639_0043263 3300046475 Bacteria 2034
442 Ga0495639_0698245 3300046475 Bacteria 524
443 Ga0495584_0064631 3300046491 Bacteria 1840
444 Ga0495584_0211796 3300046491 Bacteria 985
445 Ga0495585_0063894 3300046492 Bacteria 2019
446 Ga0495585_0135444 3300046492 Bacteria 1293
447 Ga0495594_0303732 3300046499 Bacteria 909
448 Ga0495594_0307345 3300046499 Bacteria 903
449 Ga0495606_0269049 3300046507 Bacteria 937
450 Ga0495608_0265146 3300046511 Bacteria 1069
451 Ga0495608_0285248 3300046511 Bacteria 1024
452 Ga0495616_0132589 3300046513 Bacteria 1140
453 Ga0495616_0258203 3300046513 Bacteria 746
454 Ga0495620_0160780 3300046515 Bacteria 873
455 Ga0495630_1012772 3300046517 Bacteria 631
456 Ga0495631_0100351 3300046518 Bacteria 1246
457 Ga0495631_0165660 3300046518 Bacteria 948
458 Ga0495632_0248560 3300046519 Bacteria 798
459 Ga0495644_0427880 3300046523 Bacteria 525
460 Ga0495663_0126279 3300046525 Bacteria 860
461 Ga0495666_0018694 3300046526 Bacteria 3444
462 Ga0495666_0062733 3300046526 Bacteria 1775
463 Ga0495642_0047123 3300046528 Bacteria 1764
464 Ga0495652_0574670 3300046529 Bacteria 772
465 Ga0495654_0222445 3300046530 Bacteria 798
466 Ga0495665_0065505 3300046531 Bacteria 1918
467 Ga0495598_0037748 3300046537 Bacteria 1395
468 Ga0495621_0089769 3300046539 Bacteria 1157
469 Ga0495597_0093503 3300046542 Bacteria 1274
470 Ga0495645_0089299 3300046543 Bacteria 2204
471 Ga0495645_0449832 3300046543 Bacteria 812
472 Ga0495622_0031207 3300046557 Bacteria 2491
473 Ga0495633_0306277 3300046558 Bacteria 721
474 Ga0495656_0002292 3300046615 Bacteria 6320
475 Ga0495656_0040271 3300046615 Bacteria 1946
476 Ga0495656_0188966 3300046615 Bacteria 1016
477 Ga0495611_0087374 3300046648 Bacteria 1439
478 Ga0495611_0152672 3300046648 Bacteria 1078
479 Ga0495611_0372607 3300046648 Bacteria 654
480 Ga0495625_0289994 3300046660 Bacteria 1050
481 Ga0495625_0488858 3300046660 Bacteria 754
482 Ga0495661_0286840 3300046665 Bacteria 828
483 Ga0495657_0204401 3300046675 Bacteria 1203
484 Ga0495669_0003823 3300046684 Bacteria 6186
485 Ga0495669_0152535 3300046684 Bacteria 1094
486 Ga0495624_0437682 3300046690 Bacteria 784
487 Ga0495670_0219173 3300046691 Bacteria 1010
488 Ga0495671_0128186 3300046692 Bacteria 1237
489 Ga0495671_0526659 3300046692 Bacteria 563
490 Ga0495589_0086045 3300046794 Bacteria 1527
491 Ga0495660_0264990 3300046810 Bacteria 792
492 Ga0495581_0102629 3300047315 Bacteria 1662
493 Ga0495581_0250984 3300047315 Bacteria 1035
494 Ga0495581_0879639 3300047315 Bacteria 512
495 Ga0495604_0916546 3300047317 Bacteria 547
496 Ga0495636_0040000 3300047318 Bacteria 1943
497 Ga0495636_0048424 3300047318 Bacteria 1776
498 Ga0495674_0539448 3300047319 Bacteria 930
499 Ga0495676_0441385 3300047321 Bacteria 859
500 Ga0495673_0162190 3300047469 Bacteria 857
501 Ga0495681_0106693 3300047470 Bacteria 1218
502 Ga0495615_0003505 3300048090 Bacteria 2636
503 Ga0495615_0075921 3300048090 Bacteria 914
504 Ga0496100_0081353 3300048903 Bacteria 2188
505 Ga0496100_0368323 3300048903 Bacteria 1089
506 Ga0496101_0000888 3300048904 Bacteria 17608
507 Ga0496101_0334182 3300048904 Bacteria 1189
508 Ga0496101_0394796 3300048904 Bacteria 1089
509 Ga0496101_1603727 3300048904 Bacteria 506
510 Ga0496102_0011329 3300048905 Bacteria 7685
511 Ga0496102_0019609 3300048905 Bacteria 5957
512 Ga0496102_1669259 3300048905 Bacteria 555
513 Ga0496103_0004079 3300048906 Bacteria 8872
514 Ga0496103_0025948 3300048906 Bacteria 3545
