F473614

General Info

Members Datasets Scaffolds Average Seq Length
664 356 572 336

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000801|Ga0105240_100008017
Length 326
Sequence MSQPAATTDQLANARIAVLGYGSQGRAHALNLRDSGLDVVVGLRKGGPSWERARAEGFNVAEPGDAVRDADLVAVLTPDMTQPAIYRDAIAPNIKAGAALLFAHGFNVHFKQIDPRKDIDVVLVAPKGPGALVRREYEIGRGVPCLFAVEQDATGQRALLIETDFKEETETDLFGEQAVLCGGASELVIKGFETLVEAGYKPEIAYYEVMHELKLIVDLFYEGGLKRMLEFVSETAQYGDYVSGPRVVDQETKQRMKAVLTDIQDGTFARNWIAEYQAGLPNYKRLKQADLDHPIEQVGAKLRARMPWLNAGAAQPTAAEPLKKVG

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
8 2643221559 Lysobacter sp. Root559 Isolate Unclassified
9 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
10 2643221573 Lysobacter sp. Root604 Isolate Unclassified
11 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
12 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
13 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
14 2643221586 Lysobacter sp. Root667 Isolate Unclassified
15 2643221593 Lysobacter sp. Root690 Isolate Unclassified
16 2643221612 Lysobacter sp. Root76 Isolate Unclassified
17 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
18 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
19 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
20 2643221695 Lysobacter sp. Root494 Isolate Unclassified
21 2643221720 Lysobacter sp. Root916 Isolate Unclassified
22 2643221727 Lysobacter sp. Root96 Isolate Unclassified
23 2643221728 Lysobacter sp. Root983 Isolate Unclassified
24 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
25 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
26 2734482264 Dyella sp. AD052 Isolate Unclassified
27 2738543009 Luteibacter sp. OK325 Isolate Unclassified
28 2739367700 Dyella sp. YR388 Isolate Unclassified
29 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
30 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
31 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
32 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
33 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
34 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
35 2818991457 Xanthomonas translucens 569 Isolate Unclassified
36 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
37 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
38 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
39 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
40 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
41 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
42 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
43 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
44 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
45 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
46 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
47 2884411467 Dyella sp. AD56 Isolate Rhizosphere
48 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
49 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
50 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
51 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
52 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
53 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
54 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
55 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
56 2919085039 Luteibacter sp. 1214 Isolate Unclassified
57 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
58 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
59 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
60 2919404418 Luteibacter sp. 3190 Isolate Unclassified
61 2919513703 Luteimonas sp. 3794 Isolate Unclassified
62 2919675420 Luteimonas terrae 4099 Isolate Unclassified
63 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
64 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
65 2928963466 Dyella japonica 1073 Isolate Unclassified
66 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
67 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
68 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
69 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
70 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
71 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
72 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
73 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
74 2941471342 Luteibacter sp. 621 Isolate Unclassified
75 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
76 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
77 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
78 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
79 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
80 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
81 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
82 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
83 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
84 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
85 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
86 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
87 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
88 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
91 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
92 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
93 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
94 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
95 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
96 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
97 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
98 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
99 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
100 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
103 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
104 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
107 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
108 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
109 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
110 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
111 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
112 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
113 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
114 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
115 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
116 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
117 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
118 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
121 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
122 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
123 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
128 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
129 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
130 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
131 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
132 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
133 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
134 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
135 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
163 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
168 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
170 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
171 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
289 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
343 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
348 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
352 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
353 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
354 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
355 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
356 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.84
Metatranscriptomes 0.3
Isolates 13.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 11.6
Nodule 0.15
Rhizoplane 1.81
Rhizosphere 68.98
Stem 0
Stem Tuber 0
Unclassified 17.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000782 3300001904 Bacteria 5839
2 JGI24738J21930_10000352 3300002075 Bacteria 12725
3 JGI25162J39368_1000228 3300002737 Bacteria 57436
4 JGI25162J39368_1005372 3300002737 Bacteria 2543
5 JGI25154J39366_1003466 3300002738 Bacteria 3296
6 JGI25157J39369_1000660 3300002741 Bacteria 19109
7 JGI25164J39214_1000004 3300002772 Bacteria 350814
8 JGI25164J39214_1002720 3300002772 Bacteria 2543
9 JGI25165J46597_1000164 3300003214 Bacteria 104150
10 JGI25165J46597_1000623 3300003214 Bacteria 29740
11 Ga0006562J51391_1031759 3300003578 Bacteria 11570
12 Ga0006562J51391_1031763 3300003578 Bacteria 7920
13 Ga0055527_1000070 3300003760 Bacteria 85704
14 Ga0055527_1000077 3300003760 Bacteria 79793
15 Ga0055535_1000117 3300003761 Bacteria 85705
16 Ga0055535_1000130 3300003761 Bacteria 79793
17 Ga0055542_1000156 3300003762 Bacteria 85704
18 Ga0055542_1000174 3300003762 Bacteria 79793
19 Ga0055542_1000193 3300003762 Bacteria 74642
20 Ga0055529_1000102 3300003763 Bacteria 129901
21 Ga0055529_1000201 3300003763 Bacteria 79793
22 Ga0055529_1000353 3300003763 Bacteria 50427
23 Ga0055536_1000290 3300003781 Bacteria 37915
24 Ga0055531_10017697 3300003794 Bacteria 2991
25 Ga0065165_1000204 3300005262 Bacteria 102828
26 Ga0070658_10004146 3300005327 Bacteria 11869
27 Ga0070658_10320043 3300005327 Bacteria 1324
28 Ga0070670_100115519 3300005331 Bacteria 2314
29 Ga0070666_10000079 3300005335 Bacteria 69879
30 Ga0070666_10011277 3300005335 Bacteria 5608
31 Ga0068868_100225548 3300005338 Bacteria 1570
