F473536

General Info

Members Datasets Scaffolds Average Seq Length
663 244 1326 320

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100192337|Ga0070667_1001923372
Length 345
Sequence MTRSTWIAPVWALGVALGTVLASSATAQTVKVTPLGGIDGEFCPQDRALIFEDPNGTRVLYDPGRTVAGAADPRLGKIDIVLVSHMHGDHAGNVHNKEPNAGSCAQPDLSVSALPNSSAVNIALAKKSKIVTGSEMPAFFAAKLKANGGDPANSILARFGGSVTVGGVRIATVTAIHSNGLEPDYIGGDLGKAMKDAGIAGDVGPPTGYVLRFSNGLVAYLSGDTGITADQELVVRNHYAAKLVVMNMGDALTTGPTEAAYVINELVKPVSVIASHANEVGTVGGKVRAGSKTEAFIKATKVPVYVPLSGKTMEFDAAGMCTAGCLAPAAASLDQVVTPSVIRPG

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 2643221609 Acidovorax sp. Root217 Isolate Unclassified
236 2643221611 Acidovorax sp. Root219 Isolate Unclassified
237 2738543012 Acidovorax sp. CF301 Isolate Unclassified
238 2738543013 Variovorax sp. BT01 Isolate Unclassified
239 2816332133 Acidovorax radicis 2721A Isolate Unclassified
240 2842733646 Variovorax sp. R-72446 Isolate Unclassified
241 2855730933 Achromobacter sp. HZ28 Isolate Nodule
242 2855767633 Achromobacter sp. HZ34 Isolate Nodule
243 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
244 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0.45
Rhizoplane 2.26
Rhizosphere 92.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100192337 3300005367 Bacteria 1808
2 JGI25151J46595_10000754 3300003187 Bacteria 26355
3 rootL2_10225223 3300003322 Bacteria 1835
4 Ga0055525_1000172 3300003759 Bacteria 81789
5 Ga0055531_10000002 3300003794 Bacteria 421971
6 Ga0065707_10136394 3300005295 Bacteria 1835
7 Ga0070658_10006195 3300005327 Bacteria 9698
8 Ga0070658_10014956 3300005327 Bacteria 6213
9 Ga0070658_10058722 3300005327 Bacteria 3132
10 Ga0070658_10196258 3300005327 Bacteria 1702
11 Ga0070676_10002556 3300005328 Bacteria 9355
12 Ga0070676_10003461 3300005328 Bacteria 8228
13 Ga0070676_10010806 3300005328 Bacteria 4952
14 Ga0070676_10013776 3300005328 Bacteria 4433
15 Ga0070676_10039991 3300005328 Bacteria 2714
16 Ga0070676_10068674 3300005328 Bacteria 2122
17 Ga0070683_100012094 3300005329 Bacteria 7488
18 Ga0070683_100019405 3300005329 Bacteria 6038
19 Ga0070683_100183018 3300005329 Bacteria 1989
20 Ga0070683_100227878 3300005329 Bacteria 1771
21 Ga0070690_100023930 3300005330 Bacteria 3752
22 Ga0070690_100031232 3300005330 Bacteria 3317
23 Ga0070670_100000493 3300005331 Bacteria 31595
24 Ga0070670_100054665 3300005331 Bacteria 3428
25 Ga0070670_100085113 3300005331 Bacteria 2717
26 Ga0070670_100109749 3300005331 Bacteria 2377
27 Ga0070670_100122313 3300005331 Bacteria 2245
28 Ga0070677_10002809 3300005333 Bacteria 5576
29 Ga0068869_100010507 3300005334 Bacteria 6039
30 Ga0068869_100010636 3300005334 Bacteria 6007
31 Ga0068869_100083371 3300005334 Bacteria 2391
32 Ga0070666_10000383 3300005335 Bacteria 27824
33 Ga0070666_10003557 3300005335 Bacteria 9445
34 Ga0070666_10099621 3300005335 Bacteria 2001
35 Ga0070680_100015422 3300005336 Bacteria 5990
36 Ga0070680_100124645 3300005336 Bacteria 2152
37 Ga0068868_100002833 3300005338 Bacteria 12010
38 Ga0068868_100005199 3300005338 Bacteria 9136
39 Ga0068868_100058201 3300005338 Bacteria 3054
40 Ga0068868_100088389 3300005338 Bacteria 2494
41 Ga0068868_100088808 3300005338 Bacteria 2488
42 Ga0070689_100405713 3300005340 Bacteria 1153
43 Ga0070687_100003187 3300005343 Bacteria 6336
44 Ga0070687_100063162 3300005343 Bacteria 1963
45 Ga0070661_100201232 3300005344 Bacteria 1522
46 Ga0070661_100317563 3300005344 Bacteria 1216
47 Ga0070668_100001276 3300005347 Bacteria 17996
48 Ga0070668_100009101 3300005347 Bacteria 7375
49 Ga0070668_100027813 3300005347 Bacteria 4292
50 Ga0070668_100053919 3300005347 Bacteria 3101
51 Ga0070668_100059643 3300005347 Bacteria 2953
52 Ga0070669_100002313 3300005353 Bacteria 13790
53 Ga0070669_100004036 3300005353 Bacteria 10621
54 Ga0070669_100004393 3300005353 Bacteria 10176
55 Ga0070669_100045640 3300005353 Bacteria 3194
56 Ga0070675_100002082 3300005354 Bacteria 14809
57 Ga0070675_100005774 3300005354 Bacteria 9467
58 Ga0070675_100005813 3300005354 Bacteria 9445
59 Ga0070675_100007536 3300005354 Bacteria 8412
60 Ga0070675_100013976 3300005354 Bacteria 6320
61 Ga0070675_100014161 3300005354 Bacteria 6286
62 Ga0070675_100017553 3300005354 Bacteria 5688
63 Ga0070675_100026658 3300005354 Bacteria 4639
64 Ga0070675_100037731 3300005354 Bacteria 3938
65 Ga0070675_100067830 3300005354 Bacteria 2952
66 Ga0070675_100084687 3300005354 Bacteria 2648
67 Ga0070675_100086008 3300005354 Bacteria 2627