515 Ga0496104_0052100 3300048907 Bacteria 3865
516 Ga0496104_0178525 3300048907 Bacteria 2033
517 Ga0496105_0043545 3300048908 Bacteria 3702
518 Ga0496105_0108711 3300048908 Bacteria 2289
519 Ga0496106_0028016 3300048909 Bacteria 4194
520 Ga0496106_0048589 3300048909 Bacteria 3195
521 Ga0496106_0127446 3300048909 Bacteria 1994
522 Ga0496107_0052274 3300048910 Bacteria 2947
523 Ga0496107_0719011 3300048910 Bacteria 734
524 Ga0496108_0025879 3300048911 Bacteria 4839
525 Ga0496108_0054965 3300048911 Bacteria 3342
526 Ga0496108_0174338 3300048911 Bacteria 1861
527 Ga0496108_0252089 3300048911 Bacteria 1535
528 Ga0496109_0092503 3300048912 Bacteria 2797
529 Ga0496109_0118386 3300048912 Bacteria 2466
530 Ga0496109_0179515 3300048912 Bacteria 1988
531 Ga0496109_0486704 3300048912 Bacteria 1165
532 Ga0496109_0547550 3300048912 Bacteria 1092
533 Ga0496110_0016411 3300048913 Bacteria 6182
534 Ga0496110_0067472 3300048913 Bacteria 3165
535 Ga0496110_1076362 3300048913 Bacteria 712
536 Ga0496111_0006306 3300048914 Bacteria 7692
537 Ga0496111_0100485 3300048914 Bacteria 2124
538 Ga0496111_0418111 3300048914 Bacteria 990
539 Ga0496112_0000036 3300048915 Bacteria 106325
540 Ga0496112_0034413 3300048915 Bacteria 4930
541 Ga0496112_0076154 3300048915 Bacteria 3318
542 Ga0496112_0277548 3300048915 Bacteria 1623
543 Ga0496112_0816112 3300048915 Bacteria 857
544 Ga0496113_0005645 3300048916 Bacteria 7830
545 Ga0496113_0052041 3300048916 Bacteria 3057
546 Ga0496113_0088182 3300048916 Bacteria 2386
547 Ga0496114_0017474 3300048917 Bacteria 5789
548 Ga0496114_0102935 3300048917 Bacteria 2440
549 Ga0496114_0146718 3300048917 Bacteria 2045
550 Ga0496115_0012999 3300048918 Bacteria 6282
551 Ga0496115_0038231 3300048918 Bacteria 3807
552 Ga0496115_0191950 3300048918 Bacteria 1688
553 Ga0496115_0303245 3300048918 Bacteria 1309
554 Ga0496115_0567243 3300048918 Bacteria 906
555 Ga0496117_0040827 3300048920 Bacteria 3408
556 Ga0496117_0246706 3300048920 Bacteria 977
557 Ga0496118_0258072 3300048921 Bacteria 986
558 Ga0496118_0459446 3300048921 Bacteria 644
559 Ga0496119_0085854 3300048922 Bacteria 1801
560 Ga0496120_0145514 3300048923 Bacteria 1198
561 Ga0496121_0011255 3300048924 Bacteria 9969
562 Ga0496121_0038835 3300048924 Bacteria 4207
563 Ga0496121_0163406 3300048924 Bacteria 1625
564 Ga0496121_0202557 3300048924 Bacteria 1413
565 Ga0496121_0592987 3300048924 Bacteria 685
566 Ga0496121_0657550 3300048924 Bacteria 637
567 Ga0496124_0256329 3300048927 Bacteria 1290
568 Ga0496125_0087853 3300048928 Bacteria 2346
569 Ga0496125_0198423 3300048928 Bacteria 1317
570 Ga0496126_0003429 3300048929 Bacteria 20002
571 Ga0496126_0026540 3300048929 Bacteria 5551
572 Ga0496126_0178048 3300048929 Bacteria 1808
573 Ga0496126_0195161 3300048929 Bacteria 1712
574 Ga0496126_0257182 3300048929 Bacteria 1453
575 Ga0496126_0514427 3300048929 Bacteria 955
576 Ga0501036_0093000 3300049572 Bacteria 2548
577 Ga0501040_0405130 3300049576 Bacteria 980
578 Ga0501042_0383477 3300049578 Bacteria 1018
579 Ga0501046_0588126 3300049580 Bacteria 791
580 Ga0501067_0059341 3300049583 Bacteria 2118
581 Ga0501067_0289465 3300049583 Bacteria 912
582 Ga0501071_0217427 3300049587 Bacteria 1438
583 Ga0501075_0383515 3300049591 Bacteria 1071
584 Ga0501076_0155382 3300049592 Bacteria 1862
585 Ga0501081_0372927 3300049743 Bacteria 1054
586 Ga0501045_0292691 3300049824 Bacteria 1212
587 Ga0501045_0768544 3300049824 Bacteria 710
588 nmdc:mga03683_297783_c1 3300050489 Bacteria 756