32 Ga0070661_100002731 3300005344 Bacteria 12091
33 Ga0070661_100025664 3300005344 Bacteria 4236
34 Ga0070661_100094373 3300005344 Bacteria 2217
35 Ga0070668_100101915 3300005347 Bacteria 2276
36 Ga0070669_100302932 3300005353 Bacteria 1286
37 Ga0070671_100204996 3300005355 Bacteria 1672
38 Ga0070674_100290918 3300005356 Bacteria 1299
39 Ga0070673_100037980 3300005364 Bacteria 3674
40 Ga0070659_100229374 3300005366 Bacteria 1534
41 Ga0070667_100000010 3300005367 Bacteria 273500
42 Ga0070667_100015909 3300005367 Bacteria 6224
43 Ga0070667_100038301 3300005367 Bacteria 4020
44 Ga0070667_100050214 3300005367 Bacteria 3515
45 Ga0070667_100066825 3300005367 Bacteria 3056
46 Ga0070714_100000136 3300005435 Bacteria 58402
47 Ga0070663_100000341 3300005455 Bacteria 24326
48 Ga0070663_100159500 3300005455 Bacteria 1736
49 Ga0070678_100009297 3300005456 Bacteria 5945
50 Ga0070678_100089589 3300005456 Bacteria 2355
51 Ga0070662_100122518 3300005457 Bacteria 1994
52 Ga0070681_10021990 3300005458 Bacteria 6399
53 Ga0070681_10040104 3300005458 Bacteria 4694
54 Ga0070681_10054089 3300005458 Bacteria 3999
55 Ga0070681_10126267 3300005458 Bacteria 2491
56 Ga0068853_100005811 3300005539 Bacteria 9719
57 Ga0068853_100009630 3300005539 Bacteria 7786
58 Ga0068853_100217042 3300005539 Bacteria 1745
59 Ga0068853_100252266 3300005539 Bacteria 1619
60 Ga0070696_100003127 3300005546 Bacteria 11021
61 Ga0070693_100175421 3300005547 Bacteria 1376
62 Ga0070665_100000053 3300005548 Bacteria 244523
63 Ga0070665_100000249 3300005548 Bacteria 89011
64 Ga0070665_100004714 3300005548 Bacteria 14209
65 Ga0070665_100518641 3300005548 Bacteria 1203
66 Ga0068855_100010440 3300005563 Bacteria 11203
67 Ga0068855_100061712 3300005563 Bacteria 4379
68 Ga0068855_100104594 3300005563 Bacteria 3256
69 Ga0068857_100072530 3300005577 Bacteria 3068
70 Ga0068857_100105489 3300005577 Bacteria 2530
71 Ga0068854_100010275 3300005578 Bacteria 6067
72 Ga0068856_100005470 3300005614 Bacteria 12512
73 Ga0068856_100006964 3300005614 Bacteria 11048
74 Ga0068856_100010412 3300005614 Bacteria 9030
75 Ga0068856_100033319 3300005614 Bacteria 5043
76 Ga0068856_100117006 3300005614 Bacteria 2666
77 Ga0068856_100169332 3300005614 Bacteria 2196
78 Ga0068852_100097665 3300005616 Bacteria 2643
79 Ga0068852_100182547 3300005616 Bacteria 1974
80 Ga0068859_100110776 3300005617 Bacteria 2807
81 Ga0068859_100159626 3300005617 Bacteria 2334
82 Ga0068859_100522510 3300005617 Bacteria 1282
83 Ga0068864_100001935 3300005618 Bacteria 17012
84 Ga0068864_100015349 3300005618 Bacteria 6368
85 Ga0068851_10000001 3300005834 Bacteria 495512
86 Ga0068851_10004345 3300005834 Bacteria 6376
87 Ga0068863_100078304 3300005841 Bacteria 3130
88 Ga0068863_100160999 3300005841 Bacteria 2150
89 Ga0068858_100001687 3300005842 Bacteria 22569
90 Ga0068858_100003000 3300005842 Bacteria 16922
91 Ga0068860_100158507 3300005843 Bacteria 2181
92 Ga0068862_100000058 3300005844 Bacteria 138649
93 Ga0075369_10037336 3300006186 Bacteria 2069
94 Ga0097621_100077590 3300006237 Bacteria 2758
95 Ga0097621_100105823 3300006237 Bacteria 2372
96 Ga0097621_100278644 3300006237 Bacteria 1471
97 Ga0068871_100389372 3300006358 Bacteria 1239
98 Ga0097620_100000036 3300006931 Bacteria 169326
99 Ga0097620_100110788 3300006931 Bacteria 2807
100 Ga0097620_100159619 3300006931 Bacteria 2334
101 Ga0097620_100522516 3300006931 Bacteria 1282
102 Ga0105240_10000801 3300009093 Bacteria 56966
103 Ga0105240_10002391 3300009093 Bacteria 30231
104 Ga0105240_10002598 3300009093 Bacteria 28890
105 Ga0105240_10544428 3300009093 Bacteria 1285
106 Ga0105245_10112842 3300009098 Bacteria 2530
107 Ga0105245_10344551 3300009098 Bacteria 1475
108 Ga0105247_10020943 3300009101 Bacteria 3934
109 Ga0105241_10001789 3300009174 Bacteria 16329
110 Ga0105248_10000374 3300009177 Bacteria 52182
111 Ga0105248_10019760 3300009177 Bacteria 7459
112 Ga0105248_10114072 3300009177 Bacteria 3048
113 Ga0105237_10001835 3300009545 Bacteria 27314
114 Ga0105237_10015122 3300009545 Bacteria 8041
115 Ga0105237_10065828 3300009545 Bacteria 3619
116 Ga0105238_10000145 3300009551 Bacteria 77797
117 Ga0105238_10006357 3300009551 Bacteria 11748
118 Ga0105238_10064830 3300009551 Bacteria 3653
119 Ga0105238_10115819 3300009551 Bacteria 2660
120 Ga0105238_10218775 3300009551 Bacteria 1880
121 Ga0105238_10289823 3300009551 Bacteria 1619
122 Ga0105249_10000501 3300009553 Bacteria 36179
123 Ga0105249_10029254 3300009553 Bacteria 4975
124 Ga0105148_103016 3300009978 Bacteria 1188
125 Ga0105239_10000902 3300010375 Bacteria 42239
126 Ga0105239_10018640 3300010375 Bacteria 7667
127 Ga0105239_10085247 3300010375 Bacteria 3481
128 Ga0105239_10114745 3300010375 Bacteria 2987
129 Ga0105239_10150206 3300010375 Bacteria 2600
130 Ga0105239_10553470 3300010375 Bacteria 1310
131 Ga0157370_10000837 3300013104 Bacteria 39048
132 Ga0157370_10031870 3300013104 Bacteria 5152
133 Ga0157370_10304097 3300013104 Bacteria 1472
134 Ga0157369_10000057 3300013105 Bacteria 157096
135 Ga0157369_10010571 3300013105 Bacteria 10504
136 Ga0157369_10147562 3300013105 Bacteria 2486
137 Ga0157369_10210257 3300013105 Bacteria 2039
138 Ga0157378_10000031 3300013297 Bacteria 124224
139 Ga0157378_10144798 3300013297 Bacteria 2209
140 Ga0163162_10000021 3300013306 Bacteria 214873
141 Ga0163162_10001472 3300013306 Bacteria 21907
142 Ga0163162_10035359 3300013306 Bacteria 4976
143 Ga0163162_10136240 3300013306 Bacteria 2566
144 Ga0157372_10002926 3300013307 Bacteria 18438
145 Ga0157372_10004560 3300013307 Bacteria 14748
146 Ga0157372_10031524 3300013307 Bacteria 5804
147 Ga0157372_10100063 3300013307 Bacteria 3307
148 Ga0157372_10293980 3300013307 Bacteria 1889
149 Ga0157375_10006577 3300013308 Bacteria 10117
150 Ga0163163_10000484 3300014325 Bacteria 35990
151 Ga0163163_10013819 3300014325 Bacteria 7405
152 Ga0182008_10002503 3300014497 Bacteria 11472
153 Ga0157376_10009818 3300014969 Bacteria 6977
154 Ga0182006_1000189 3300015261 Bacteria 64215
155 Ga0182006_1000469 3300015261 Bacteria 31554
156 Ga0182007_10009677 3300015262 Bacteria 3866
157 Ga0182005_1000015 3300015265 Bacteria 387565
158 Ga0182005_1000601 3300015265 Bacteria 17556
159 Ga0182005_1005157 3300015265 Bacteria 4111
160 Ga0182005_1017120 3300015265 Bacteria 2007
161 Ga0182005_1036458 3300015265 Bacteria 1337
162 Ga0163161_10002763 3300017792 Bacteria 12476
163 Ga0213875_10004941 3300021388 Bacteria 7235
164 Ga0209674_100486 3300025226 Bacteria 16872
165 Ga0209674_100810 3300025226 Bacteria 10420
166 Ga0209672_100070 3300025228 Bacteria 174481
167 Ga0209672_100084 3300025228 Bacteria 129975
168 Ga0209672_100099 3300025228 Bacteria 109599
169 Ga0209563_100161 3300025230 Bacteria 57863
170 Ga0207427_100031 3300025231 Bacteria 350866
171 Ga0207427_100044 3300025231 Bacteria 242623
172 Ga0207427_100088 3300025231 Bacteria 137220
173 Ga0207427_100191 3300025231 Bacteria 60860
174 Ga0209437_100005 3300025233 Bacteria 1071596
175 Ga0209437_100061 3300025233 Bacteria 350866
176 Ga0209437_100167 3300025233 Bacteria 144661
177 Ga0209258_100054 3300025242 Bacteria 339063
178 Ga0209258_100104 3300025242 Bacteria 208582
179 Ga0209258_100188 3300025242 Bacteria 130022
180 Ga0209258_100218 3300025242 Bacteria 109599
181 Ga0209646_1002273 3300025246 Bacteria 4390
182 Ga0209026_1000171 3300025250 Bacteria 98984
183 Ga0209026_1000588 3300025250 Bacteria 23702
184 Ga0209026_1001016 3300025250 Bacteria 13853
185 Ga0209677_104660 3300025253 Bacteria 3872
186 Ga0209148_1000063 3300025254 Bacteria 346881
187 Ga0209148_1000066 3300025254 Bacteria 339063
188 Ga0209148_1000106 3300025254 Bacteria 208597
189 Ga0209148_1000196 3300025254 Bacteria 109599
190 Ga0209148_1000528 3300025254 Bacteria 37646
191 Ga0209148_1002949 3300025254 Bacteria 5153
192 Ga0209759_1000137 3300025256 Bacteria 125216
193 Ga0209759_1000487 3300025256 Bacteria 43693
194 Ga0209759_1001330 3300025256 Bacteria 14512
195 Ga0209129_1004485 3300025258 Bacteria 5424
196 Ga0209233_1000011 3300025261 Bacteria 1071611
197 Ga0209233_1000046 3300025261 Bacteria 470971
198 Ga0209233_1000076 3300025261 Bacteria 350866
199 Ga0209455_1000146 3300025272 Bacteria 133032
200 Ga0209455_1000165 3300025272 Bacteria 113465
201 Ga0209455_1000173 3300025272 Bacteria 109599
202 Ga0209676_1000182 3300025292 Bacteria 146373
203 Ga0209676_1001439 3300025292 Bacteria 22421
204 Ga0209758_1010302 3300025297 Bacteria 5618
205 Ga0209050_1021354 3300025298 Bacteria 2364
206 Ga0209256_1010388 3300025299 Bacteria 3909
207 Ga0207426_1009854 3300025302 Bacteria 3745
208 Ga0209051_1008273 3300025303 Bacteria 5530
209 Ga0209257_1000484 3300025304 Bacteria 72044
210 Ga0207656_10000002 3300025321 Bacteria 792178
211 Ga0207656_10000925 3300025321 Bacteria 9573
212 Ga0207710_10019278 3300025900 Bacteria 2910
213 Ga0207710_10094666 3300025900 Bacteria 1402
214 Ga0207680_10000001 3300025903 Bacteria 1091453
215 Ga0207680_10000225 3300025903 Bacteria 27387
216 Ga0207680_10045783 3300025903 Bacteria 2582
217 Ga0207647_10000031 3300025904 Bacteria 104231
218 Ga0207647_10000111 3300025904 Bacteria 62900
219 Ga0207647_10003069 3300025904 Bacteria 12553
220 Ga0207647_10186939 3300025904 Bacteria 1201
221 Ga0207699_10034038 3300025906 Bacteria 2885
222 Ga0207705_10008100 3300025909 Bacteria 7698
223 Ga0207705_10018914 3300025909 Bacteria 4925
224 Ga0207705_10060663 3300025909 Bacteria 2732
225 Ga0207654_10000001 3300025911 Bacteria 1816198
226 Ga0207707_10016515 3300025912 Bacteria 6436
227 Ga0207707_10145047 3300025912 Bacteria 2075
228 Ga0207695_10000033 3300025913 Bacteria 507477
229 Ga0207695_10000100 3300025913 Bacteria 258626
230 Ga0207695_10000261 3300025913 Bacteria 133038