68 Ga0070671_100002227 3300005355 Bacteria 14969
69 Ga0070671_100004990 3300005355 Bacteria 10575
70 Ga0070671_100007780 3300005355 Bacteria 8562
71 Ga0070671_100014357 3300005355 Bacteria 6399
72 Ga0070671_100043467 3300005355 Bacteria 3733
73 Ga0070671_100046163 3300005355 Bacteria 3622
74 Ga0070671_100057569 3300005355 Bacteria 3234
75 Ga0070671_100318377 3300005355 Bacteria 1325
76 Ga0070671_100350935 3300005355 Bacteria 1259
77 Ga0070674_100001605 3300005356 Bacteria 12136
78 Ga0070674_100007593 3300005356 Bacteria 6403
79 Ga0070674_100088654 3300005356 Bacteria 2227
80 Ga0070674_100103347 3300005356 Bacteria 2080
81 Ga0070674_100202525 3300005356 Bacteria 1534
82 Ga0070673_100004085 3300005364 Bacteria 9186
83 Ga0070673_100008381 3300005364 Bacteria 6871
84 Ga0070673_100051796 3300005364 Bacteria 3218
85 Ga0070673_100101270 3300005364 Bacteria 2373
86 Ga0070673_100105289 3300005364 Bacteria 2330
87 Ga0070659_100015154 3300005366 Bacteria 5767
88 Ga0070659_100182261 3300005366 Bacteria 1724
89 Ga0070667_100005842 3300005367 Bacteria 10264
90 Ga0070667_100008041 3300005367 Bacteria 8748
91 Ga0070667_100010549 3300005367 Bacteria 7625
92 Ga0070714_100347251 3300005435 Bacteria 1393
93 Ga0070701_10167957 3300005438 Bacteria 1275
94 Ga0070700_100007731 3300005441 Bacteria 5821
95 Ga0070678_100001678 3300005456 Bacteria 11868
96 Ga0070678_100002666 3300005456 Bacteria 9833
97 Ga0070678_100038520 3300005456 Bacteria 3366
98 Ga0070678_100096008 3300005456 Bacteria 2286
99 Ga0070678_100416814 3300005456 Bacteria 1170
100 Ga0070662_100011397 3300005457 Bacteria 5867
101 Ga0070662_100031576 3300005457 Bacteria 3718
102 Ga0070662_100361113 3300005457 Bacteria 1192
103 Ga0068867_100002278 3300005459 Bacteria 13498
104 Ga0068867_100005532 3300005459 Bacteria 8944
105 Ga0068867_100006849 3300005459 Bacteria 8058
106 Ga0068867_100009094 3300005459 Bacteria 7010
107 Ga0068867_100033024 3300005459 Bacteria 3745
108 Ga0068867_100128355 3300005459 Bacteria 1967
109 Ga0068867_100300638 3300005459 Bacteria 1323
110 Ga0070685_10019423 3300005466 Bacteria 3665
111 Ga0070699_100045007 3300005518 Bacteria 3820
112 Ga0070699_100526224 3300005518 Bacteria 1075
113 Ga0070679_100010825 3300005530 Bacteria 8665
114 Ga0070679_100236737 3300005530 Bacteria 1784
115 Ga0070684_100055214 3300005535 Bacteria 3461
116 Ga0068853_100059553 3300005539 Bacteria 3299
117 Ga0068853_100392257 3300005539 Bacteria 1298
118 Ga0070672_100000362 3300005543 Bacteria 26134
119 Ga0070672_100005080 3300005543 Bacteria 8683
120 Ga0070672_100005345 3300005543 Bacteria 8503
121 Ga0070672_100018795 3300005543 Bacteria 5004
122 Ga0070672_100037366 3300005543 Bacteria 3704
123 Ga0070672_100062569 3300005543 Bacteria 2937
124 Ga0070672_100115791 3300005543 Bacteria 2189
125 Ga0070672_100142566 3300005543 Bacteria 1978
126 Ga0070686_100031917 3300005544 Bacteria 3226
127 Ga0070686_100421875 3300005544 Bacteria 1019
128 Ga0070693_100086762 3300005547 Bacteria 1878
129 Ga0070665_100007950 3300005548 Bacteria 10751
130 Ga0070665_100027920 3300005548 Bacteria 5683
131 Ga0070665_100477243 3300005548 Bacteria 1258
132 Ga0068855_100026304 3300005563 Bacteria 6961
133 Ga0068855_100035899 3300005563 Bacteria 5903
134 Ga0068855_100164169 3300005563 Bacteria 2519
135 Ga0070664_100011431 3300005564 Bacteria 7203
136 Ga0070664_100025779 3300005564 Bacteria 4874
137 Ga0070664_100209698 3300005564 Bacteria 1741
138 Ga0068857_100045234 3300005577 Bacteria 3904
139 Ga0068857_100138896 3300005577 Bacteria 2195
140 Ga0068854_100096156 3300005578 Bacteria 2212
141 Ga0068856_100051388 3300005614 Bacteria 4064
142 Ga0068856_100067182 3300005614 Bacteria 3543
143 Ga0068856_100145177 3300005614 Bacteria 2380
144 Ga0068856_100160619 3300005614 Bacteria 2257
145 Ga0068852_100009536 3300005616 Bacteria 7214
146 Ga0068852_100010642 3300005616 Bacteria 6884
147 Ga0068852_100027812 3300005616 Bacteria 4616
148 Ga0068852_100050657 3300005616 Bacteria 3559
149 Ga0068852_100066624 3300005616 Bacteria 3145
150 Ga0068852_100134628 3300005616 Bacteria 2280
151 Ga0068852_100162593 3300005616 Bacteria 2086
152 Ga0068852_100265930 3300005616 Bacteria 1648
153 Ga0068852_100447265 3300005616 Bacteria 1278
154 Ga0068852_100466025 3300005616 Bacteria 1253
155 Ga0068859_100036665 3300005617 Bacteria 4922
156 Ga0068859_100157806 3300005617 Bacteria 2347
157 Ga0068859_100181956 3300005617 Bacteria 2185
158 Ga0068859_100242939 3300005617 Bacteria 1890
159 Ga0068859_100290503 3300005617 Bacteria 1728