589 nmdc:mga03n38_369332_c1 3300050490 Bacteria 784
590 nmdc:mga03n38_89595_c1 3300050490 Bacteria 1462
591 nmdc:mga00v17_4739_c1 3300050491 Bacteria 7112
592 nmdc:mga00v17_723554_c1 3300050491 Bacteria 637
593 nmdc:mga0yw44_112882_c1 3300050492 Bacteria 1743
594 nmdc:mga0yw44_192127_c1 3300050492 Bacteria 1347
595 nmdc:mga0yw44_539563_c1 3300050492 Bacteria 792
596 nmdc:mga0k408_51871_c1 3300050493 Bacteria 2377
597 nmdc:mga06z11_249442_c1 3300050494 Bacteria 1045
598 nmdc:mga06z11_358628_c1 3300050494 Bacteria 874
599 nmdc:mga06z11_752020_c1 3300050494 Bacteria 594
600 nmdc:mga07m45_59301_c1 3300050496 Bacteria 2165
601 nmdc:mga0qj67_361740_c1 3300050509 Bacteria 1172
602 nmdc:mga08y16_282638_c1 3300050511 Bacteria 1711
603 nmdc:mga0n895_51311_c1 3300050512 Bacteria 4046
604 nmdc:mga0rr50_114043_c1 3300050513 Bacteria 2142
605 nmdc:mga0sz30_111209_c1 3300050516 Bacteria 1201
606 nmdc:mga0sz30_307758_c1 3300050516 Bacteria 707
607 Ga0495601_0072190 3300053077 Bacteria 2205
608 Ga0495601_0106195 3300053077 Bacteria 1816
609 Ga0495612_0227864 3300053078 Bacteria 826
610 Ga0500635_0182712 3300053080 Bacteria 811
611 Ga0495655_0310573 3300053083 Bacteria 544
612 Ga0495595_0033065 3300053084 Bacteria 2332
613 Ga0495619_0022284 3300053085 Bacteria 4052
614 Ga0495619_0130773 3300053085 Bacteria 1725
615 Ga0500643_018565 3300053087 Bacteria 2306
616 Ga0500644_0392936 3300053088 Bacteria 604
617 Ga0500581_262288 3300053089 Bacteria 716
618 Ga0500651_0108719 3300053093 Bacteria 1694
619 Ga0500566_0016247 3300053094 Bacteria 4369
620 Ga0500641_0017516 3300053096 Bacteria 2681
621 Ga0500641_0064031 3300053096 Bacteria 1536
622 Ga0500641_0304447 3300053096 Bacteria 653
623 Ga0500650_0244808 3300053098 Bacteria 806
624 Ga0500554_001834 3300053102 Bacteria 4102
625 Ga0500562_030062 3300053108 Bacteria 1430
626 Ga0500572_246399 3300053111 Bacteria 582
627 Ga0500595_000181 3300053119 Bacteria 42687
628 Ga0500595_002904 3300053119 Bacteria 8202
629 Ga0500655_018030 3300053133 Bacteria 1310
630 Ga0500658_0045511 3300053134 Bacteria 1774
631 Ga0500658_0244992 3300053134 Bacteria 823
632 Ga0500561_0135030 3300053137 Bacteria 761
633 Ga0500568_0086466 3300053139 Bacteria 1186
634 Ga0500577_0015940 3300053142 Bacteria 2359
635 Ga0500577_0022809 3300053142 Bacteria 2082
636 Ga0500603_006850 3300053150 Bacteria 2486
637 Ga0500604_0047826 3300053151 Bacteria 1312
638 Ga0500620_248931 3300053155 Bacteria 592
639 Ga0500633_0141457 3300053160 Bacteria 901
640 Ga0500638_006557 3300053162 Bacteria 4776
641 Ga0500636_0265770 3300053177 Bacteria 866
642 Ga0500637_0000116 3300053178 Bacteria 29193
643 Ga0500645_056829 3300053730 Bacteria 1135
644 Ga0500661_010790 3300055283 Bacteria 1660
645 Ga0501082_0254833 3300060353 Bacteria 1527
646 2513679231 2513237098 Bacteria 9902361
647 2513695549 2513237101 Bacteria 7952346
648 2524463620 2524023210 Bacteria 9029266
649 2723843944 2721755755 Bacteria 8322773
650 2723845443 2721755755 Bacteria 8322773
651 2793083369
652 2874607656 2874604998 Bacteria 7834745
653 2874612065 2874604998 Bacteria 7834745
654 2876811956 2876808645 Bacteria 8824342
655 2879113988 2879110137 Bacteria 8907982
656 2885389464 2885383462 Bacteria 9473874
657 2889040226 2889033259 Bacteria 9099371
658 2903774714 2903768456 Bacteria 9749579
659 2904700396
660 2922366291 2922361189 Bacteria 7436256
661 2922386644 2922386360 Bacteria 7017218
662 8006968068 8006964411 Bacteria 8966052
663 8006992252 8006984368 Bacteria 9651211