231 Ga0207695_10002253 3300025913 Bacteria 28887
232 Ga0207695_10002266 3300025913 Bacteria 28809
233 Ga0207695_10002518 3300025913 Bacteria 26913
234 Ga0207695_10027246 3300025913 Bacteria 6366
235 Ga0207695_10043108 3300025913 Bacteria 4812
236 Ga0207695_10054607 3300025913 Bacteria 4170
237 Ga0207695_10153396 3300025913 Bacteria 2240
238 Ga0207671_10000002 3300025914 Bacteria 1144816
239 Ga0207671_10003270 3300025914 Bacteria 16299
240 Ga0207671_10008080 3300025914 Bacteria 8989
241 Ga0207671_10008084 3300025914 Bacteria 8986
242 Ga0207671_10023009 3300025914 Bacteria 4704
243 Ga0207671_10109218 3300025914 Bacteria 2103
244 Ga0207671_10127071 3300025914 Bacteria 1954
245 Ga0207660_10288606 3300025917 Bacteria 1304
246 Ga0207657_10271643 3300025919 Bacteria 1348
247 Ga0207649_10000424 3300025920 Bacteria 31011
248 Ga0207649_10022479 3300025920 Bacteria 3644
249 Ga0207649_10168323 3300025920 Bacteria 1524
250 Ga0207652_10108129 3300025921 Bacteria 2464
251 Ga0207694_10000740 3300025924 Bacteria 29358
252 Ga0207694_10000828 3300025924 Bacteria 27515
253 Ga0207694_10010264 3300025924 Bacteria 7061
254 Ga0207694_10015088 3300025924 Bacteria 5826
255 Ga0207694_10072225 3300025924 Bacteria 2698
256 Ga0207694_10231149 3300025924 Bacteria 1510
257 Ga0207650_10316323 3300025925 Bacteria 1278
258 Ga0207664_10002661 3300025929 Bacteria 11849
259 Ga0207644_10403114 3300025931 Bacteria 1118
260 Ga0207690_10003540 3300025932 Bacteria 9309
261 Ga0207690_10021073 3300025932 Bacteria 4037
262 Ga0207690_10025869 3300025932 Bacteria 3690
263 Ga0207690_10036769 3300025932 Bacteria 3173
264 Ga0207706_10026521 3300025933 Bacteria 5186
265 Ga0207706_10086920 3300025933 Bacteria 2748
266 Ga0207706_10234313 3300025933 Bacteria 1605
267 Ga0207711_10000437 3300025941 Bacteria 43402
268 Ga0207711_10003934 3300025941 Bacteria 12777
269 Ga0207711_10135609 3300025941 Bacteria 2210
270 Ga0207689_10260779 3300025942 Bacteria 1434
271 Ga0207667_10003460 3300025949 Bacteria 19493
272 Ga0207667_10004560 3300025949 Bacteria 16987
273 Ga0207667_10011726 3300025949 Bacteria 10165
274 Ga0207667_10209618 3300025949 Bacteria 1997
275 Ga0207667_10212012 3300025949 Bacteria 1985
276 Ga0207712_10000094 3300025961 Bacteria 102401
277 Ga0207712_10000477 3300025961 Bacteria 33669
278 Ga0207668_10243291 3300025972 Bacteria 1457
279 Ga0207640_10022660 3300025981 Bacteria 3763
280 Ga0207658_10000053 3300025986 Bacteria 126294
281 Ga0207658_10011805 3300025986 Bacteria 5951
282 Ga0207658_10013378 3300025986 Bacteria 5604
283 Ga0207658_10026902 3300025986 Bacteria 4037
284 Ga0207658_10052993 3300025986 Bacteria 2995
285 Ga0207658_10156441 3300025986 Bacteria 1863
286 Ga0207677_10159415 3300026023 Bacteria 1751
287 Ga0207703_10000168 3300026035 Bacteria 76234
288 Ga0207703_10001468 3300026035 Bacteria 21500
289 Ga0207703_10231303 3300026035 Bacteria 1657
290 Ga0207703_10265554 3300026035 Bacteria 1553
291 Ga0207703_10424716 3300026035 Bacteria 1237
292 Ga0207639_10000197 3300026041 Bacteria 45460
293 Ga0207639_10000670 3300026041 Bacteria 23640
294 Ga0207639_10026027 3300026041 Bacteria 4248
295 Ga0207639_10062210 3300026041 Bacteria 2885
296 Ga0207639_10209971 3300026041 Bacteria 1675
297 Ga0207678_10007165 3300026067 Bacteria 9886
298 Ga0207678_10008754 3300026067 Bacteria 8908
299 Ga0207678_10015494 3300026067 Bacteria 6702
300 Ga0207678_10386564 3300026067 Bacteria 1210
301 Ga0207702_10000362 3300026078 Bacteria 51961
302 Ga0207702_10042293 3300026078 Bacteria 3822
303 Ga0207702_10071263 3300026078 Bacteria 2992
304 Ga0207702_10071499 3300026078 Bacteria 2987
305 Ga0207702_10073483 3300026078 Bacteria 2949
306 Ga0207648_10083277 3300026089 Bacteria 2790
307 Ga0207648_10365161 3300026089 Bacteria 1303
308 Ga0207676_10015622 3300026095 Bacteria 5483
309 Ga0207676_10089174 3300026095 Bacteria 2527
310 Ga0207676_10168709 3300026095 Bacteria 1905
311 Ga0207676_10569779 3300026095 Bacteria 1084
312 Ga0207674_10002030 3300026116 Bacteria 25689
313 Ga0207674_10026613 3300026116 Bacteria 6137
314 Ga0207674_10032341 3300026116 Bacteria 5488
315 Ga0207674_10150631 3300026116 Bacteria 2283
316 Ga0207675_100200837 3300026118 Bacteria 1915
317 Ga0207683_10033881 3300026121 Bacteria 4437
318 Ga0207683_10084611 3300026121 Bacteria 2820
319 Ga0207698_10001978 3300026142 Bacteria 12056
320 Ga0207698_10032787 3300026142 Bacteria 3767
321 Ga0207698_10054240 3300026142 Bacteria 3083
322 Ga0207698_10104207 3300026142 Bacteria 2359
323 Ga0207698_10343560 3300026142 Bacteria 1407
324 Ga0268266_10000001 3300028379 Bacteria 4040580
325 Ga0268266_10000006 3300028379 Bacteria 1410021
326 Ga0268266_10000067 3300028379 Bacteria 241577
327 Ga0268265_10000075 3300028380 Bacteria 126053
328 Ga0268264_10020135 3300028381 Bacteria 5452
329 Ga0268264_10205645 3300028381 Bacteria 1804
330 Ga0307515_10238159 3300028794 Bacteria 1597
331 Ga0307508_10106065 3300031616 Bacteria 2408
332 Ga0307514_10177529 3300031649 Bacteria 1379
333 Ga0307516_10065953 3300031730 Bacteria 3494
334 Ga0307516_10195625 3300031730 Bacteria 1745
335 Ga0307406_10002892 3300031901 Bacteria 9355
336 Ga0307412_10001161 3300031911 Bacteria 15089
337 Ga0307414_10027560 3300032004 Bacteria 3673
338 Ga0307414_10042514 3300032004 Bacteria 3088
339 Ga0307507_10095124 3300033179 Bacteria 2528
340 Ga0373946_0083798 3300035171 Bacteria 1401
341 Ga0395899_0000146 3300037312 Bacteria 107272
342 Ga0395899_0003483 3300037312 Bacteria 12471
343 Ga0395899_0191859 3300037312 Bacteria 1429
344 Ga0395900_0000272 3300037418 Bacteria 78624
345 Ga0395900_0000706 3300037418 Bacteria 44517
346 Ga0395900_0005617 3300037418 Bacteria 13113
347 Ga0395900_0088103 3300037418 Bacteria 3190
348 Ga0395898_0000329 3300037466 Bacteria 107288
349 Ga0395898_0000387 3300037466 Bacteria 96473
350 Ga0395898_0012851 3300037466 Bacteria 8637
351 Ga0395898_0115704 3300037466 Bacteria 2569
352 Ga0436364_0915093 3300037853 Bacteria 10669
353 Ga0395901_0007382 3300038443 Bacteria 11092
354 Ga0395901_0033820 3300038443 Bacteria 5278
355 Ga0395901_0166941 3300038443 Bacteria 2310
356 Ga0395901_0178570 3300038443 Bacteria 2226
357 Ga0439436_0000003 3300041404 Bacteria 186684
358 Ga0451807_1120056 3300041486 Bacteria 3211
359 Ga0439445_0007447 3300042004 Bacteria 2539
360 Ga0439455_0001585 3300042012 Bacteria 3864
361 Ga0450908_000008 3300042184 Bacteria 54808
362 Ga0451577_0159044 3300042876 Bacteria 2034
363 Ga0466982_0000041 3300044672 Bacteria 40889
364 Ga0466965_0001445 3300044683 Bacteria 9590
365 Ga0466966_0019156 3300044684 Bacteria 4504
366 Ga0466961_0000703 3300044693 Bacteria 21063
367 Ga0466961_0001035 3300044693 Bacteria 17163
368 Ga0466961_0006978 3300044693 Bacteria 7183
369 Ga0466963_0130991 3300044694 Bacteria 1732
370 Ga0453684_0000437 3300044712 Bacteria 169900
371 Ga0466971_0029258 3300044719 Bacteria 2463
372 Ga0466968_0007949 3300044735 Bacteria 4049
373 Ga0466957_0046799 3300044842 Bacteria 2627
374 Ga0466959_0000266 3300045049 Bacteria 32146
375 Ga0466959_0048943 3300045049 Bacteria 3105
376 Ga0466959_0059481 3300045049 Bacteria 2782
377 Ga0466959_0068491 3300045049 Bacteria 2571
378 Ga0451576_0000081 3300045051 Bacteria 239875
379 Ga0466958_0004725 3300045836 Bacteria 7237
380 Ga0466967_0036051 3300045976 Bacteria 4219
381 Ga0495617_000031 3300046452 Bacteria 151115
382 Ga0495617_000059 3300046452 Bacteria 97595
383 Ga0495590_0009137 3300046457 Bacteria 3762
384 Ga0495590_0041650 3300046457 Bacteria 1601
385 Ga0495638_0000278 3300046460 Bacteria 69374
386 Ga0495650_0000810 3300046471 Bacteria 38046
387 Ga0495650_0000811 3300046471 Bacteria 38034
388 Ga0495650_0001430 3300046471 Bacteria 23153
389 Ga0495650_0069876 3300046471 Bacteria 1380
390 Ga0495584_0001879 3300046491 Bacteria 12122
391 Ga0495585_0000035 3300046492 Bacteria 136801
392 Ga0495585_0001919 3300046492 Bacteria 15568
393 Ga0495607_0000117 3300046501 Bacteria 83890
394 Ga0495607_0000640 3300046501 Bacteria 34013
395 Ga0495607_0006154 3300046501 Bacteria 8487
396 Ga0495583_0006822 3300046506 Bacteria 7370
397 Ga0495606_0000174 3300046507 Bacteria 113955
398 Ga0495606_0001062 3300046507 Bacteria 39712
399 Ga0495606_0001499 3300046507 Bacteria 31017
400 Ga0495610_0002831 3300046512 Bacteria 14131
401 Ga0495610_0008589 3300046512 Bacteria 6588
402 Ga0495616_0000028 3300046513 Bacteria 133873
403 Ga0495620_0000088 3300046515 Bacteria 74950
404 Ga0495620_0000364 3300046515 Bacteria 31358
405 Ga0495631_0000156 3300046518 Bacteria 45951
406 Ga0495631_0000508 3300046518 Bacteria 26001
407 Ga0495631_0013649 3300046518 Bacteria 3938
408 Ga0495632_0000005 3300046519 Bacteria 362872
409 Ga0495632_0008732 3300046519 Bacteria 6178
410 Ga0495632_0141495 3300046519 Bacteria 1116
411 Ga0495637_0004833 3300046520 Bacteria 6940
412 Ga0495648_0001237 3300046524 Bacteria 25544
413 Ga0495648_0004640 3300046524 Bacteria 11665
414 Ga0495609_0001744 3300046538 Bacteria 13996
415 Ga0495633_0000384 3300046558 Bacteria 46696
416 Ga0495668_0001645 3300046616 Bacteria 20849
417 Ga0495611_0000049 3300046648 Bacteria 85148
418 Ga0495611_0000059 3300046648 Bacteria 78609
419 Ga0495625_0000288 3300046660 Bacteria 77990
420 Ga0495625_0012337 3300046660 Bacteria 6929
421 Ga0495625_0030994 3300046660 Bacteria 3981
422 Ga0495625_0086248 3300046660 Bacteria 2178
423 Ga0495661_0000907 3300046665 Bacteria 27196
424 Ga0495647_0006723 3300046681 Bacteria 3827
425 Ga0495658_0028529 3300046683 Bacteria 3013
426 Ga0495670_0000538 3300046691 Bacteria 18046
427 Ga0495671_0003578 3300046692 Bacteria 9491
428 Ga0495649_0010679 3300046694 Bacteria 5408
429 Ga0495589_0000056 3300046794 Bacteria 109990
430 Ga0495660_0000295 3300046810 Bacteria 45627