160 Ga0068864_100005033 3300005618 Bacteria 10824
161 Ga0068864_100005144 3300005618 Bacteria 10714
162 Ga0068864_100021034 3300005618 Bacteria 5463
163 Ga0068864_100029242 3300005618 Bacteria 4664
164 Ga0068864_100079880 3300005618 Bacteria 2865
165 Ga0068864_100096205 3300005618 Bacteria 2620
166 Ga0068864_100129948 3300005618 Bacteria 2261
167 Ga0068864_100144118 3300005618 Bacteria 2151
168 Ga0068864_100153829 3300005618 Bacteria 2086
169 Ga0068864_100205316 3300005618 Bacteria 1812
170 Ga0068866_10002302 3300005718 Bacteria 7911
171 Ga0068866_10053849 3300005718 Bacteria 2059
172 Ga0068861_100042073 3300005719 Bacteria 3424
173 Ga0068861_100239257 3300005719 Bacteria 1543
174 Ga0068851_10004232 3300005834 Bacteria 6460
175 Ga0068851_10008387 3300005834 Bacteria 4777
176 Ga0068863_100006445 3300005841 Bacteria 11512
177 Ga0068863_100014308 3300005841 Bacteria 7643
178 Ga0068863_100021677 3300005841 Bacteria 6128
179 Ga0068863_100025104 3300005841 Bacteria 5684
180 Ga0068863_100038439 3300005841 Bacteria 4552
181 Ga0068863_100097802 3300005841 Bacteria 2787
182 Ga0068863_100264509 3300005841 Bacteria 1663
183 Ga0068858_100004984 3300005842 Bacteria 13009
184 Ga0068858_100005660 3300005842 Bacteria 12216
185 Ga0068858_100008645 3300005842 Bacteria 9778
186 Ga0068858_100011859 3300005842 Bacteria 8215
187 Ga0068858_100063509 3300005842 Bacteria 3417
188 Ga0068858_100145735 3300005842 Bacteria 2224
189 Ga0068858_100271215 3300005842 Bacteria 1615
190 Ga0068860_100001042 3300005843 Bacteria 30514
191 Ga0068860_100006915 3300005843 Bacteria 11369
192 Ga0068860_100016513 3300005843 Bacteria 7200
193 Ga0068860_100038264 3300005843 Bacteria 4589
194 Ga0068860_100092389 3300005843 Bacteria 2883
195 Ga0068860_100131556 3300005843 Bacteria 2401
196 Ga0068860_100132703 3300005843 Bacteria 2391
197 Ga0068862_100009567 3300005844 Bacteria 8015
198 Ga0068862_100035847 3300005844 Bacteria 4203
199 Ga0068862_100088278 3300005844 Bacteria 2698
200 Ga0068862_100131634 3300005844 Bacteria 2213
201 Ga0068862_100231646 3300005844 Bacteria 1676
202 Ga0068862_100311633 3300005844 Bacteria 1450
203 Ga0075365_10082141 3300006038 Bacteria 2184
204 Ga0075366_10083710 3300006195 Bacteria 1907
205 Ga0075366_10258443 3300006195 Bacteria 1063
206 Ga0097621_100004405 3300006237 Bacteria 9798
207 Ga0097621_100006878 3300006237 Bacteria 8090
208 Ga0097621_100023190 3300006237 Bacteria 4828
209 Ga0097621_100025132 3300006237 Bacteria 4658
210 Ga0097621_100033837 3300006237 Bacteria 4073
211 Ga0097621_100042318 3300006237 Bacteria 3669
212 Ga0068871_100008300 3300006358 Bacteria 7465
213 Ga0068871_100050514 3300006358 Bacteria 3364
214 Ga0068871_100141833 3300006358 Bacteria 2044
215 Ga0068871_100242042 3300006358 Bacteria 1569
216 Ga0075429_100002294 3300006880 Bacteria 16052
217 Ga0068865_100005451 3300006881 Bacteria 7720
218 Ga0068865_100021570 3300006881 Bacteria 4191
219 Ga0068865_100064097 3300006881 Bacteria 2585
220 Ga0068865_100142105 3300006881 Bacteria 1811
221 Ga0097620_100036665 3300006931 Bacteria 4922
222 Ga0097620_100157803 3300006931 Bacteria 2347
223 Ga0097620_100181966 3300006931 Bacteria 2185
224 Ga0097620_100242958 3300006931 Bacteria 1890
225 Ga0097620_100290506 3300006931 Bacteria 1728
226 Ga0105240_10005068 3300009093 Bacteria 19747
227 Ga0105240_10029445 3300009093 Bacteria 7153
228 Ga0105240_10033517 3300009093 Bacteria 6634
229 Ga0105240_10219036 3300009093 Bacteria 2219
230 Ga0105240_10581432 3300009093 Bacteria 1235
231 Ga0111539_10419277 3300009094 Bacteria 1559
232 Ga0105245_10043120 3300009098 Bacteria 4025
233 Ga0105245_10098378 3300009098 Bacteria 2703
234 Ga0105245_10376809 3300009098 Bacteria 1412
235 Ga0105243_10004458 3300009148 Bacteria 11067
236 Ga0105243_10051567 3300009148 Bacteria 3255
237 Ga0105243_10454456 3300009148 Bacteria 1203
238 Ga0105242_10003366 3300009176 Bacteria 12448
239 Ga0105242_10055908 3300009176 Bacteria 3229
240 Ga0105242_10093705 3300009176 Bacteria 2532
241 Ga0105242_10133409 3300009176 Bacteria 2147
242 Ga0105242_10160427 3300009176 Bacteria 1968
243 Ga0105248_10002431 3300009177 Bacteria 20666
244 Ga0105248_10002726 3300009177 Bacteria 19624
245 Ga0105248_10015932 3300009177 Bacteria 8278
246 Ga0105248_10035490 3300009177 Bacteria 5577
247 Ga0105248_10042168 3300009177 Bacteria 5118
248 Ga0105248_10044753 3300009177 Bacteria 4964
249 Ga0105248_10045959 3300009177 Bacteria 4895
250 Ga0105248_10046386 3300009177 Bacteria 4870