664 8006999356 8006994254 Bacteria 8309700
665 8056680021 8056673599 Bacteria 7871253
666 8056685804 8056681323 Bacteria 8472857
667 Ga0207707_10443609
668 JGI24737J22298_10004204
669 JGI24750J21931_1053744
670 rootH1_10076789
671 Ga0070676_10959834
672 Ga0070690_101247742
673 Ga0070670_100615230
674 Ga0070670_101450593
675 Ga0068869_100100565
676 Ga0068869_100152048
677 Ga0070666_10085468
678 Ga0070666_10480986
679 Ga0068868_100010220
680 Ga0068868_100570240
681 Ga0070660_100314550
682 Ga0070660_100405402
683 Ga0070691_10322628
684 Ga0070661_100117437
685 Ga0070661_100354557
686 Ga0070661_100488379
687 Ga0070692_10343716
688 Ga0070668_100020138
689 Ga0070668_100082807
690 Ga0070668_100149222
691 Ga0070668_101030286
692 Ga0070668_101740121
693 Ga0070675_100629680
694 Ga0070675_100955713
695 Ga0070675_100992953
696 Ga0070671_100199444
697 Ga0070671_100293049
698 Ga0070671_100700038
699 Ga0070671_101399592
700 Ga0070674_100012892
701 Ga0070674_100725433
702 Ga0070674_101076238
703 Ga0070673_100594469
704 Ga0070688_101271248
705 Ga0070659_100054064
706 Ga0070667_100866577
707 Ga0070667_101780338
708 Ga0070709_10094317
709 Ga0070714_100119792
710 Ga0070713_100674350
711 Ga0070713_100846209
712 Ga0070711_100148707
713 Ga0070705_100516534
714 Ga0070708_100366968
715 Ga0070663_100027234
716 Ga0070663_100042566
717 Ga0070663_100084169
718 Ga0070663_100104819
719 Ga0070663_100108695
720 Ga0070663_100824392
721 Ga0070663_100948401
722 Ga0070678_100010735
723 Ga0070678_100192691
724 Ga0070678_100226667
725 Ga0070678_100365827
726 Ga0070678_100554488
727 Ga0070681_11459141
728 Ga0068867_100289215
729 Ga0068867_100297791
730 Ga0068867_101419350
731 Ga0068867_101681634
732 Ga0070698_100114046
733 Ga0070699_100291309
734 Ga0070684_100056833
735 Ga0068853_100099542
736 Ga0068853_100159297
737 Ga0068853_100183956
738 Ga0070672_100398198
739 Ga0070672_100637914
740 Ga0070672_100774919
741 Ga0070686_100032442
742 Ga0070686_100965924
743 Ga0070693_100892213
744 Ga0070665_100012119
745 Ga0070665_100020627
746 Ga0070665_100049165
747 Ga0070665_100079003
748 Ga0070665_100209162
749 Ga0070665_100437233
750 Ga0068855_100032685
751 Ga0068855_100044257
752 Ga0070664_100254507
753 Ga0070664_101591426
754 Ga0068857_100017606
755 Ga0068857_100049245
756 Ga0068857_100294536
757 Ga0068854_100011322
758 Ga0068856_100017676
759 Ga0068856_100029867
760 Ga0068856_100038322
761 Ga0068856_100200080
762 Ga0068856_101157036
763 Ga0068856_101286381
764 Ga0070702_100366181
765 Ga0068852_100010356
766 Ga0068852_100299168
767 Ga0068852_100416072
768 Ga0068859_100128041
769 Ga0068859_101234155
770 Ga0068864_100008346
771 Ga0068864_100096309
772 Ga0068866_10357806
773 Ga0068861_100015059
774 Ga0068861_100043296
775 Ga0068861_100223322
776 Ga0068851_10004632
777 Ga0068851_10136216
778 Ga0068851_10499890
779 Ga0068870_10048842
780 Ga0068870_10054425
781 Ga0068863_100290262
782 Ga0068858_100072200
783 Ga0068858_100866408
784 Ga0068858_101033756
785 Ga0068860_100418695
786 Ga0068860_100428046
787 Ga0068862_100040575
788 Ga0068862_100438182
789 Ga0068862_100491203
790 Ga0068862_100672706
791 Ga0068862_101080779
792 Ga0081455_10017511
793 Ga0081455_10097190
794 Ga0081455_10250098
795 Ga0081540_1002910
796 Ga0081540_1019255
797 Ga0081540_1033394
798 Ga0081540_1040498
799 Ga0081540_1073868
800 Ga0081539_10153687
801 Ga0075365_10127645
802 Ga0075365_10429149
803 Ga0075368_10026913
804 Ga0075363_100018622
805 Ga0075364_10014703