431 Ga0495660_0000304 3300046810 Bacteria 44534
432 Ga0495672_0016333 3300047320 Bacteria 5007
433 Ga0495672_0041308 3300047320 Bacteria 2790
434 Ga0495683_0000631 3300047323 Bacteria 26247
435 Ga0495679_000010 3300047446 Bacteria 337760
436 Ga0495673_0000045 3300047469 Bacteria 280765
437 Ga0495673_0000240 3300047469 Bacteria 77586
438 Ga0495673_0000244 3300047469 Bacteria 76503
439 Ga0495681_0085306 3300047470 Bacteria 1403
440 Ga0495686_0000227 3300047472 Bacteria 103680
441 Ga0495686_0000311 3300047472 Bacteria 82066
442 Ga0495686_0001969 3300047472 Bacteria 20403
443 Ga0495686_0005940 3300047472 Bacteria 9499
444 Ga0495686_0032109 3300047472 Bacteria 3400
445 Ga0495686_0043336 3300047472 Bacteria 2853
446 Ga0495686_0053074 3300047472 Bacteria 2541
447 Ga0496100_0010529 3300048903 Bacteria 5238
448 Ga0496101_0010821 3300048904 Bacteria 6034
449 Ga0496101_0102311 3300048904 Bacteria 2145
450 Ga0496104_0000017 3300048907 Bacteria 325877
451 Ga0496104_0001832 3300048907 Bacteria 18380
452 Ga0496105_0000009 3300048908 Bacteria 325734
453 Ga0496105_0011699 3300048908 Bacteria 6942
454 Ga0496106_0000285 3300048909 Bacteria 35780
455 Ga0496107_0018550 3300048910 Bacteria 4900
456 Ga0496115_0000139 3300048918 Bacteria 66961
457 Ga0496115_0029059 3300048918 Bacteria 4339
458 Ga0496116_0029954 3300048919 Bacteria 3917
459 Ga0496116_0042148 3300048919 Bacteria 3124
460 Ga0496117_0004738 3300048920 Bacteria 14772
461 Ga0496117_0006842 3300048920 Bacteria 11341
462 Ga0496117_0024285 3300048920 Bacteria 4799
463 Ga0496118_0000313 3300048921 Bacteria 84145
464 Ga0496118_0001244 3300048921 Bacteria 39134
465 Ga0496118_0001653 3300048921 Bacteria 32760
466 Ga0496118_0002972 3300048921 Bacteria 21928
467 Ga0496118_0008694 3300048921 Bacteria 10438
468 Ga0496118_0073500 3300048921 Bacteria 2449
469 Ga0496118_0111907 3300048921 Bacteria 1809
470 Ga0496119_0000094 3300048922 Bacteria 130089
471 Ga0496120_0000013 3300048923 Bacteria 331109
472 Ga0496120_0001093 3300048923 Bacteria 35422
473 Ga0496120_0008970 3300048923 Bacteria 7157
474 Ga0496120_0055927 3300048923 Bacteria 2229
475 Ga0496121_0000403 3300048924 Bacteria 86293
476 Ga0496121_0000530 3300048924 Bacteria 72524
477 Ga0496121_0000756 3300048924 Bacteria 59448
478 Ga0496122_0000940 3300048925 Bacteria 52878
479 Ga0496122_0019128 3300048925 Bacteria 6279
480 Ga0496122_0021025 3300048925 Bacteria 5862
481 Ga0496122_0069970 3300048925 Bacteria 2510
482 Ga0496122_0160417 3300048925 Bacteria 1372
483 Ga0496123_0000029 3300048926 Bacteria 295871
484 Ga0496123_0001905 3300048926 Bacteria 27213
485 Ga0496123_0075180 3300048926 Bacteria 2086
486 Ga0496123_0150552 3300048926 Bacteria 1256
487 Ga0496124_0001211 3300048927 Bacteria 39925
488 Ga0496124_0001213 3300048927 Bacteria 39919
489 Ga0496124_0280566 3300048927 Bacteria 1215
490 Ga0496125_0009298 3300048928 Bacteria 10138
491 Ga0496125_0080384 3300048928 Bacteria 2495
492 Ga0496126_0000033 3300048929 Bacteria 368851
493 Ga0496126_0000301 3300048929 Bacteria 104981
494 Ga0496126_0076687 3300048929 Bacteria 2965
495 Ga0496126_0093596 3300048929 Bacteria 2638
496 Ga0495678_000211 3300049459 Bacteria 67511
497 Ga0495682_0001027 3300049460 Bacteria 16470
498 Ga0495682_0004397 3300049460 Bacteria 6035
499 Ga0501031_0004350 3300049568 Bacteria 9164
500 Ga0501031_0015158 3300049568 Bacteria 5005
501 Ga0501032_0000994 3300049569 Bacteria 22837
502 Ga0501032_0002696 3300049569 Bacteria 13843
503 Ga0501033_0008456 3300049570 Bacteria 7969
504 Ga0501033_0014077 3300049570 Bacteria 6082
505 Ga0501033_0124236 3300049570 Bacteria 1871
506 Ga0501033_0126180 3300049570 Bacteria 1855
507 Ga0501034_0001262 3300049571 Bacteria 34347
508 Ga0501034_0001429 3300049571 Bacteria 31855
509 Ga0501034_0013755 3300049571 Bacteria 8324
510 Ga0501034_0035783 3300049571 Bacteria 5033
511 Ga0501037_0003570 3300049573 Bacteria 11284
512 Ga0501037_0008180 3300049573 Bacteria 7667
513 Ga0501037_0018027 3300049573 Bacteria 5198
514 Ga0501038_0002517 3300049574 Bacteria 17075
515 Ga0501038_0003208 3300049574 Bacteria 15263
516 Ga0501038_0006715 3300049574 Bacteria 10636
517 Ga0501039_0021401 3300049575 Bacteria 4962
518 Ga0501042_0176459 3300049578 Bacteria 1541
519 Ga0501043_0001679 3300049579 Bacteria 19220
520 Ga0501043_0004377 3300049579 Bacteria 11498
521 Ga0501043_0096334 3300049579 Bacteria 2326
522 Ga0501046_0001275 3300049580 Bacteria 24406
523 Ga0501046_0001926 3300049580 Bacteria 19713
524 Ga0501046_0079855 3300049580 Bacteria 2529
525 Ga0501047_0000768 3300049581 Bacteria 33598
526 Ga0501047_0015182 3300049581 Bacteria 7332
527 Ga0501048_0007295 3300049582 Bacteria 8384
528 Ga0501067_0000124 3300049583 Bacteria 42331
529 Ga0501069_0000314 3300049585 Bacteria 22114
530 Ga0501070_0003729 3300049586 Bacteria 13151
531 Ga0501070_0025838 3300049586 Bacteria 4926
532 Ga0501070_0053067 3300049586 Bacteria 3364
533 Ga0501070_0167375 3300049586 Bacteria 1811
534 Ga0501072_0051627 3300049588 Bacteria 3237
535 Ga0501073_0001873 3300049589 Bacteria 15659
536 Ga0501073_0010811 3300049589 Bacteria 6685
537 Ga0501073_0021215 3300049589 Bacteria 4683
538 Ga0501074_0012841 3300049590 Bacteria 6089
539 Ga0501074_0024269 3300049590 Bacteria 4407
540 Ga0501077_0017477 3300049593 Bacteria 4528
541 Ga0501080_0000161 3300049742 Bacteria 48396
542 Ga0501080_0005039 3300049742 Bacteria 11766
543 Ga0501080_0017902 3300049742 Bacteria 6559
544 Ga0501080_0365330 3300049742 Bacteria 1302
545 Ga0501083_0000055 3300049744 Bacteria 82183
546 Ga0501083_0004721 3300049744 Bacteria 9629
547 Ga0501083_0016567 3300049744 Bacteria 5155
548 Ga0501083_0025177 3300049744 Bacteria 4120
549 Ga0501035_0011177 3300049822 Bacteria 8314
550 Ga0501035_0015608 3300049822 Bacteria 7009
551 Ga0501044_0001236 3300049823 Bacteria 30366
552 Ga0501044_0012370 3300049823 Bacteria 9238
553 nmdc:mga0sz30_35979_c1 3300050516 Bacteria 2068
554 Ga0500635_0094882 3300053080 Bacteria 1090
555 Ga0500643_000051 3300053087 Bacteria 145619
556 Ga0500643_010471 3300053087 Bacteria 3449
557 Ga0500651_0000106 3300053093 Bacteria 51110
558 Ga0500651_0029088 3300053093 Bacteria 3473
559 Ga0500555_005370 3300053103 Bacteria 3634
560 Ga0500556_0000001 3300053104 Bacteria 1135060
561 Ga0500597_044989 3300053120 Bacteria 1866
562 Ga0500559_0001617 3300053136 Bacteria 12519
563 Ga0500559_0010491 3300053136 Bacteria 3975
564 Ga0500568_0000003 3300053139 Bacteria 863587
565 Ga0500568_0022190 3300053139 Bacteria 2721
566 Ga0500590_007979 3300053148 Bacteria 5268
567 Ga0500616_0000205 3300053153 Bacteria 96713
568 Ga0500616_0000970 3300053153 Bacteria 31033
569 Ga0500620_000200 3300053155 Bacteria 11909
570 Ga0500633_0001750 3300053160 Bacteria 4236
571 Ga0501082_0076404 3300060353 Bacteria 2887
572 Ga0466962_0009010 3300061719 Bacteria 4779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10386564 Ga0207678_103865642 293
2 3300038443 Ga0395901_0178570 Ga0395901_0178570_12_914 299
3 3300053093 Ga0500651_0000106 Ga0500651_0000106_2661_3641 315
4 3300009978 Ga0105148_103016 Ga0105148_1030161 316
5 3300026089 Ga0207648_10365161 Ga0207648_103651612 316
6 3300026095 Ga0207676_10168709 Ga0207676_101687092 316
7 3300044712 Ga0453684_0000437 Ga0453684_0000437_124389_125417 318
8 3300045051 Ga0451576_0000081 Ga0451576_0000081_44484_45512 318
9 iso_pu_bacteria 2547132130 2547503538 320
10 iso_pu_bacteria 2576861471 2578457094 320
11 iso_pu_bacteria 2747842428 2747949210 320
12 iso_pu_bacteria 2765235840 2765580401 320
13 iso_pu_bacteria 2816332141 2816518560 320
14 iso_pu_bacteria 2842391507 2842395344 320
15 iso_pu_bacteria 2842757796 2842759081 320
16 iso_pu_bacteria 2852649853 2852652229 320
17 iso_pu_bacteria 2857442823 2857445680 320
18 iso_pu_bacteria 2874220319 2874223077 320
19 iso_pu_bacteria 2919089067 2919092984 320
20 iso_pu_bacteria 2919134579 2919137328 320
21 iso_pu_bacteria 2928496128 2928498974 320
22 iso_pu_bacteria 2931380184 2931383472 320
23 iso_pu_bacteria 2937610967 2937614460 320
24 iso_pu_bacteria 2939589442 2939589712 320
25 iso_pu_bacteria 2939622612 2939624209 320
26 iso_pu_bacteria 2939626828 2939630694 320
27 iso_pu_bacteria 2941475908 2941478853 320
28 iso_pu_bacteria 2961047084 2961049842 320
29 iso_pu_bacteria 2961064222 2961066478 320
30 iso_pu_bacteria 2974307012 2974307733 320
31 iso_pu_bacteria 2977247770 2977248453 320
32 iso_pu_bacteria 2984514374 2984517063 320
33 iso_pu_bacteria 2987605356 2987608686 320
34 3300009093 Ga0105240_10000801 Ga0105240_100008017 321
35 3300009093 Ga0105240_10002598 Ga0105240_1000259820 321
36 3300010375 Ga0105239_10000902 Ga0105239_1000090220 321
37 3300025913 Ga0207695_10000100 Ga0207695_10000100175 321
38 3300025913 Ga0207695_10002253 Ga0207695_100022537 321
39 3300048904 Ga0496101_0102311 Ga0496101_0102311_827_1852 321
40 3300048907 Ga0496104_0001832 Ga0496104_0001832_5532_6557 321
41 3300048908 Ga0496105_0011699 Ga0496105_0011699_1865_2890 321
42 3300048910 Ga0496107_0018550 Ga0496107_0018550_2186_3211 321
43 3300048918 Ga0496115_0029059 Ga0496115_0029059_2163_3188 321
44 3300048920 Ga0496117_0006842 Ga0496117_0006842_10272_11297 321
45 3300048920 Ga0496117_0024285 Ga0496117_0024285_2339_3364 321
46 3300048921 Ga0496118_0001653 Ga0496118_0001653_5949_6974 321
47 3300048921 Ga0496118_0002972 Ga0496118_0002972_7358_8383 321
48 3300048922 Ga0496119_0000094 Ga0496119_0000094_56603_57628 321
49 3300048923 Ga0496120_0000013 Ga0496120_0000013_273438_274463 321
50 3300048929 Ga0496126_0000301 Ga0496126_0000301_23374_24399 321
51 iso_pu_bacteria 2775506925 2776371536 322
52 iso_pu_bacteria 2863067949 2863070954 322
53 iso_pu_bacteria 2919513703 2919516015 322
54 iso_pu_bacteria 2919675420 2919677825 322