251 Ga0105248_10084741 3300009177 Bacteria 3565
252 Ga0105248_10112068 3300009177 Bacteria 3077
253 Ga0105248_10131990 3300009177 Bacteria 2818
254 Ga0105248_10444312 3300009177 Bacteria 1461
255 Ga0105237_10138331 3300009545 Bacteria 2430
256 Ga0105237_10142040 3300009545 Bacteria 2395
257 Ga0105238_10022233 3300009551 Bacteria 6465
258 Ga0105238_10026901 3300009551 Bacteria 5863
259 Ga0105238_10067527 3300009551 Bacteria 3577
260 Ga0105238_10162702 3300009551 Bacteria 2207
261 Ga0105249_10001991 3300009553 Bacteria 17741
262 Ga0105249_10103755 3300009553 Bacteria 2679
263 Ga0105239_10025716 3300010375 Bacteria 6483
264 Ga0157373_10013320 3300013100 Bacteria 6036
265 Ga0157371_10020484 3300013102 Bacteria 4867
266 Ga0157369_10016713 3300013105 Bacteria 8247
267 Ga0157369_10130332 3300013105 Bacteria 2665
268 Ga0157374_10007182 3300013296 Bacteria 9487
269 Ga0157374_10022816 3300013296 Bacteria 5589
270 Ga0157374_10075199 3300013296 Bacteria 3192
271 Ga0157374_10161805 3300013296 Bacteria 2180
272 Ga0157378_10025923 3300013297 Bacteria 5166
273 Ga0163162_10001893 3300013306 Bacteria 19713
274 Ga0163162_10005282 3300013306 Bacteria 12464
275 Ga0163162_10010523 3300013306 Bacteria 8996
276 Ga0163162_10090488 3300013306 Bacteria 3141
277 Ga0163162_10259302 3300013306 Bacteria 1870
278 Ga0163162_10354476 3300013306 Bacteria 1600
279 Ga0157372_10007345 3300013307 Bacteria 11724
280 Ga0157372_10065806 3300013307 Bacteria 4071
281 Ga0157375_10006696 3300013308 Bacteria 10035
282 Ga0157375_10016875 3300013308 Bacteria 6574
283 Ga0157375_10019019 3300013308 Bacteria 6236
284 Ga0157375_10038905 3300013308 Bacteria 4571
285 Ga0157375_10086187 3300013308 Bacteria 3191
286 Ga0157375_10173242 3300013308 Bacteria 2306
287 Ga0163163_10083656 3300014325 Bacteria 3196
288 Ga0163163_10349646 3300014325 Bacteria 1534
289 Ga0157380_10035828 3300014326 Bacteria 3835
290 Ga0157379_10000632 3300014968 Bacteria 28339
291 Ga0157379_10001435 3300014968 Bacteria 19567
292 Ga0157379_10007829 3300014968 Bacteria 9253
293 Ga0157379_10008418 3300014968 Bacteria 8966
294 Ga0157379_10013996 3300014968 Bacteria 7031
295 Ga0157379_10105151 3300014968 Bacteria 2533
296 Ga0157379_10257236 3300014968 Bacteria 1586
297 Ga0157376_10005040 3300014969 Bacteria 9210
298 Ga0157376_10010909 3300014969 Bacteria 6673
299 Ga0163161_10007699 3300017792 Bacteria 7450
300 Ga0163161_10044323 3300017792 Bacteria 3204
301 Ga0163161_10066151 3300017792 Bacteria 2639
302 Ga0163161_10101066 3300017792 Bacteria 2147
303 Ga0163161_10108850 3300017792 Bacteria 2070
304 Ga0213872_10001334 3300021361 Bacteria 16286
305 Ga0213876_10063430 3300021384 Bacteria 1951
306 Ga0209563_100044 3300025230 Bacteria 396812
307 Ga0209675_1004177 3300025291 Bacteria 6537
308 Ga0209025_1000040 3300025294 Bacteria 376228
309 Ga0209025_1037943 3300025294 Bacteria 2128
310 Ga0209050_1001200 3300025298 Bacteria 30440
311 Ga0209051_1010077 3300025303 Bacteria 4809
312 Ga0209257_1000049 3300025304 Bacteria 441224
313 Ga0207697_10020895 3300025315 Bacteria 2680
314 Ga0207697_10023434 3300025315 Bacteria 2528
315 Ga0207656_10004680 3300025321 Bacteria 4794
316 Ga0207656_10009388 3300025321 Bacteria 3633
317 Ga0207656_10015846 3300025321 Bacteria 2924
318 Ga0207656_10021238 3300025321 Bacteria 2592
319 Ga0207682_10001005 3300025893 Bacteria 13068
320 Ga0207682_10002098 3300025893 Bacteria 9032
321 Ga0207682_10005051 3300025893 Bacteria 5411
322 Ga0207682_10022241 3300025893 Bacteria 2497
323 Ga0207642_10003623 3300025899 Bacteria 4901
324 Ga0207688_10016160 3300025901 Bacteria 4046
325 Ga0207688_10083831 3300025901 Bacteria 1824
326 Ga0207680_10002448 3300025903 Bacteria 8658
327 Ga0207680_10151345 3300025903 Bacteria 1547
328 Ga0207680_10182294 3300025903 Bacteria 1421
329 Ga0207645_10000390 3300025907 Bacteria 36191
330 Ga0207645_10003275 3300025907 Bacteria 12356
331 Ga0207645_10030818 3300025907 Bacteria 3456
332 Ga0207645_10120985 3300025907 Bacteria 1699
333 Ga0207643_10062337 3300025908 Bacteria 2131
334 Ga0207705_10012330 3300025909 Bacteria 6175
335 Ga0207705_10017050 3300025909 Bacteria 5202
336 Ga0207705_10040425 3300025909 Bacteria 3345
337 Ga0207695_10042647 3300025913 Bacteria 4842
338 Ga0207695_10105096 3300025913 Bacteria 2811
339 Ga0207695_10105395 3300025913 Bacteria 2807
340 Ga0207671_10271423 3300025914 Bacteria 1336
341 Ga0207671_10308801 3300025914 Bacteria 1250
342 Ga0207660_10021106 3300025917 Bacteria 4377