806 Ga0070716_100201767
807 Ga0070712_101364142
808 Ga0075367_10120808
809 Ga0075367_10263713
810 Ga0075369_10019242
811 Ga0097621_100128336
812 Ga0097621_100690948
813 Ga0075370_10129298
814 Ga0075370_10284329
815 Ga0075370_10303386
816 Ga0075428_100776917
817 Ga0075434_100103752
818 Ga0068865_100244156
819 Ga0068865_100487988
820 Ga0068865_100842515
821 Ga0068865_100879824
822 Ga0097620_100128041
823 Ga0097620_100912233
824 Ga0097620_101234172
825 Ga0105250_10126513
826 Ga0105240_10039455
827 Ga0105240_10068104
828 Ga0105240_10095898
829 Ga0111539_10151936
830 Ga0105245_10019388
831 Ga0105245_10521037
832 Ga0105247_10119455
833 Ga0105247_10196799
834 Ga0105247_11299599
835 Ga0105243_10017890
836 Ga0105243_10385080
837 Ga0105243_10436678
838 Ga0105243_10869015
839 Ga0105241_10001591
840 Ga0105241_10006113
841 Ga0105241_11236147
842 Ga0105242_10081456
843 Ga0105242_10381808
844 Ga0105248_10008167
845 Ga0105248_10054220
846 Ga0105248_10738984
847 Ga0105248_10846780
848 Ga0105237_10015594
849 Ga0105237_10047056
850 Ga0105237_11525884
851 Ga0105238_10001649
852 Ga0105238_10002262
853 Ga0105238_10530362
854 Ga0105238_10604592
855 Ga0105238_10754764
856 Ga0105238_11703356
857 Ga0105249_10145916
858 Ga0105249_11676705
859 Ga0105239_10034643
860 Ga0105239_10038968
861 Ga0105239_10063799
862 Ga0105239_11007042
863 Ga0105246_10034347
864 Ga0105246_10120031
865 Ga0105246_10239680
866 Ga0157370_10126430
867 Ga0157374_10020966
868 Ga0157378_11884872
869 Ga0163162_10306185
870 Ga0163162_11025497
871 Ga0163162_11176027
872 Ga0157375_10008608
873 Ga0157375_10489571
874 Ga0157375_10576272
875 Ga0157375_10576410
876 Ga0157375_11280238
877 Ga0157375_11436425
878 Ga0163163_10022575
879 Ga0163163_10069756
880 Ga0163163_10284783
881 Ga0157380_10167044
882 Ga0157380_11442347
883 Ga0157377_10083329
884 Ga0157377_10241924
885 Ga0157377_10253983
886 Ga0157377_10938933
887 Ga0157379_10031034
888 Ga0157379_10141903
889 Ga0157379_10162634
890 Ga0157379_10343402
891 Ga0157376_10003124
892 Ga0157376_10297542
893 Ga0157376_10831801
894 Ga0163161_10027466
895 Ga0163161_10251644
896 Ga0163161_11570310
897 Ga0213872_10058614
898 Ga0213874_10004410
899 Ga0213876_10123176
900 Ga0209758_1030732
901 Ga0207697_10281314
902 Ga0207656_10081505
903 Ga0207696_1135086
904 Ga0207653_10198563
905 Ga0207642_10413781
906 Ga0207710_10065340
907 Ga0207688_10202401
908 Ga0207688_10204360
909 Ga0207688_10968556
910 Ga0207680_10247954
911 Ga0207680_10280992
912 Ga0207647_10000650
913 Ga0207645_10199550
914 Ga0207643_10036580
915 Ga0207643_10154273
916 Ga0207684_10979638
917 Ga0207654_10000525
918 Ga0207654_10021653
919 Ga0207695_10001482
920 Ga0207695_10138646
921 Ga0207671_10611850
922 Ga0207671_10893439
923 Ga0207693_10802161
924 Ga0207663_10235603
925 Ga0207662_11025810
926 Ga0207657_10175558
927 Ga0207657_10273548
928 Ga0207649_10149745
929 Ga0207649_10313076
930 Ga0207649_10609194
931 Ga0207681_10441236
932 Ga0207694_10000952
933 Ga0207694_10028384
934 Ga0207694_10372724
935 Ga0207694_10804453
936 Ga0207694_10900492
937 Ga0207650_10472443
938 Ga0207650_10569131
939 Ga0207687_10025205
940 Ga0207687_10386932
941 Ga0207700_10572565
942 Ga0207664_11456313
943 Ga0207644_10087423
944 Ga0207644_10374721
945 Ga0207690_10689565
946 Ga0207690_10844954
947 Ga0207706_10461970
948 Ga0207706_10502466
949 Ga0207686_10036156
950 Ga0207686_10267205
951 Ga0207709_10074330
952 Ga0207709_10381232
953 Ga0207670_10169659
954 Ga0207669_10002209
955 Ga0207669_10518941