55 iso_pu_bacteria 2643221577 2643896667 323
56 iso_pu_bacteria 2643221685 2644478583 323
57 iso_pu_bacteria 8047710418 8047715526 323
58 3300005843 Ga0068860_100158507 Ga0068860_1001585072 324
59 3300005844 Ga0068862_100000058 Ga0068862_10000005824 324
60 3300006931 Ga0097620_100000036 Ga0097620_10000003649 324
61 3300010375 Ga0105239_10085247 Ga0105239_100852471 324
62 3300025900 Ga0207710_10094666 Ga0207710_100946662 324
63 3300025914 Ga0207671_10109218 Ga0207671_101092182 324
64 3300026035 Ga0207703_10231303 Ga0207703_102313031 324
65 3300028380 Ga0268265_10000075 Ga0268265_1000007511 324
66 3300049742 Ga0501080_0365330 Ga0501080_0365330_265_1242 324
67 iso_pu_bacteria 2524614729 2525556749 324
68 iso_pu_bacteria 2627854209 2630648345 324
69 iso_pu_bacteria 2747842501 2748018572 324
70 iso_pu_bacteria 2895498888 2895499673 324
71 iso_pu_bacteria 2895511927 2895512697 324
72 iso_pu_bacteria 2895522137 2895522711 324
73 iso_pu_bacteria 2895525241 2895525527 324
74 iso_pu_bacteria 8003014200 8003017422 324
75 3300005367 Ga0070667_100000010 Ga0070667_100000010114 325
76 3300005367 Ga0070667_100038301 Ga0070667_1000383012 325
77 3300005455 Ga0070663_100000341 Ga0070663_10000034120 325
78 3300005539 Ga0068853_100005811 Ga0068853_1000058112 325
79 3300005548 Ga0070665_100000053 Ga0070665_10000005330 325
80 3300009093 Ga0105240_10544428 Ga0105240_105444281 325
81 3300009177 Ga0105248_10000374 Ga0105248_1000037414 325
82 3300009545 Ga0105237_10015122 Ga0105237_100151227 325
83 3300009553 Ga0105249_10000501 Ga0105249_1000050128 325
84 3300010375 Ga0105239_10150206 Ga0105239_101502062 325
85 3300025914 Ga0207671_10003270 Ga0207671_1000327011 325
86 3300025941 Ga0207711_10000437 Ga0207711_1000043722 325
87 3300025961 Ga0207712_10000094 Ga0207712_1000009416 325
88 3300025986 Ga0207658_10000053 Ga0207658_1000005327 325
89 3300025986 Ga0207658_10026902 Ga0207658_100269022 325
90 3300026041 Ga0207639_10209971 Ga0207639_102099711 325
91 3300026067 Ga0207678_10008754 Ga0207678_100087543 325
92 3300028379 Ga0268266_10000001 Ga0268266_1000000127 325
93 3300028381 Ga0268264_10205645 Ga0268264_102056451 325
94 3300041486 Ga0451807_1120056 Ga0451807_1120056_1217_2227 325
95 3300047472 Ga0495686_0001969 Ga0495686_0001969_19364_20344 325
96 3300048921 Ga0496118_0000313 Ga0496118_0000313_42883_43863 325
97 3300048921 Ga0496118_0111907 Ga0496118_0111907_657_1637 325
98 3300048925 Ga0496122_0000940 Ga0496122_0000940_51782_52762 325
99 3300048926 Ga0496123_0000029 Ga0496123_0000029_146749_147729 325
100 3300049568 Ga0501031_0004350 Ga0501031_0004350_7672_8667 325
101 3300049569 Ga0501032_0000994 Ga0501032_0000994_4501_5496 325
102 3300049570 Ga0501033_0008456 Ga0501033_0008456_2473_3468 325
103 3300049571 Ga0501034_0001262 Ga0501034_0001262_17324_18319 325
104 3300049573 Ga0501037_0008180 Ga0501037_0008180_1611_2606 325
105 3300049574 Ga0501038_0003208 Ga0501038_0003208_7601_8596 325
106 3300049575 Ga0501039_0021401 Ga0501039_0021401_1765_2760 325
107 3300049579 Ga0501043_0001679 Ga0501043_0001679_2096_3091 325
108 3300049580 Ga0501046_0001275 Ga0501046_0001275_7281_8276 325
109 3300049581 Ga0501047_0015182 Ga0501047_0015182_4373_5368 325
110 3300049589 Ga0501073_0010811 Ga0501073_0010811_4115_5110 325
111 3300049742 Ga0501080_0017902 Ga0501080_0017902_1595_2590 325
112 3300049822 Ga0501035_0015608 Ga0501035_0015608_2473_3468 325
113 3300049823 Ga0501044_0001236 Ga0501044_0001236_16004_16999 325
114 3300053087 Ga0500643_010471 Ga0500643_010471_106_1086 325
115 3300053120 Ga0500597_044989 Ga0500597_044989_775_1755 325
116 iso_pu_bacteria 2643221559 2643816116 325
117 iso_pu_bacteria 2643221573 2643881065 325
118 iso_pu_bacteria 2643221586 2643939198 325
119 iso_pu_bacteria 2643221593 2643977577 325
120 iso_pu_bacteria 2643221612 2644077879 325
121 iso_pu_bacteria 2643221720 2644661835 325
122 iso_pu_bacteria 2643221727 2644697150 325
123 iso_pu_bacteria 2643221728 2644699976 325
124 iso_pu_bacteria 2941489479 2941492466 325
125 iso_pu_bacteria 2995948881 2995953276 325
126 iso_pu_bacteria 8002869464 8002869929 325
127 3300021388 Ga0213875_10004941 Ga0213875_100049414 326
128 3300033179 Ga0307507_10095124 Ga0307507_100951242 326
129 3300037853 Ga0436364_0915093 Ga0436364_0915093_6848_7861 326
130 3300045049 Ga0466959_0048943 Ga0466959_0048943_204_1184 326
131 3300048920 Ga0496117_0004738 Ga0496117_0004738_1091_2071 326
132 3300048921 Ga0496118_0001244 Ga0496118_0001244_25610_26590 326
133 iso_pu_bacteria 2643221695 2644530092 326
134 iso_pu_bacteria 2818991457 2819661195 326
135 iso_pu_bacteria 2894414249 2894414964 326
136 iso_pu_bacteria 2906799679 2906800325 326
137 iso_pu_bacteria 2919130084 2919131160 326
138 iso_pu_bacteria 2929195423 2929196401 326
139 iso_pu_bacteria 8021622325 8021624961 326
140 iso_pu_bacteria 8021626552 8021626776 326
141 iso_pu_bacteria 8021648035 8021650070 326
142 3300031730 Ga0307516_10065953 Ga0307516_100659532 327
143 iso_pu_bacteria 2643221579 2643906726 327
144 iso_pu_bacteria 2643221581 2643913772 327
145 iso_pu_bacteria 2643221632 2644182970 327
146 iso_pu_bacteria 2852684882 2852687055 327
147 iso_pu_bacteria 2923516293 2923519684 327
148 3300005335 Ga0070666_10011277 Ga0070666_100112772 328
149 3300005539 Ga0068853_100252266 Ga0068853_1002522662 328
150 3300005548 Ga0070665_100000249 Ga0070665_10000024982 328
151 3300005563 Ga0068855_100061712 Ga0068855_1000617122 328
152 3300005578 Ga0068854_100010275 Ga0068854_1000102752 328
153 3300005616 Ga0068852_100182547 Ga0068852_1001825472 328
154 3300005617 Ga0068859_100110776 Ga0068859_1001107763 328
155 3300005834 Ga0068851_10004345 Ga0068851_100043454 328
156 3300005842 Ga0068858_100003000 Ga0068858_1000030008 328
157 3300006931 Ga0097620_100110788 Ga0097620_1001107883 328
158 3300009551 Ga0105238_10006357 Ga0105238_1000635710 328
159 3300009551 Ga0105238_10064830 Ga0105238_100648302 328
160 3300009553 Ga0105249_10029254 Ga0105249_100292541 328
161 3300013307 Ga0157372_10293980 Ga0157372_102939802 328
162 3300025321 Ga0207656_10000925 Ga0207656_100009253 328
163 3300025903 Ga0207680_10045783 Ga0207680_100457832 328
164 3300025904 Ga0207647_10000111 Ga0207647_1000011133 328
165 3300025913 Ga0207695_10000033 Ga0207695_10000033159 328
166 3300025913 Ga0207695_10027246 Ga0207695_100272463 328
167 3300025914 Ga0207671_10023009 Ga0207671_100230093 328
168 3300025914 Ga0207671_10127071 Ga0207671_101270711 328
169 3300025920 Ga0207649_10168323 Ga0207649_101683232 328
170 3300025924 Ga0207694_10010264 Ga0207694_100102646 328
171 3300025924 Ga0207694_10072225 Ga0207694_100722252 328
172 3300025925 Ga0207650_10316323 Ga0207650_103163231 328
173 3300025933 Ga0207706_10086920 Ga0207706_100869202 328
174 3300025949 Ga0207667_10209618 Ga0207667_102096182 328
175 3300025961 Ga0207712_10000477 Ga0207712_100004776 328
176 3300025981 Ga0207640_10022660 Ga0207640_100226602 328
177 3300025986 Ga0207658_10011805 Ga0207658_100118052 328
178 3300026035 Ga0207703_10001468 Ga0207703_1000146815 328
179 3300026035 Ga0207703_10424716 Ga0207703_104247162 328
180 3300026041 Ga0207639_10000197 Ga0207639_1000019711 328
181 3300026067 Ga0207678_10007165 Ga0207678_100071658 328
182 3300026078 Ga0207702_10071263 Ga0207702_100712632 328
183 3300026142 Ga0207698_10054240 Ga0207698_100542402 328
184 3300026142 Ga0207698_10104207 Ga0207698_101042072 328
185 3300028379 Ga0268266_10000006 Ga0268266_10000006155 328
186 iso_pu_bacteria 2842780639 2842782260 328
187 3300047320 Ga0495672_0041308 Ga0495672_0041308_1125_2150 329
188 3300048926 Ga0496123_0075180 Ga0496123_0075180_1083_2075 329
189 iso_pu_bacteria 2537561836 2538834416 329
190 iso_pu_bacteria 2643221562 2643828812 329
191 iso_pu_bacteria 2643221663 2644353865 329
192 iso_pu_bacteria 2895395659 2895398129 329
193 iso_pu_bacteria 2928972540 2928973763 329
194 iso_pu_bacteria 2939611941 2939613440 329
195 iso_pu_bacteria 2941485952 2941489460 329
196 iso_pu_bacteria 2977240413 2977241275 329
197 3300003781 Ga0055536_1000290 Ga0055536_100029018 330
198 3300003794 Ga0055531_10017697 Ga0055531_100176972 330
199 3300005327 Ga0070658_10320043 Ga0070658_103200431 330
200 3300005367 Ga0070667_100050214 Ga0070667_1000502143 330
201 3300005563 Ga0068855_100010440 Ga0068855_1000104403 330
202 3300005614 Ga0068856_100169332 Ga0068856_1001693323 330
203 3300005617 Ga0068859_100159626 Ga0068859_1001596262 330
204 3300005618 Ga0068864_100015349 Ga0068864_1000153493 330
205 3300005834 Ga0068851_10000001 Ga0068851_10000001351 330
206 3300005842 Ga0068858_100001687 Ga0068858_1000016874 330
207 3300006931 Ga0097620_100159619 Ga0097620_1001596192 330
208 3300009093 Ga0105240_10002391 Ga0105240_1000239134 330
209 3300009098 Ga0105245_10112842 Ga0105245_101128423 330
210 3300009174 Ga0105241_10001789 Ga0105241_1000178919 330
211 3300009177 Ga0105248_10019760 Ga0105248_100197603 330
212 3300009545 Ga0105237_10001835 Ga0105237_100018352 330
213 3300013104 Ga0157370_10031870 Ga0157370_100318702 330
214 3300014325 Ga0163163_10013819 Ga0163163_100138196 330
215 3300025254 Ga0209148_1000528 Ga0209148_100052816 330
216 3300025292 Ga0209676_1000182 Ga0209676_100018235 330
217 3300025292 Ga0209676_1001439 Ga0209676_10014396 330
218 3300025298 Ga0209050_1021354 Ga0209050_10213542 330
219 3300025304 Ga0209257_1000484 Ga0209257_100048436 330
220 3300025321 Ga0207656_10000002 Ga0207656_10000002577 330
221 3300025909 Ga0207705_10060663 Ga0207705_100606632 330
222 3300025911 Ga0207654_10000001 Ga0207654_100000011284 330
223 3300025913 Ga0207695_10002266 Ga0207695_1000226635 330
224 3300025913 Ga0207695_10043108 Ga0207695_100431083 330
225 3300025913 Ga0207695_10153396 Ga0207695_101533962 330