343 Ga0207660_10072617 3300025917 Bacteria 2506
344 Ga0207660_10164401 3300025917 Bacteria 1714
345 Ga0207662_10036122 3300025918 Bacteria 2887
346 Ga0207662_10058612 3300025918 Bacteria 2305
347 Ga0207657_10097215 3300025919 Bacteria 2448
348 Ga0207657_10102826 3300025919 Bacteria 2369
349 Ga0207657_10297708 3300025919 Bacteria 1278
350 Ga0207649_10007382 3300025920 Bacteria 5981
351 Ga0207652_10016058 3300025921 Bacteria 6105
352 Ga0207652_10016721 3300025921 Bacteria 5994
353 Ga0207681_10000675 3300025923 Bacteria 22417
354 Ga0207681_10003053 3300025923 Bacteria 10524
355 Ga0207681_10011715 3300025923 Bacteria 5391
356 Ga0207681_10045699 3300025923 Bacteria 2942
357 Ga0207681_10048696 3300025923 Bacteria 2862
358 Ga0207681_10073626 3300025923 Bacteria 2390
359 Ga0207694_10064266 3300025924 Bacteria 2860
360 Ga0207694_10068841 3300025924 Bacteria 2764
361 Ga0207694_10218805 3300025924 Bacteria 1553
362 Ga0207650_10000548 3300025925 Bacteria 30528
363 Ga0207650_10009480 3300025925 Bacteria 6651
364 Ga0207650_10052809 3300025925 Bacteria 3011
365 Ga0207650_10071134 3300025925 Bacteria 2616
366 Ga0207650_10084748 3300025925 Bacteria 2410
367 Ga0207650_10110957 3300025925 Bacteria 2123
368 Ga0207650_10128616 3300025925 Bacteria 1980
369 Ga0207650_10141031 3300025925 Bacteria 1895
370 Ga0207659_10003731 3300025926 Bacteria 9184
371 Ga0207659_10005425 3300025926 Bacteria 7726
372 Ga0207659_10005549 3300025926 Bacteria 7655
373 Ga0207659_10006585 3300025926 Bacteria 7131
374 Ga0207659_10019174 3300025926 Bacteria 4496
375 Ga0207659_10019777 3300025926 Bacteria 4438
376 Ga0207659_10028539 3300025926 Bacteria 3793
377 Ga0207659_10045135 3300025926 Bacteria 3105
378 Ga0207659_10073847 3300025926 Bacteria 2498
379 Ga0207659_10082015 3300025926 Bacteria 2386
380 Ga0207659_10124418 3300025926 Bacteria 1981
381 Ga0207644_10002501 3300025931 Bacteria 11832
382 Ga0207644_10004015 3300025931 Bacteria 9556
383 Ga0207644_10004735 3300025931 Bacteria 8841
384 Ga0207644_10022717 3300025931 Bacteria 4287
385 Ga0207644_10038136 3300025931 Bacteria 3383
386 Ga0207644_10049383 3300025931 Bacteria 3012
387 Ga0207644_10209441 3300025931 Bacteria 1541
388 Ga0207644_10243345 3300025931 Bacteria 1433
389 Ga0207690_10014595 3300025932 Bacteria 4745
390 Ga0207706_10003084 3300025933 Bacteria 16013
391 Ga0207706_10021208 3300025933 Bacteria 5837
392 Ga0207706_10053029 3300025933 Bacteria 3580
393 Ga0207706_10246749 3300025933 Bacteria 1560
394 Ga0207706_10335194 3300025933 Bacteria 1316
395 Ga0207686_10018455 3300025934 Bacteria 3950
396 Ga0207686_10036777 3300025934 Bacteria 2950
397 Ga0207686_10251766 3300025934 Bacteria 1291
398 Ga0207686_10387386 3300025934 Bacteria 1062
399 Ga0207709_10010315 3300025935 Bacteria 5146
400 Ga0207670_10004097 3300025936 Bacteria 7805
401 Ga0207669_10000537 3300025937 Bacteria 16544
402 Ga0207669_10040385 3300025937 Bacteria 2706
403 Ga0207669_10096966 3300025937 Bacteria 1937
404 Ga0207669_10174345 3300025937 Bacteria 1534
405 Ga0207669_10299562 3300025937 Bacteria 1221
406 Ga0207704_10002824 3300025938 Bacteria 7835
407 Ga0207704_10032404 3300025938 Bacteria 2957
408 Ga0207704_10040583 3300025938 Bacteria 2722
409 Ga0207704_10090825 3300025938 Bacteria 2005
410 Ga0207704_10102211 3300025938 Bacteria 1914
411 Ga0207704_10107279 3300025938 Bacteria 1878
412 Ga0207665_10117777 3300025939 Bacteria 1873
413 Ga0207691_10000390 3300025940 Bacteria 43939
414 Ga0207691_10000629 3300025940 Bacteria 34886
415 Ga0207691_10003901 3300025940 Bacteria 14484
416 Ga0207691_10005390 3300025940 Bacteria 12350
417 Ga0207691_10027723 3300025940 Bacteria 5309
418 Ga0207691_10031684 3300025940 Bacteria 4933
419 Ga0207691_10044950 3300025940 Bacteria 4063
420 Ga0207691_10047703 3300025940 Bacteria 3930
421 Ga0207691_10079355 3300025940 Bacteria 2954
422 Ga0207711_10004634 3300025941 Bacteria 11685
423 Ga0207711_10005818 3300025941 Bacteria 10417
424 Ga0207711_10006916 3300025941 Bacteria 9527
425 Ga0207711_10010776 3300025941 Bacteria 7600
426 Ga0207711_10023802 3300025941 Bacteria 5127
427 Ga0207711_10026506 3300025941 Bacteria 4864
428 Ga0207711_10052128 3300025941 Bacteria 3506
429 Ga0207711_10060767 3300025941 Bacteria 3257
430 Ga0207711_10069378 3300025941 Bacteria 3055
431 Ga0207711_10254847 3300025941 Bacteria 1612
432 Ga0207689_10001729 3300025942 Bacteria 20638
433 Ga0207689_10004319 3300025942 Bacteria 12943
434 Ga0207689_10006256 3300025942 Bacteria 10551
435 Ga0207689_10006485 3300025942 Bacteria 10340