956 Ga0207704_10105399
957 Ga0207704_10321608
958 Ga0207691_10355177
959 Ga0207711_10029080
960 Ga0207711_10151196
961 Ga0207711_10867927
962 Ga0207689_10012651
963 Ga0207689_10033276
964 Ga0207689_10109667
965 Ga0207689_10160860
966 Ga0207661_10172390
967 Ga0207667_10009603
968 Ga0207667_10026327
969 Ga0207667_10359550
970 Ga0207651_10173494
971 Ga0207668_10003350
972 Ga0207668_10373272
973 Ga0207668_10657831
974 Ga0207668_10847354
975 Ga0207668_11140572
976 Ga0207640_10003151
977 Ga0207658_10571751
978 Ga0207658_11039170
979 Ga0207677_10056622
980 Ga0207677_10472573
981 Ga0207677_10489947
982 Ga0207703_10027121
983 Ga0207703_11532139
984 Ga0207639_10136854
985 Ga0207639_10180491
986 Ga0207639_10270610
987 Ga0207639_10275847
988 Ga0207639_10508340
989 Ga0207678_10012691
990 Ga0207678_10016243
991 Ga0207678_10041577
992 Ga0207678_10054978
993 Ga0207678_10095783
994 Ga0207678_10114669
995 Ga0207678_10201279
996 Ga0207678_10287054
997 Ga0207678_10406637
998 Ga0207678_10408922
999 Ga0207678_10725466
1000 Ga0207702_10000093
1001 Ga0207702_10019431
1002 Ga0207641_10375193
1003 Ga0207648_10097140
1004 Ga0207648_10330673
1005 Ga0207648_10630968
1006 Ga0207648_10696892
1007 Ga0207648_11770985
1008 Ga0207676_10028673
1009 Ga0207676_10084538
1010 Ga0207676_11335768
1011 Ga0207674_10011067
1012 Ga0207674_10015216
1013 Ga0207674_10070390
1014 Ga0207675_100030583
1015 Ga0207675_100057302
1016 Ga0207675_100471043
1017 Ga0207683_10004913
1018 Ga0207683_10026290
1019 Ga0207683_10178095
1020 Ga0207683_10239422
1021 Ga0207683_10335362
1022 Ga0207683_10352808
1023 Ga0207698_10060013
1024 Ga0207698_11254532
1025 Ga0268266_10026661
1026 Ga0268266_10030100
1027 Ga0268266_10064177
1028 Ga0268266_10506176
1029 Ga0268265_10075534
1030 Ga0268265_10327299
1031 Ga0268265_10355826
1032 Ga0268265_10788015
1033 Ga0268264_10197903
1034 Ga0268264_10377107
1035 Ga0307517_10141563
1036 Ga0307512_10162228
1037 Ga0307512_10352279
1038 Ga0307512_10396356
1039 Ga0307513_10055674
1040 Ga0307513_10212331
1041 Ga0307509_10047106
1042 Ga0307408_100143638
1043 Ga0307508_10025902
1044 Ga0265314_10088928
1045 Ga0307516_10129782
1046 Ga0307516_10160922
1047 Ga0307405_10212002
1048 Ga0307409_100815680
1049 Ga0307416_100413809
1050 Ga0307416_100641226
1051 Ga0307414_10326628
1052 Ga0307411_10234625
1053 Ga0307411_10564259
1054 Ga0307415_100157630
1055 Ga0307415_100167848
1056 Ga0307415_100222401
1057 Ga0307415_101111332
1058 Ga0307507_10287978
1059 Ga0307510_10035347
1060 Ga0373938_0030655
1061 Ga0373929_0023534
1062 Ga0373944_0052875
1063 Ga0373951_0121456
1064 Ga0373936_0082535
1065 Ga0373936_0201931
1066 Ga0373924_0146515
1067 Ga0373931_0073457
1068 Ga0373931_0169703
1069 Ga0373927_0030540
1070 Ga0373927_0152905
1071 Ga0373927_0271261
1072 Ga0373947_0105455
1073 Ga0373947_0352338
1074 Ga0373925_0181332
1075 Ga0373925_1086655
1076 Ga0395900_0701099
1077 Ga0395898_0037844
1078 Ga0395905_0108394
1079 Ga0395905_0144208
1080 Ga0395901_0480452
1081 Ga0436365_0218335
1082 Ga0436361_0718305
1083 Ga0436363_1481065
1084 Ga0451789_0087561
1085 Ga0451797_1499889
1086 Ga0451798_0753749
1087 Ga0451800_0050083
1088 Ga0451807_1860363
1089 Ga0451839_1140605
1090 Ga0451851_1318226
1091 Ga0451843_1590620
1092 Ga0451853_4097277
1093 Ga0439431_0061232
1094 Ga0466969_0054980
1095 Ga0466959_0048207
1096 Ga0495617_109187
1097 Ga0495603_0016916
1098 Ga0495603_0091876
1099 Ga0495629_0187375
1100 Ga0495638_0522269
1101 Ga0495641_0123125
1102 Ga0495651_0217530