226 3300025914 Ga0207671_10000002 Ga0207671_10000002871 330
227 3300025924 Ga0207694_10000740 Ga0207694_1000074013 330
228 3300025932 Ga0207690_10003540 Ga0207690_100035402 330
229 3300025941 Ga0207711_10003934 Ga0207711_100039349 330
230 3300025949 Ga0207667_10004560 Ga0207667_1000456012 330
231 3300025949 Ga0207667_10011726 Ga0207667_100117263 330
232 3300025949 Ga0207667_10212012 Ga0207667_102120122 330
233 3300025986 Ga0207658_10052993 Ga0207658_100529933 330
234 3300026035 Ga0207703_10000168 Ga0207703_100001687 330
235 3300026095 Ga0207676_10089174 Ga0207676_100891742 330
236 3300026116 Ga0207674_10032341 Ga0207674_100323413 330
237 3300026142 Ga0207698_10001978 Ga0207698_1000197814 330
238 3300028794 Ga0307515_10238159 Ga0307515_102381592 330
239 3300031649 Ga0307514_10177529 Ga0307514_101775291 330
240 3300031901 Ga0307406_10002892 Ga0307406_100028929 330
241 3300032004 Ga0307414_10027560 Ga0307414_100275602 330
242 3300032004 Ga0307414_10042514 Ga0307414_100425142 330
243 3300046457 Ga0495590_0009137 Ga0495590_0009137_735_1760 330
244 3300046471 Ga0495650_0000810 Ga0495650_0000810_15423_16448 330
245 3300046558 Ga0495633_0000384 Ga0495633_0000384_21981_22994 330
246 3300047320 Ga0495672_0016333 Ga0495672_0016333_1232_2257 330
247 3300047472 Ga0495686_0053074 Ga0495686_0053074_935_1960 330
248 3300048919 Ga0496116_0042148 Ga0496116_0042148_420_1433 330
249 3300048921 Ga0496118_0008694 Ga0496118_0008694_4559_5560 330
250 3300048921 Ga0496118_0073500 Ga0496118_0073500_884_1909 330
251 3300048923 Ga0496120_0001093 Ga0496120_0001093_26019_27044 330
252 3300048923 Ga0496120_0008970 Ga0496120_0008970_3708_4733 330
253 3300048925 Ga0496122_0019128 Ga0496122_0019128_4793_5806 330
254 3300048926 Ga0496123_0001905 Ga0496123_0001905_89_1102 330
255 3300048927 Ga0496124_0280566 Ga0496124_0280566_17_1030 330
256 3300048928 Ga0496125_0080384 Ga0496125_0080384_610_1635 330
257 3300049571 Ga0501034_0013755 Ga0501034_0013755_2825_3850 330
258 3300049579 Ga0501043_0004377 Ga0501043_0004377_2056_3081 330
259 3300049586 Ga0501070_0003729 Ga0501070_0003729_531_1556 330
260 3300049589 Ga0501073_0021215 Ga0501073_0021215_2890_3915 330
261 3300049742 Ga0501080_0000161 Ga0501080_0000161_17788_18813 330
262 3300049744 Ga0501083_0016567 Ga0501083_0016567_3034_4059 330
263 3300053080 Ga0500635_0094882 Ga0500635_0094882_48_1073 330
264 3300053104 Ga0500556_0000001 Ga0500556_0000001_899151_900176 330
265 3300053136 Ga0500559_0001617 Ga0500559_0001617_11179_12204 330
266 3300053136 Ga0500559_0010491 Ga0500559_0010491_1869_2894 330
267 3300053139 Ga0500568_0000003 Ga0500568_0000003_720866_721891 330
268 3300053139 Ga0500568_0022190 Ga0500568_0022190_627_1652 330
269 3300053148 Ga0500590_007979 Ga0500590_007979_1758_2783 330
270 3300053153 Ga0500616_0000205 Ga0500616_0000205_71112_72137 330
271 3300053153 Ga0500616_0000970 Ga0500616_0000970_1490_2515 330
272 3300053155 Ga0500620_000200 Ga0500620_000200_5034_6059 330
273 iso_pu_bacteria 2739367700 2739733602 330
274 iso_pu_bacteria 2928963466 2928966211 330
275 3300005331 Ga0070670_100115519 Ga0070670_1001155192 331
276 3300005367 Ga0070667_100066825 Ga0070667_1000668252 331
277 3300005577 Ga0068857_100105489 Ga0068857_1001054892 331
278 3300025904 Ga0207647_10186939 Ga0207647_101869391 331
279 3300025986 Ga0207658_10156441 Ga0207658_101564412 331
280 3300026095 Ga0207676_10569779 Ga0207676_105697791 331
281 3300026116 Ga0207674_10002030 Ga0207674_1000203015 331
282 3300044683 Ga0466965_0001445 Ga0466965_0001445_2435_3442 331
283 3300044693 Ga0466961_0006978 Ga0466961_0006978_1105_2112 331
284 3300044694 Ga0466963_0130991 Ga0466963_0130991_250_1257 331
285 3300044719 Ga0466971_0029258 Ga0466971_0029258_1260_2267 331
286 3300044842 Ga0466957_0046799 Ga0466957_0046799_197_1204 331
287 3300045049 Ga0466959_0059481 Ga0466959_0059481_482_1489 331
288 3300045836 Ga0466958_0004725 Ga0466958_0004725_4639_5646 331
289 3300049568 Ga0501031_0015158 Ga0501031_0015158_3884_4912 331
290 3300049569 Ga0501032_0002696 Ga0501032_0002696_96_1124 331
291 3300049570 Ga0501033_0014077 Ga0501033_0014077_3283_4311 331
292 3300049570 Ga0501033_0126180 Ga0501033_0126180_332_1360 331
293 3300049573 Ga0501037_0003570 Ga0501037_0003570_3271_4299 331
294 3300049574 Ga0501038_0002517 Ga0501038_0002517_792_1820 331
295 3300049578 Ga0501042_0176459 Ga0501042_0176459_69_1097 331
296 3300049579 Ga0501043_0096334 Ga0501043_0096334_107_1135 331
297 3300049580 Ga0501046_0001926 Ga0501046_0001926_210_1238 331
298 3300049582 Ga0501048_0007295 Ga0501048_0007295_6192_7220 331
299 3300049586 Ga0501070_0167375 Ga0501070_0167375_761_1789 331
300 3300049744 Ga0501083_0000055 Ga0501083_0000055_81121_82149 331
301 3300049744 Ga0501083_0004721 Ga0501083_0004721_985_2013 331
302 3300053093 Ga0500651_0029088 Ga0500651_0029088_1823_2833 331
303 3300061719 Ga0466962_0009010 Ga0466962_0009010_197_1204 331
304 iso_pu_bacteria 2687453130 2687581401 331
305 iso_pu_bacteria 2842914999 2842916793 331
306 iso_pu_bacteria 2884411467 2884416240 331
307 3300002737 JGI25162J39368_1005372 JGI25162J39368_10053722 332
308 3300002772 JGI25164J39214_1002720 JGI25164J39214_10027202 332
309 3300003214 JGI25165J46597_1000623 JGI25165J46597_10006232 332
310 3300005435 Ga0070714_100000136 Ga0070714_10000013649 332
311 3300005455 Ga0070663_100159500 Ga0070663_1001595002 332
312 3300005457 Ga0070662_100122518 Ga0070662_1001225182 332
313 3300005458 Ga0070681_10040104 Ga0070681_100401042 332
314 3300005458 Ga0070681_10054089 Ga0070681_100540892 332
315 3300005539 Ga0068853_100009630 Ga0068853_1000096305 332
316 3300005539 Ga0068853_100217042 Ga0068853_1002170422 332
317 3300005546 Ga0070696_100003127 Ga0070696_1000031279 332
318 3300005547 Ga0070693_100175421 Ga0070693_1001754211 332
319 3300005563 Ga0068855_100104594 Ga0068855_1001045943 332
320 3300005577 Ga0068857_100072530 Ga0068857_1000725302 332
321 3300005614 Ga0068856_100033319 Ga0068856_1000333194 332
322 3300009545 Ga0105237_10065828 Ga0105237_100658282 332
323 3300010375 Ga0105239_10018640 Ga0105239_100186408 332
324 3300013307 Ga0157372_10100063 Ga0157372_101000632 332
325 3300025231 Ga0207427_100191 Ga0207427_10019151 332
326 3300025233 Ga0209437_100167 Ga0209437_100167100 332
327 3300025261 Ga0209233_1000046 Ga0209233_1000046100 332
328 3300025904 Ga0207647_10003069 Ga0207647_1000306911 332
329 3300025909 Ga0207705_10018914 Ga0207705_100189144 332
330 3300025912 Ga0207707_10145047 Ga0207707_101450471 332
331 3300025917 Ga0207660_10288606 Ga0207660_102886062 332
332 3300025919 Ga0207657_10271643 Ga0207657_102716431 332
333 3300025920 Ga0207649_10022479 Ga0207649_100224792 332
334 3300025921 Ga0207652_10108129 Ga0207652_101081292 332
335 3300025929 Ga0207664_10002661 Ga0207664_100026614 332
336 3300025932 Ga0207690_10025869 Ga0207690_100258692 332
337 3300025932 Ga0207690_10036769 Ga0207690_100367692 332
338 3300025933 Ga0207706_10026521 Ga0207706_100265212 332
339 3300026041 Ga0207639_10062210 Ga0207639_100622102 332
340 3300026078 Ga0207702_10042293 Ga0207702_100422932 332
341 3300026116 Ga0207674_10026613 Ga0207674_100266135 332
342 3300026116 Ga0207674_10150631 Ga0207674_101506312 332
343 3300038443 Ga0395901_0007382 Ga0395901_0007382_4800_5810 332
344 3300042012 Ga0439455_0001585 Ga0439455_0001585_1422_2432 332
345 3300048918 Ga0496115_0000139 Ga0496115_0000139_45922_46929 332
346 3300048929 Ga0496126_0000033 Ga0496126_0000033_118960_119967 332
347 3300049571 Ga0501034_0035783 Ga0501034_0035783_3753_4763 332
348 3300049585 Ga0501069_0000314 Ga0501069_0000314_9677_10690 332
349 3300049586 Ga0501070_0053067 Ga0501070_0053067_1954_2964 332
350 3300049593 Ga0501077_0017477 Ga0501077_0017477_2336_3346 332
351 3300049822 Ga0501035_0011177 Ga0501035_0011177_6766_7776 332
352 3300002737 JGI25162J39368_1000228 JGI25162J39368_100022850 333
353 3300002738 JGI25154J39366_1003466 JGI25154J39366_10034663 333
354 3300002741 JGI25157J39369_1000660 JGI25157J39369_100066010 333
355 3300002772 JGI25164J39214_1000004 JGI25164J39214_1000004268 333
356 3300003214 JGI25165J46597_1000164 JGI25165J46597_100016463 333
357 3300003762 Ga0055542_1000193 Ga0055542_100019337 333
358 3300003763 Ga0055529_1000102 Ga0055529_100010287 333
359 3300025228 Ga0209672_100084 Ga0209672_10008437 333
360 3300025231 Ga0207427_100031 Ga0207427_10003137 333
361 3300025233 Ga0209437_100061 Ga0209437_100061268 333
362 3300025242 Ga0209258_100104 Ga0209258_100104134 333
363 3300025242 Ga0209258_100188 Ga0209258_10018886 333
364 3300025246 Ga0209646_1002273 Ga0209646_10022733 333
365 3300025250 Ga0209026_1000171 Ga0209026_100017159 333
366 3300025250 Ga0209026_1000588 Ga0209026_100058814 333
367 3300025250 Ga0209026_1001016 Ga0209026_100101613 333
368 3300025254 Ga0209148_1000063 Ga0209148_1000063265 333
369 3300025254 Ga0209148_1000106 Ga0209148_1000106135 333
370 3300025256 Ga0209759_1000137 Ga0209759_100013782 333
371 3300025256 Ga0209759_1000487 Ga0209759_100048738 333
372 3300025256 Ga0209759_1001330 Ga0209759_10013304 333
373 3300025261 Ga0209233_1000076 Ga0209233_100007637 333
374 3300025272 Ga0209455_1000165 Ga0209455_100016524 333
375 3300026118 Ga0207675_100200837 Ga0207675_1002008371 333
376 3300037312 Ga0395899_0000146 Ga0395899_0000146_66618_67631 333
377 3300037312 Ga0395899_0003483 Ga0395899_0003483_10165_11178 333
378 3300037418 Ga0395900_0000272 Ga0395900_0000272_38324_39337 333
379 3300037466 Ga0395898_0000329 Ga0395898_0000329_39641_40654 333
380 3300037466 Ga0395898_0000387 Ga0395898_0000387_36955_37968 333
381 3300038443 Ga0395901_0166941 Ga0395901_0166941_886_1899 333
382 3300044684 Ga0466966_0019156 Ga0466966_0019156_864_1877 333