436 Ga0207661_10028188 3300025944 Bacteria 4298
437 Ga0207661_10054524 3300025944 Bacteria 3203
438 Ga0207679_10025627 3300025945 Bacteria 4058
439 Ga0207679_10072701 3300025945 Bacteria 2599
440 Ga0207667_10102772 3300025949 Bacteria 2948
441 Ga0207667_10433310 3300025949 Bacteria 1337
442 Ga0207651_10000650 3300025960 Bacteria 14754
443 Ga0207651_10014132 3300025960 Bacteria 4599
444 Ga0207651_10033267 3300025960 Bacteria 3323
445 Ga0207651_10036296 3300025960 Bacteria 3216
446 Ga0207651_10037958 3300025960 Bacteria 3160
447 Ga0207651_10092459 3300025960 Bacteria 2218
448 Ga0207651_10170828 3300025960 Bacteria 1714
449 Ga0207651_10178176 3300025960 Bacteria 1683
450 Ga0207651_10206297 3300025960 Bacteria 1579
451 Ga0207712_10014950 3300025961 Bacteria 5000
452 Ga0207668_10002995 3300025972 Bacteria 9900
453 Ga0207668_10017323 3300025972 Bacteria 4512
454 Ga0207668_10055988 3300025972 Bacteria 2744
455 Ga0207668_10076394 3300025972 Bacteria 2411
456 Ga0207668_10095823 3300025972 Bacteria 2191
457 Ga0207668_10143501 3300025972 Bacteria 1839
458 Ga0207640_10045551 3300025981 Bacteria 2817
459 Ga0207640_10216325 3300025981 Bacteria 1464
460 Ga0207658_10004261 3300025986 Bacteria 9965
461 Ga0207658_10004266 3300025986 Bacteria 9958
462 Ga0207658_10006548 3300025986 Bacteria 7944
463 Ga0207677_10003065 3300026023 Bacteria 8829
464 Ga0207677_10004606 3300026023 Bacteria 7415
465 Ga0207677_10005295 3300026023 Bacteria 6996
466 Ga0207677_10041841 3300026023 Bacteria 3033
467 Ga0207677_10047843 3300026023 Bacteria 2875
468 Ga0207677_10327295 3300026023 Bacteria 1276
469 Ga0207677_10361753 3300026023 Bacteria 1219
470 Ga0207703_10004561 3300026035 Bacteria 11359
471 Ga0207703_10006227 3300026035 Bacteria 9550
472 Ga0207703_10007497 3300026035 Bacteria 8662
473 Ga0207703_10012235 3300026035 Bacteria 6691
474 Ga0207703_10022098 3300026035 Bacteria 4985
475 Ga0207703_10076779 3300026035 Bacteria 2771
476 Ga0207639_10015678 3300026041 Bacteria 5348
477 Ga0207639_10142289 3300026041 Bacteria 2000
478 Ga0207639_10159153 3300026041 Bacteria 1901
479 Ga0207639_10262978 3300026041 Bacteria 1510
480 Ga0207639_10398040 3300026041 Bacteria 1240
481 Ga0207678_10001027 3300026067 Bacteria 25460
482 Ga0207678_10423928 3300026067 Bacteria 1154
483 Ga0207708_10079831 3300026075 Bacteria 2514
484 Ga0207702_10018519 3300026078 Bacteria 5761
485 Ga0207702_10028710 3300026078 Bacteria 4625
486 Ga0207702_10072413 3300026078 Bacteria 2970
487 Ga0207702_10078492 3300026078 Bacteria 2858
488 Ga0207702_10169755 3300026078 Bacteria 1999
489 Ga0207641_10004255 3300026088 Bacteria 12464
490 Ga0207641_10004293 3300026088 Bacteria 12387
491 Ga0207641_10009041 3300026088 Bacteria 8231
492 Ga0207641_10011162 3300026088 Bacteria 7368
493 Ga0207641_10059682 3300026088 Bacteria 3249
494 Ga0207641_10407627 3300026088 Bacteria 1306
495 Ga0207648_10000364 3300026089 Bacteria 49697
496 Ga0207648_10001878 3300026089 Bacteria 22968
497 Ga0207648_10005035 3300026089 Bacteria 13408
498 Ga0207648_10012904 3300026089 Bacteria 7803
499 Ga0207648_10068346 3300026089 Bacteria 3095
500 Ga0207648_10130846 3300026089 Bacteria 2209
501 Ga0207648_10156590 3300026089 Bacteria 2011
502 Ga0207648_10274056 3300026089 Bacteria 1508
503 Ga0207676_10006858 3300026095 Bacteria 8067
504 Ga0207676_10007475 3300026095 Bacteria 7753
505 Ga0207676_10019043 3300026095 Bacteria 5001
506 Ga0207676_10040307 3300026095 Bacteria 3579
507 Ga0207676_10097064 3300026095 Bacteria 2434
508 Ga0207676_10118832 3300026095 Bacteria 2225
509 Ga0207676_10263972 3300026095 Bacteria 1556
510 Ga0207674_10035971 3300026116 Bacteria 5165
511 Ga0207674_10059448 3300026116 Bacteria 3867
512 Ga0207675_100000267 3300026118 Bacteria 49570
513 Ga0207675_100000401 3300026118 Bacteria 41583
514 Ga0207675_100023619 3300026118 Bacteria 5720
515 Ga0207675_100066420 3300026118 Bacteria 3371
516 Ga0207683_10000076 3300026121 Bacteria 77762
517 Ga0207683_10003684 3300026121 Bacteria 13315
518 Ga0207683_10004593 3300026121 Bacteria 11896
519 Ga0207683_10021450 3300026121 Bacteria 5530
520 Ga0207683_10025117 3300026121 Bacteria 5137
521 Ga0207683_10033869 3300026121 Bacteria 4438
522 Ga0207698_10022294 3300026142 Bacteria 4397
523 Ga0207698_10061997 3300026142 Bacteria 2917
524 Ga0207698_10081812 3300026142 Bacteria 2608
525 Ga0207698_10139195 3300026142 Bacteria 2088
526 Ga0207698_10257412 3300026142 Bacteria 1601
527 Ga0207698_10279881 3300026142 Bacteria 1542