1103 Ga0495580_0354230
1104 Ga0495582_0570051
1105 Ga0495605_0194100
1106 Ga0495639_0017157
1107 Ga0495639_0043263
1108 Ga0495639_0698245
1109 Ga0495584_0064631
1110 Ga0495584_0211796
1111 Ga0495585_0063894
1112 Ga0495585_0135444
1113 Ga0495594_0303732
1114 Ga0495594_0307345
1115 Ga0495606_0269049
1116 Ga0495608_0265146
1117 Ga0495608_0285248
1118 Ga0495616_0132589
1119 Ga0495616_0258203
1120 Ga0495620_0160780
1121 Ga0495630_1012772
1122 Ga0495631_0100351
1123 Ga0495631_0165660
1124 Ga0495632_0248560
1125 Ga0495644_0427880
1126 Ga0495663_0126279
1127 Ga0495666_0018694
1128 Ga0495666_0062733
1129 Ga0495642_0047123
1130 Ga0495652_0574670
1131 Ga0495654_0222445
1132 Ga0495665_0065505
1133 Ga0495598_0037748
1134 Ga0495621_0089769
1135 Ga0495597_0093503
1136 Ga0495645_0089299
1137 Ga0495645_0449832
1138 Ga0495622_0031207
1139 Ga0495633_0306277
1140 Ga0495656_0002292
1141 Ga0495656_0040271
1142 Ga0495656_0188966
1143 Ga0495611_0087374
1144 Ga0495611_0152672
1145 Ga0495611_0372607
1146 Ga0495625_0289994
1147 Ga0495625_0488858
1148 Ga0495661_0286840
1149 Ga0495657_0204401
1150 Ga0495669_0003823
1151 Ga0495669_0152535
1152 Ga0495624_0437682
1153 Ga0495670_0219173
1154 Ga0495671_0128186
1155 Ga0495671_0526659
1156 Ga0495589_0086045
1157 Ga0495660_0264990
1158 Ga0495581_0102629
1159 Ga0495581_0250984
1160 Ga0495581_0879639
1161 Ga0495604_0916546
1162 Ga0495636_0040000
1163 Ga0495636_0048424
1164 Ga0495674_0539448
1165 Ga0495676_0441385
1166 Ga0495673_0162190
1167 Ga0495681_0106693
1168 Ga0495615_0003505
1169 Ga0495615_0075921
1170 Ga0496100_0081353
1171 Ga0496100_0368323
1172 Ga0496101_0000888
1173 Ga0496101_0334182
1174 Ga0496101_0394796
1175 Ga0496101_1603727
1176 Ga0496102_0011329
1177 Ga0496102_0019609
1178 Ga0496102_1669259
1179 Ga0496103_0004079
1180 Ga0496103_0025948
1181 Ga0496104_0052100
1182 Ga0496104_0178525
1183 Ga0496105_0043545
1184 Ga0496105_0108711
1185 Ga0496106_0028016
1186 Ga0496106_0048589
1187 Ga0496106_0127446
1188 Ga0496107_0052274
1189 Ga0496107_0719011
1190 Ga0496108_0025879
1191 Ga0496108_0054965
1192 Ga0496108_0174338
1193 Ga0496108_0252089
1194 Ga0496109_0092503
1195 Ga0496109_0118386
1196 Ga0496109_0179515
1197 Ga0496109_0486704
1198 Ga0496109_0547550
1199 Ga0496110_0016411
1200 Ga0496110_0067472
1201 Ga0496110_1076362
1202 Ga0496111_0006306
1203 Ga0496111_0100485
1204 Ga0496111_0418111
1205 Ga0496112_0000036
1206 Ga0496112_0034413
1207 Ga0496112_0076154
1208 Ga0496112_0277548
1209 Ga0496112_0816112
1210 Ga0496113_0005645
1211 Ga0496113_0052041
1212 Ga0496113_0088182
1213 Ga0496114_0017474
1214 Ga0496114_0102935
1215 Ga0496114_0146718
1216 Ga0496115_0012999
1217 Ga0496115_0038231
1218 Ga0496115_0191950
1219 Ga0496115_0303245
1220 Ga0496115_0567243
1221 Ga0496117_0040827
1222 Ga0496117_0246706
1223 Ga0496118_0258072
1224 Ga0496118_0459446
1225 Ga0496119_0085854
1226 Ga0496120_0145514
1227 Ga0496121_0011255
1228 Ga0496121_0038835
1229 Ga0496121_0163406
1230 Ga0496121_0202557
1231 Ga0496121_0592987
1232 Ga0496121_0657550
1233 Ga0496124_0256329
1234 Ga0496125_0087853
1235 Ga0496125_0198423
1236 Ga0496126_0003429
1237 Ga0496126_0026540
1238 Ga0496126_0178048
1239 Ga0496126_0195161
1240 Ga0496126_0257182
1241 Ga0496126_0514427
1242 Ga0501036_0093000
1243 Ga0501040_0405130
1244 Ga0501042_0383477
1245 Ga0501046_0588126
1246 Ga0501067_0059341
1247 Ga0501067_0289465
1248 Ga0501071_0217427
1249 Ga0501075_0383515
1250 Ga0501076_0155382
1251 Ga0501081_0372927
1252 Ga0501045_0292691