383 3300044693 Ga0466961_0000703 Ga0466961_0000703_18371_19384 333
384 3300044693 Ga0466961_0001035 Ga0466961_0001035_1085_2098 333
385 3300045049 Ga0466959_0000266 Ga0466959_0000266_22418_23431 333
386 3300045049 Ga0466959_0068491 Ga0466959_0068491_987_2000 333
387 3300045976 Ga0466967_0036051 Ga0466967_0036051_2463_3476 333
388 3300049571 Ga0501034_0001429 Ga0501034_0001429_18053_19072 333
389 3300049574 Ga0501038_0006715 Ga0501038_0006715_7189_8208 333
390 3300049581 Ga0501047_0000768 Ga0501047_0000768_12788_13807 333
391 3300049583 Ga0501067_0000124 Ga0501067_0000124_36760_37779 333
392 3300049586 Ga0501070_0025838 Ga0501070_0025838_2597_3616 333
393 3300049588 Ga0501072_0051627 Ga0501072_0051627_45_1064 333
394 3300049589 Ga0501073_0001873 Ga0501073_0001873_6476_7495 333
395 3300049590 Ga0501074_0012841 Ga0501074_0012841_4869_5888 333
396 3300049742 Ga0501080_0005039 Ga0501080_0005039_7570_8589 333
397 3300049744 Ga0501083_0025177 Ga0501083_0025177_2063_3082 333
398 3300049823 Ga0501044_0012370 Ga0501044_0012370_559_1578 333
399 3300060353 Ga0501082_0076404 Ga0501082_0076404_323_1342 333
400 3300003760 Ga0055527_1000070 Ga0055527_100007038 334
401 3300003760 Ga0055527_1000077 Ga0055527_100007735 334
402 3300003761 Ga0055535_1000117 Ga0055535_100011738 334
403 3300003761 Ga0055535_1000130 Ga0055535_100013045 334
404 3300003762 Ga0055542_1000156 Ga0055542_100015649 334
405 3300003762 Ga0055542_1000174 Ga0055542_100017445 334
406 3300003763 Ga0055529_1000201 Ga0055529_100020145 334
407 3300003763 Ga0055529_1000353 Ga0055529_100035313 334
408 3300005458 Ga0070681_10126267 Ga0070681_101262672 334
409 3300005614 Ga0068856_100010412 Ga0068856_1000104125 334
410 3300013307 Ga0157372_10031524 Ga0157372_100315247 334
411 3300025226 Ga0209674_100486 Ga0209674_10048614 334
412 3300025228 Ga0209672_100070 Ga0209672_10007036 334
413 3300025228 Ga0209672_100099 Ga0209672_10009936 334
414 3300025230 Ga0209563_100161 Ga0209563_10016130 334
415 3300025242 Ga0209258_100054 Ga0209258_100054261 334
416 3300025242 Ga0209258_100218 Ga0209258_10021836 334
417 3300025253 Ga0209677_104660 Ga0209677_1046603 334
418 3300025254 Ga0209148_1000066 Ga0209148_1000066261 334
419 3300025254 Ga0209148_1000196 Ga0209148_100019636 334
420 3300025272 Ga0209455_1000146 Ga0209455_100014636 334
421 3300025272 Ga0209455_1000173 Ga0209455_100017336 334
422 3300025924 Ga0207694_10231149 Ga0207694_102311492 334
423 3300026078 Ga0207702_10000362 Ga0207702_1000036252 334
424 3300037312 Ga0395899_0191859 Ga0395899_0191859_362_1372 334
425 3300037418 Ga0395900_0000706 Ga0395900_0000706_1592_2602 334
426 3300037418 Ga0395900_0005617 Ga0395900_0005617_968_1978 334
427 3300037418 Ga0395900_0088103 Ga0395900_0088103_732_1742 334
428 3300037466 Ga0395898_0012851 Ga0395898_0012851_7060_8070 334
429 3300037466 Ga0395898_0115704 Ga0395898_0115704_1011_2021 334
430 3300038443 Ga0395901_0033820 Ga0395901_0033820_471_1481 334
431 3300042876 Ga0451577_0159044 Ga0451577_0159044_110_1150 334
432 3300044672 Ga0466982_0000041 Ga0466982_0000041_11498_12523 334
433 3300049570 Ga0501033_0124236 Ga0501033_0124236_645_1655 334
434 3300049573 Ga0501037_0018027 Ga0501037_0018027_248_1264 334
435 3300049580 Ga0501046_0079855 Ga0501046_0079855_1462_2472 334
436 3300049590 Ga0501074_0024269 Ga0501074_0024269_2059_3090 334
437 iso_pu_bacteria 2593339239 2595450562 334
438 iso_pu_bacteria 2818991440 2819566380 334
439 iso_pu_bacteria 2904463128 2904467047 334
440 iso_pu_bacteria 2919404418 2919407514 334
441 3300005355 Ga0070671_100204996 Ga0070671_1002049962 335
442 3300005356 Ga0070674_100290918 Ga0070674_1002909181 335
443 3300005364 Ga0070673_100037980 Ga0070673_1000379802 335
444 3300005366 Ga0070659_100229374 Ga0070659_1002293742 335
445 3300005456 Ga0070678_100009297 Ga0070678_1000092973 335
446 3300005456 Ga0070678_100089589 Ga0070678_1000895892 335
447 3300005458 Ga0070681_10021990 Ga0070681_100219902 335
448 3300005617 Ga0068859_100522510 Ga0068859_1005225102 335
449 3300005841 Ga0068863_100078304 Ga0068863_1000783042 335
450 3300006931 Ga0097620_100522516 Ga0097620_1005225162 335
451 3300009177 Ga0105248_10114072 Ga0105248_101140722 335
452 3300013104 Ga0157370_10304097 Ga0157370_103040971 335
453 3300013306 Ga0163162_10035359 Ga0163162_100353592 335
454 3300013307 Ga0157372_10004560 Ga0157372_100045603 335
455 3300014969 Ga0157376_10009818 Ga0157376_100098181 335
456 3300025231 Ga0207427_100044 Ga0207427_10004496 335
457 3300025231 Ga0207427_100088 Ga0207427_10008895 335
458 3300025233 Ga0209437_100005 Ga0209437_100005280 335
459 3300025261 Ga0209233_1000011 Ga0209233_1000011661 335
460 3300025912 Ga0207707_10016515 Ga0207707_100165152 335
461 3300025931 Ga0207644_10403114 Ga0207644_104031141 335
462 3300025932 Ga0207690_10021073 Ga0207690_100210732 335
463 3300025933 Ga0207706_10234313 Ga0207706_102343132 335
464 3300025941 Ga0207711_10135609 Ga0207711_101356092 335
465 3300025972 Ga0207668_10243291 Ga0207668_102432911 335
466 3300026089 Ga0207648_10083277 Ga0207648_100832771 335
467 3300026121 Ga0207683_10033881 Ga0207683_100338813 335
468 3300026121 Ga0207683_10084611 Ga0207683_100846112 335
469 3300048925 Ga0496122_0021025 Ga0496122_0021025_3424_4434 335
470 3300048927 Ga0496124_0001211 Ga0496124_0001211_25141_26151 335
471 3300048927 Ga0496124_0001213 Ga0496124_0001213_25146_26156 335
472 iso_pu_bacteria 2593339238 2595449274 335
473 iso_pu_bacteria 2718218334 2721029295 335
474 iso_pu_bacteria 2734482264 2735835108 335
475 iso_pu_bacteria 2738543009 2739228969 335
476 iso_pu_bacteria 2842918807 2842922583 335
477 iso_pu_bacteria 2884338543 2884342503 335
478 iso_pu_bacteria 2919085039 2919088885 335
479 iso_pu_bacteria 2941471342 2941475644 335
480 iso_pu_bacteria 2953994433 2953996701 335
481 3300005338 Ga0068868_100225548 Ga0068868_1002255482 336
482 3300005344 Ga0070661_100094373 Ga0070661_1000943732 336
483 3300005353 Ga0070669_100302932 Ga0070669_1003029321 336
484 3300005614 Ga0068856_100005470 Ga0068856_1000054702 336
485 3300005614 Ga0068856_100006964 Ga0068856_1000069643 336
486 3300005614 Ga0068856_100117006 Ga0068856_1001170062 336
487 3300005616 Ga0068852_100097665 Ga0068852_1000976652 336
488 3300005618 Ga0068864_100001935 Ga0068864_10000193511 336
489 3300005841 Ga0068863_100160999 Ga0068863_1001609992 336
490 3300006237 Ga0097621_100077590 Ga0097621_1000775902 336
491 3300006237 Ga0097621_100105823 Ga0097621_1001058232 336
492 3300006237 Ga0097621_100278644 Ga0097621_1002786441 336
493 3300006358 Ga0068871_100389372 Ga0068871_1003893721 336
494 3300009098 Ga0105245_10344551 Ga0105245_103445511 336
495 3300009551 Ga0105238_10218775 Ga0105238_102187752 336
496 3300009551 Ga0105238_10289823 Ga0105238_102898232 336
497 3300010375 Ga0105239_10114745 Ga0105239_101147452 336
498 3300010375 Ga0105239_10553470 Ga0105239_105534702 336
499 3300013105 Ga0157369_10000057 Ga0157369_1000005735 336
500 3300013105 Ga0157369_10147562 Ga0157369_101475622 336
501 3300013105 Ga0157369_10210257 Ga0157369_102102571 336
502 3300013297 Ga0157378_10000031 Ga0157378_1000003163 336
503 3300013297 Ga0157378_10144798 Ga0157378_101447981 336
504 3300013306 Ga0163162_10000021 Ga0163162_10000021174 336
505 3300013306 Ga0163162_10136240 Ga0163162_101362402 336
506 3300013307 Ga0157372_10002926 Ga0157372_100029262 336
507 3300013308 Ga0157375_10006577 Ga0157375_100065772 336
508 3300014325 Ga0163163_10000484 Ga0163163_1000048410 336
509 3300025903 Ga0207680_10000225 Ga0207680_100002259 336
510 3300025906 Ga0207699_10034038 Ga0207699_100340382 336
511 3300025913 Ga0207695_10000261 Ga0207695_10000261111 336
512 3300025913 Ga0207695_10002518 Ga0207695_100025185 336
513 3300025913 Ga0207695_10054607 Ga0207695_100546072 336
514 3300025914 Ga0207671_10008080 Ga0207671_100080807 336
515 3300025914 Ga0207671_10008084 Ga0207671_100080848 336
516 3300025920 Ga0207649_10000424 Ga0207649_100004247 336
517 3300025942 Ga0207689_10260779 Ga0207689_102607791 336
518 3300025949 Ga0207667_10003460 Ga0207667_100034604 336
519 3300026023 Ga0207677_10159415 Ga0207677_101594152 336
520 3300026035 Ga0207703_10265554 Ga0207703_102655542 336
521 3300026041 Ga0207639_10000670 Ga0207639_1000067010 336
522 3300026041 Ga0207639_10026027 Ga0207639_100260272 336
523 3300026078 Ga0207702_10071499 Ga0207702_100714991 336
524 3300026078 Ga0207702_10073483 Ga0207702_100734832 336
525 3300026095 Ga0207676_10015622 Ga0207676_100156222 336
526 3300026142 Ga0207698_10032787 Ga0207698_100327872 336
527 3300026142 Ga0207698_10343560 Ga0207698_103435601 336
528 3300028381 Ga0268264_10020135 Ga0268264_100201352 336
529 3300031616 Ga0307508_10106065 Ga0307508_101060652 336
530 3300031730 Ga0307516_10195625 Ga0307516_101956251 336
531 3300035171 Ga0373946_0083798 Ga0373946_0083798_343_1371 336
532 3300046681 Ga0495647_0006723 Ga0495647_0006723_2762_3790 336
533 3300046683 Ga0495658_0028529 Ga0495658_0028529_1804_2832 336
534 3300048907 Ga0496104_0000017 Ga0496104_0000017_287444_288475 336
535 3300048908 Ga0496105_0000009 Ga0496105_0000009_88330_89361 336
536 3300005548 Ga0070665_100518641 Ga0070665_1005186411 337
537 3300003578 Ga0006562J51391_1031759 Ga0006562J51391_10317597 338
538 3300003578 Ga0006562J51391_1031763 Ga0006562J51391_10317632 338
539 3300005327 Ga0070658_10004146 Ga0070658_100041462 338
540 3300005335 Ga0070666_10000079 Ga0070666_1000007934 338
541 3300005344 Ga0070661_100002731 Ga0070661_1000027316 338
542 3300005347 Ga0070668_100101915 Ga0070668_1001019152 338
543 3300005367 Ga0070667_100015909 Ga0070667_1000159092 338
544 3300005548 Ga0070665_100004714 Ga0070665_1000047148 338
545 3300009551 Ga0105238_10000145 Ga0105238_1000014521 338