528 Ga0268266_10069518 3300028379 Bacteria 3051
529 Ga0268266_10081063 3300028379 Bacteria 2828
530 Ga0268266_10084083 3300028379 Bacteria 2778
531 Ga0268266_10149807 3300028379 Bacteria 2102
532 Ga0268266_10178861 3300028379 Bacteria 1930
533 Ga0268266_10479387 3300028379 Bacteria 1186
534 Ga0268265_10055867 3300028380 Bacteria 3001
535 Ga0268265_10068194 3300028380 Bacteria 2757
536 Ga0268265_10248398 3300028380 Bacteria 1574
537 Ga0268264_10007375 3300028381 Bacteria 9186
538 Ga0268264_10071101 3300028381 Bacteria 2947
539 Ga0268264_10085206 3300028381 Bacteria 2712
540 Ga0268264_10157221 3300028381 Bacteria 2044
541 Ga0307515_10064322 3300028794 Bacteria 5130
542 Ga0265332_10001641 3300031238 Bacteria 12225
543 Ga0265328_10002184 3300031239 Bacteria 8824
544 Ga0265331_10009053 3300031250 Bacteria 5624
545 Ga0265327_10000028 3300031251 Bacteria 361066
546 Ga0265327_10000773 3300031251 Bacteria 49324
547 Ga0307513_10116415 3300031456 Bacteria 2652
548 Ga0307408_100398011 3300031548 Bacteria 1182
549 Ga0265314_10003637 3300031711 Bacteria 14832
550 Ga0316576_10074870 3300031727 Bacteria 2504
551 Ga0307516_10256923 3300031730 Bacteria 1439
552 Ga0307405_10001548 3300031731 Bacteria 9747
553 Ga0307405_10016397 3300031731 Bacteria 4040
554 Ga0307413_10017224 3300031824 Bacteria 3758
555 Ga0307410_10012873 3300031852 Bacteria 4857
556 Ga0307410_10273934 3300031852 Bacteria 1321
557 Ga0307406_10031577 3300031901 Bacteria 3226
558 Ga0307407_10059462 3300031903 Bacteria 2226
559 Ga0307409_100020401 3300031995 Bacteria 4515
560 Ga0307409_100031414 3300031995 Bacteria 3832
561 Ga0307409_100171661 3300031995 Bacteria 1909
562 Ga0307409_100327194 3300031995 Bacteria 1437
563 Ga0307416_100027794 3300032002 Bacteria 4196
564 Ga0307416_100033175 3300032002 Bacteria 3911
565 Ga0307416_100104866 3300032002 Bacteria 2473
566 Ga0307416_100625829 3300032002 Bacteria 1159
567 Ga0307414_10179900 3300032004 Bacteria 1700
568 Ga0307411_10039101 3300032005 Bacteria 2998
569 Ga0307411_10152116 3300032005 Bacteria 1721
570 Ga0307415_100031923 3300032126 Bacteria 3400
571 Ga0373926_0050923 3300035083 Bacteria 1493
572 Ga0373931_0015217 3300035691 Bacteria 3771
573 Ga0373937_0015680 3300036401 Bacteria 6709
574 Ga0373937_0207946 3300036401 Bacteria 1841
575 Ga0373925_0007713 3300037068 Bacteria 7842
576 Ga0373925_0134109 3300037068 Bacteria 1933
577 Ga0395899_0053075 3300037312 Bacteria 3003
578 Ga0395900_0156319 3300037418 Bacteria 2329
579 Ga0395905_0034212 3300037471 Bacteria 4771
580 Ga0395905_0185368 3300037471 Bacteria 1953
581 Ga0395905_0396216 3300037471 Bacteria 1275
582 Ga0395901_0088458 3300038443 Bacteria 3240
583 Ga0436365_1713127 3300039437 Bacteria 3378
584 Ga0436361_0368333 3300039447 Bacteria 17778
585 Ga0436361_0457870 3300039447 Bacteria 1089
586 Ga0436361_0698438 3300039447 Bacteria 3640
587 Ga0439464_0033602 3300042439 Bacteria 1444
588 Ga0451577_0030534 3300042876 Bacteria 4869
589 Ga0466966_0031348 3300044684 Bacteria 3448
590 Ga0466966_0192346 3300044684 Bacteria 1236
591 Ga0466961_0013874 3300044693 Bacteria 5163
592 Ga0466961_0199094 3300044693 Bacteria 1239
593 Ga0466970_0059165 3300044765 Bacteria 2052
594 Ga0466957_0085662 3300044842 Bacteria 1968
595 Ga0466959_0008418 3300045049 Bacteria 7292
596 Ga0451576_0000386 3300045051 Bacteria 102813
597 Ga0466958_0013949 3300045836 Bacteria 4582
598 Ga0495629_0163269 3300046459 Bacteria 1547
599 Ga0495580_0028882 3300046472 Bacteria 4029
600 Ga0495628_0085567 3300046516 Bacteria 2446
601 Ga0495643_0008229 3300046522 Bacteria 6626
602 Ga0495642_0004925 3300046528 Bacteria 5149
603 Ga0495652_0063161 3300046529 Bacteria 3119
604 Ga0495621_0046053 3300046539 Bacteria 1546
605 Ga0495621_0068231 3300046539 Bacteria 1304
606 Ga0495645_0029044 3300046543 Bacteria 4019
607 Ga0495645_0191251 3300046543 Bacteria 1394
608 Ga0495667_0095822 3300046559 Bacteria 1921
609 Ga0495635_0219798 3300046663 Bacteria 1285
610 Ga0495635_0249291 3300046663 Bacteria 1197
611 Ga0495661_0001706 3300046665 Bacteria 17794
612 Ga0495599_0001643 3300046678 Bacteria 12895
613 Ga0495623_0076833 3300046679 Bacteria 2072
614 Ga0495646_0112037 3300046680 Bacteria 1553
615 Ga0495647_0063151 3300046681 Bacteria 1466
616 Ga0495658_0122533 3300046683 Bacteria 1574
617 Ga0495636_0093266 3300047318 Bacteria 1309
618 Ga0495686_0198256 3300047472 Bacteria 1153
619 Ga0495615_0011627 3300048090 Bacteria 1795
620 Ga0496102_0009476 3300048905 Bacteria 8371