1253 Ga0501045_0768544
1254 nmdc:mga03683_297783_c1
1255 nmdc:mga03n38_369332_c1
1256 nmdc:mga03n38_89595_c1
1257 nmdc:mga00v17_4739_c1
1258 nmdc:mga00v17_723554_c1
1259 nmdc:mga0yw44_112882_c1
1260 nmdc:mga0yw44_192127_c1
1261 nmdc:mga0yw44_539563_c1
1262 nmdc:mga0k408_51871_c1
1263 nmdc:mga06z11_249442_c1
1264 nmdc:mga06z11_358628_c1
1265 nmdc:mga06z11_752020_c1
1266 nmdc:mga07m45_59301_c1
1267 nmdc:mga0qj67_361740_c1
1268 nmdc:mga08y16_282638_c1
1269 nmdc:mga0n895_51311_c1
1270 nmdc:mga0rr50_114043_c1
1271 nmdc:mga0sz30_111209_c1
1272 nmdc:mga0sz30_307758_c1
1273 Ga0495601_0072190
1274 Ga0495601_0106195
1275 Ga0495612_0227864
1276 Ga0500635_0182712
1277 Ga0495655_0310573
1278 Ga0495595_0033065
1279 Ga0495619_0022284
1280 Ga0495619_0130773
1281 Ga0500643_018565
1282 Ga0500644_0392936
1283 Ga0500581_262288
1284 Ga0500651_0108719
1285 Ga0500566_0016247
1286 Ga0500641_0017516
1287 Ga0500641_0064031
1288 Ga0500641_0304447
1289 Ga0500650_0244808
1290 Ga0500554_001834
1291 Ga0500562_030062
1292 Ga0500572_246399
1293 Ga0500595_000181
1294 Ga0500595_002904
1295 Ga0500655_018030
1296 Ga0500658_0045511
1297 Ga0500658_0244992
1298 Ga0500561_0135030
1299 Ga0500568_0086466
1300 Ga0500577_0015940
1301 Ga0500577_0022809
1302 Ga0500603_006850
1303 Ga0500604_0047826
1304 Ga0500620_248931
1305 Ga0500633_0141457
1306 Ga0500638_006557
1307 Ga0500636_0265770
1308 Ga0500637_0000116
1309 Ga0500645_056829
1310 Ga0500661_010790
1311 Ga0501082_0254833
1312 2513679231
1313 2513695549
1314 2524463620
1315 2723843944
1316 2723845443
1317 2793083369
1318 2874607656
1319 2874612065
1320 2876811956
1321 2879113988
1322 2885389464
1323 2889040226
1324 2903774714
1325 2904700396
1326 2922366291
1327 2922386644
1328 8006968068
1329 8006992252
1330 8006999356
1331 8056680021
1332 8056685804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05751

FixH

FixH

32

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gvl-assembly1.cif.gz_A second pair of fibronectin type iii domains of integrin beta4 bound to the bullous pemphigoid antigen bp230 (bpag1e) 0.7416 74 165
6gvk-assembly1.cif.gz_A second pair of fibronectin type iii domains of integrin beta4 (t1663r mutant) bound to the bullous pemphigoid antigen bp230 (bpag1e) 0.7147 74 165
5n48-assembly1.cif.gz_B structure of anticalin n9b in complex with extra-domain b of human oncofetal fibronectin 0.7009 74 165
2a74-assembly2.cif.gz_D human complement component c3c 0.6997 72 165
4wtx-assembly1.cif.gz_A crystal structure of the fourth fniii domain of integrin beta4 0.6995 75 165
ID Description Score Start End Superfamily
af_A0A0R0GAI4_122_194_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8511 71 100 3.30.420.10
af_O34090_221_303_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.8113 70 96 3.30.160.40
af_B6HY54_357_443_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7093 74 164 2.60.40.10
af_P15509_110_215_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7033 74 163 2.60.40.10
af_Q9FIE3_310_409_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7012 71 164 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A258JPZ5-F1-model_v4 Nitrogen fixation protein FixH 0.9451 59 165
AF-A0A0A1PX81-F1-model_v4 FixH 0.902 86 165
AF-A0A3N5NZY4-F1-model_v4 VWA domain-containing protein 0.8788 70 163 GO:0016020
AF-A0A7Y6PXX2-F1-model_v4 VWA domain-containing protein 0.8755 72 164 GO:0016020
AF-A0A2N3EIC4-F1-model_v4 YtkA-like domain-containing protein 0.8755 81 165

Map