546 3300013306 Ga0163162_10001472 Ga0163162_100014724 338
547 3300015265 Ga0182005_1017120 Ga0182005_10171202 338
548 3300025258 Ga0209129_1004485 Ga0209129_10044852 338
549 3300025297 Ga0209758_1010302 Ga0209758_10103022 338
550 3300025299 Ga0209256_1010388 Ga0209256_10103883 338
551 3300025903 Ga0207680_10000001 Ga0207680_10000001995 338
552 3300025909 Ga0207705_10008100 Ga0207705_100081002 338
553 3300025924 Ga0207694_10000828 Ga0207694_1000082813 338
554 3300025986 Ga0207658_10013378 Ga0207658_100133785 338
555 3300028379 Ga0268266_10000067 Ga0268266_1000006736 338
556 3300046471 Ga0495650_0001430 Ga0495650_0001430_18617_19636 338
557 3300046501 Ga0495607_0000640 Ga0495607_0000640_12542_13561 338
558 3300046519 Ga0495632_0141495 Ga0495632_0141495_47_1066 338
559 3300046660 Ga0495625_0012337 Ga0495625_0012337_4629_5648 338
560 3300048929 Ga0496126_0093596 Ga0496126_0093596_988_2007 338
561 3300001904 JGI24736J21556_1000782 JGI24736J21556_10007823 339
562 3300002075 JGI24738J21930_10000352 JGI24738J21930_100003524 339
563 3300005262 Ga0065165_1000204 Ga0065165_100020435 339
564 3300005344 Ga0070661_100025664 Ga0070661_1000256642 339
565 3300006186 Ga0075369_10037336 Ga0075369_100373362 339
566 3300009101 Ga0105247_10020943 Ga0105247_100209431 339
567 3300009551 Ga0105238_10115819 Ga0105238_101158192 339
568 3300013104 Ga0157370_10000837 Ga0157370_1000083722 339
569 3300013105 Ga0157369_10010571 Ga0157369_100105717 339
570 3300014497 Ga0182008_10002503 Ga0182008_100025032 339
571 3300015261 Ga0182006_1000189 Ga0182006_100018912 339
572 3300015261 Ga0182006_1000469 Ga0182006_10004699 339
573 3300015262 Ga0182007_10009677 Ga0182007_100096772 339
574 3300015265 Ga0182005_1000015 Ga0182005_1000015276 339
575 3300015265 Ga0182005_1000601 Ga0182005_10006012 339
576 3300015265 Ga0182005_1005157 Ga0182005_10051573 339
577 3300015265 Ga0182005_1036458 Ga0182005_10364582 339
578 3300017792 Ga0163161_10002763 Ga0163161_100027633 339
579 3300025226 Ga0209674_100810 Ga0209674_1008107 339
580 3300025254 Ga0209148_1002949 Ga0209148_10029495 339
581 3300025302 Ga0207426_1009854 Ga0207426_10098542 339
582 3300025303 Ga0209051_1008273 Ga0209051_10082733 339
583 3300025900 Ga0207710_10019278 Ga0207710_100192782 339
584 3300025904 Ga0207647_10000031 Ga0207647_1000003136 339
585 3300025924 Ga0207694_10015088 Ga0207694_100150882 339
586 3300026067 Ga0207678_10015494 Ga0207678_100154942 339
587 3300031911 Ga0307412_10001161 Ga0307412_100011619 339
588 3300041404 Ga0439436_0000003 Ga0439436_0000003_53741_54760 339
589 3300042004 Ga0439445_0007447 Ga0439445_0007447_384_1403 339
590 3300042184 Ga0450908_000008 Ga0450908_000008_36494_37513 339
591 3300044735 Ga0466968_0007949 Ga0466968_0007949_819_1844 339
592 3300046452 Ga0495617_000031 Ga0495617_000031_62819_63841 339
593 3300046452 Ga0495617_000059 Ga0495617_000059_63928_64950 339
594 3300046457 Ga0495590_0041650 Ga0495590_0041650_67_1089 339
595 3300046460 Ga0495638_0000278 Ga0495638_0000278_1133_2155 339
596 3300046471 Ga0495650_0000811 Ga0495650_0000811_17709_18728 339
597 3300046471 Ga0495650_0069876 Ga0495650_0069876_122_1141 339
598 3300046491 Ga0495584_0001879 Ga0495584_0001879_6741_7760 339
599 3300046492 Ga0495585_0000035 Ga0495585_0000035_59417_60439 339
600 3300046492 Ga0495585_0001919 Ga0495585_0001919_7774_8793 339
601 3300046501 Ga0495607_0000117 Ga0495607_0000117_10453_11475 339
602 3300046501 Ga0495607_0006154 Ga0495607_0006154_4664_5728 339
603 3300046506 Ga0495583_0006822 Ga0495583_0006822_5779_6801 339
604 3300046507 Ga0495606_0000174 Ga0495606_0000174_47316_48335 339
605 3300046507 Ga0495606_0001062 Ga0495606_0001062_9384_10406 339
606 3300046507 Ga0495606_0001499 Ga0495606_0001499_14400_15422 339
607 3300046512 Ga0495610_0002831 Ga0495610_0002831_11260_12279 339
608 3300046512 Ga0495610_0008589 Ga0495610_0008589_1983_3002 339
609 3300046513 Ga0495616_0000028 Ga0495616_0000028_43165_44184 339
610 3300046515 Ga0495620_0000088 Ga0495620_0000088_19887_20909 339
611 3300046515 Ga0495620_0000364 Ga0495620_0000364_17937_18956 339
612 3300046518 Ga0495631_0000156 Ga0495631_0000156_37551_38573 339
613 3300046518 Ga0495631_0000508 Ga0495631_0000508_17815_18834 339
614 3300046518 Ga0495631_0013649 Ga0495631_0013649_890_1912 339
615 3300046519 Ga0495632_0000005 Ga0495632_0000005_55629_56651 339
616 3300046519 Ga0495632_0008732 Ga0495632_0008732_3872_4891 339
617 3300046520 Ga0495637_0004833 Ga0495637_0004833_4509_5531 339
618 3300046524 Ga0495648_0001237 Ga0495648_0001237_13942_14964 339
619 3300046524 Ga0495648_0004640 Ga0495648_0004640_3522_4541 339
620 3300046538 Ga0495609_0001744 Ga0495609_0001744_6234_7256 339
621 3300046616 Ga0495668_0001645 Ga0495668_0001645_11311_12333 339
622 3300046648 Ga0495611_0000049 Ga0495611_0000049_66154_67173 339
623 3300046648 Ga0495611_0000059 Ga0495611_0000059_67157_68179 339
624 3300046660 Ga0495625_0000288 Ga0495625_0000288_9856_10878 339
625 3300046660 Ga0495625_0030994 Ga0495625_0030994_358_1377 339
626 3300046660 Ga0495625_0086248 Ga0495625_0086248_841_1863 339
627 3300046665 Ga0495661_0000907 Ga0495661_0000907_13992_15014 339
628 3300046691 Ga0495670_0000538 Ga0495670_0000538_5054_6076 339
629 3300046692 Ga0495671_0003578 Ga0495671_0003578_3203_4225 339
630 3300046694 Ga0495649_0010679 Ga0495649_0010679_1651_2670 339
631 3300046794 Ga0495589_0000056 Ga0495589_0000056_41924_42946 339
632 3300046810 Ga0495660_0000295 Ga0495660_0000295_9414_10436 339
633 3300046810 Ga0495660_0000304 Ga0495660_0000304_10745_11767 339
634 3300047323 Ga0495683_0000631 Ga0495683_0000631_20040_21059 339
635 3300047446 Ga0495679_000010 Ga0495679_000010_269519_270541 339
636 3300047469 Ga0495673_0000045 Ga0495673_0000045_261266_262285 339
637 3300047469 Ga0495673_0000240 Ga0495673_0000240_11790_12812 339
638 3300047469 Ga0495673_0000244 Ga0495673_0000244_67160_68182 339
639 3300047470 Ga0495681_0085306 Ga0495681_0085306_326_1348 339
640 3300047472 Ga0495686_0000227 Ga0495686_0000227_50265_51287 339
641 3300047472 Ga0495686_0000311 Ga0495686_0000311_43876_44895 339
642 3300047472 Ga0495686_0005940 Ga0495686_0005940_947_1966 339
643 3300047472 Ga0495686_0032109 Ga0495686_0032109_1535_2554 339
644 3300047472 Ga0495686_0043336 Ga0495686_0043336_1127_2149 339
645 3300048903 Ga0496100_0010529 Ga0496100_0010529_1185_2240 339
646 3300048904 Ga0496101_0010821 Ga0496101_0010821_2844_3899 339
647 3300048909 Ga0496106_0000285 Ga0496106_0000285_19279_20379 339
648 3300048919 Ga0496116_0029954 Ga0496116_0029954_1824_2846 339
649 3300048923 Ga0496120_0055927 Ga0496120_0055927_68_1087 339
650 3300048924 Ga0496121_0000403 Ga0496121_0000403_46147_47169 339
651 3300048924 Ga0496121_0000530 Ga0496121_0000530_21632_22651 339
652 3300048924 Ga0496121_0000756 Ga0496121_0000756_38148_39167 339
653 3300048925 Ga0496122_0069970 Ga0496122_0069970_1452_2471 339
654 3300048925 Ga0496122_0160417 Ga0496122_0160417_206_1240 339
655 3300048926 Ga0496123_0150552 Ga0496123_0150552_166_1185 339
656 3300048928 Ga0496125_0009298 Ga0496125_0009298_2530_3549 339
657 3300048929 Ga0496126_0076687 Ga0496126_0076687_703_1722 339
658 3300049459 Ga0495678_000211 Ga0495678_000211_12436_13458 339
659 3300049460 Ga0495682_0001027 Ga0495682_0001027_13949_14971 339
660 3300049460 Ga0495682_0004397 Ga0495682_0004397_3898_4920 339
661 3300050516 nmdc:mga0sz30_35979_c1 nmdc:mga0sz30_35979_c1_660_1682 339
662 3300053087 Ga0500643_000051 Ga0500643_000051_77395_78417 339
663 3300053103 Ga0500555_005370 Ga0500555_005370_1182_2204 339
664 3300053160 Ga0500633_0001750 Ga0500633_0001750_2812_3831 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01450

IlvC

Acetohydroxy acid isomeroreductase, catalytic domain

165

308

1

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

10

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ep7-assembly1.cif.gz_A-2 crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with nadp 0.981 3 320
8ep7-assembly2.cif.gz_B-3 crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with nadp 0.9805 3 323
7kh7-assembly1.cif.gz_A crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg2+, nadph, and nsc116565 0.978 3 319
7q03-assembly1.cif.gz_A ketol-acid reductoisomerase from methanothermococcus thermolithotrophicus in the close state with nadp and mg2+ 0.9774 3 323
6vo2-assembly1.cif.gz_A crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, nadph and inhibitor. 0.9741 3 323
ID Description Score Start End Superfamily
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9819 3 178 3.40.50.720
4xehA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9797 7 178 3.40.50.720
4xdyA02 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.9749 180 319 6.10.240.10
4xdyB02 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.9749 180 319 6.10.240.10
4kqwA02 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.9681 180 319 6.10.240.10
ID Description Score Start End GO Terms
AF-W1XVF2-F1-model_v4 Ketol-acid reductoisomerase 0.9975 104 192 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A3D1LYN9-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9972 107 188 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-T1AVJ5-F1-model_v4 Ketol-acid reductoisomerase 0.9953 4 192 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A3D4NM10-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9951 104 191 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
GO:0046872
AF-A0A6V8P8H2-F1-model_v4 Ketol-acid reductoisomerase 0.9927 99 192 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853

Feature Viewer

pLDDT pTM Quality
92.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map