621 Ga0496104_0041094 3300048907 Bacteria 4335
622 Ga0496104_0145151 3300048907 Bacteria 2279
623 Ga0496104_0284154 3300048907 Bacteria 1567
624 Ga0496105_0048217 3300048908 Bacteria 3516
625 Ga0496106_0008514 3300048909 Bacteria 7586
626 Ga0496107_0007111 3300048910 Bacteria 7710
627 Ga0496109_0198695 3300048912 Bacteria 1885
628 Ga0496110_0240919 3300048913 Bacteria 1646
629 Ga0496110_0262817 3300048913 Bacteria 1571
630 Ga0496112_0232428 3300048915 Bacteria 1798
631 Ga0496113_0051136 3300048916 Bacteria 3083
632 Ga0496113_0069430 3300048916 Bacteria 2676
633 Ga0496114_0073574 3300048917 Bacteria 2876
634 Ga0496114_0082336 3300048917 Bacteria 2720
635 Ga0496116_0007313 3300048919 Bacteria 9832
636 Ga0496121_0013498 3300048924 Bacteria 8768
637 Ga0496121_0029079 3300048924 Bacteria 5123
638 Ga0496121_0065589 3300048924 Bacteria 2953
639 Ga0496122_0000272 3300048925 Bacteria 115666
640 Ga0496123_0000221 3300048926 Bacteria 115688
641 Ga0496124_0033936 3300048927 Bacteria 4485
642 Ga0501033_0016170 3300049570 Bacteria 5650
643 Ga0501034_0035860 3300049571 Bacteria 5029
644 Ga0501047_0042160 3300049581 Bacteria 4411
645 Ga0501035_0007355 3300049822 Bacteria 10291
646 Ga0501044_0002878 3300049823 Bacteria 19586
647 nmdc:mga0k408_1129_c1 3300050493 Bacteria 14642
648 nmdc:mga09592_3054_c1 3300050508 Bacteria 13578
649 nmdc:mga0qj67_2967_c1 3300050509 Bacteria 12168
650 Ga0495595_0042977 3300053084 Bacteria 2072
651 Ga0495619_0083554 3300053085 Bacteria 2154
652 Ga0495619_0084722 3300053085 Bacteria 2140
653 Ga0500559_0001066 3300053136 Bacteria 16626
654 2644060590 2643221609 Bacteria 6756331
655 2644073911 2643221611 Bacteria 6820941
656 2739242613 2738543012 Bacteria 7115078
657 2739249404 2738543013 Bacteria 5618633
658 2816473066 2816332133 Bacteria 7249298
659 2842738012 2842733646 Bacteria 5716726
660 2855736629 2855730933 Bacteria 7047938
661 2855773566 2855767633 Bacteria 7049357
662 2876770069 2876761206 Bacteria 10111113
663 2881417928 2881412998 Bacteria 6492157
664 Ga0070667_100192337
665 JGI25151J46595_10000754
666 rootL2_10225223
667 Ga0055525_1000172
668 Ga0055531_10000002
669 Ga0065707_10136394
670 Ga0070658_10006195
671 Ga0070658_10014956
672 Ga0070658_10058722
673 Ga0070658_10196258
674 Ga0070676_10002556
675 Ga0070676_10003461
676 Ga0070676_10010806
677 Ga0070676_10013776
678 Ga0070676_10039991
679 Ga0070676_10068674
680 Ga0070683_100012094
681 Ga0070683_100019405
682 Ga0070683_100183018
683 Ga0070683_100227878
684 Ga0070690_100023930
685 Ga0070690_100031232
686 Ga0070670_100000493
687 Ga0070670_100054665
688 Ga0070670_100085113
689 Ga0070670_100109749
690 Ga0070670_100122313
691 Ga0070677_10002809
692 Ga0068869_100010507
693 Ga0068869_100010636
694 Ga0068869_100083371
695 Ga0070666_10000383
696 Ga0070666_10003557
697 Ga0070666_10099621
698 Ga0070680_100015422
699 Ga0070680_100124645
700 Ga0068868_100002833
701 Ga0068868_100005199
702 Ga0068868_100058201
703 Ga0068868_100088389
704 Ga0068868_100088808
705 Ga0070689_100405713
706 Ga0070687_100003187
707 Ga0070687_100063162
708 Ga0070661_100201232
709 Ga0070661_100317563
710 Ga0070668_100001276
711 Ga0070668_100009101
712 Ga0070668_100027813
713 Ga0070668_100053919
714 Ga0070668_100059643
715 Ga0070669_100002313
716 Ga0070669_100004036
717 Ga0070669_100004393
718 Ga0070669_100045640
719 Ga0070675_100002082
720 Ga0070675_100005774
721 Ga0070675_100005813
722 Ga0070675_100007536
723 Ga0070675_100013976
724 Ga0070675_100014161
725 Ga0070675_100017553
726 Ga0070675_100026658
727 Ga0070675_100037731
728 Ga0070675_100067830
729 Ga0070675_100084687
730 Ga0070675_100086008
731 Ga0070671_100002227
732 Ga0070671_100004990
733 Ga0070671_100007780
734 Ga0070671_100014357
735 Ga0070671_100043467
736 Ga0070671_100046163
737 Ga0070671_100057569
738 Ga0070671_100318377
739 Ga0070671_100350935
740 Ga0070674_100001605
741 Ga0070674_100007593
742 Ga0070674_100088654
743 Ga0070674_100103347
744 Ga0070674_100202525
745 Ga0070673_100004085
746 Ga0070673_100008381
747 Ga0070673_100051796
748 Ga0070673_100101270
749 Ga0070673_100105289
750 Ga0070659_100015154
751 Ga0070659_100182261
752 Ga0070667_100005842
753 Ga0070667_100008041
754 Ga0070667_100010549
755 Ga0070714_100347251
756 Ga0070701_10167957
757 Ga0070700_100007731
758 Ga0070678_100001678
759 Ga0070678_100002666
760 Ga0070678_100038520
761 Ga0070678_100096008
762 Ga0070678_100416814
763 Ga0070662_100011397
764 Ga0070662_100031576
765 Ga0070662_100361113
766 Ga0068867_100002278
767 Ga0068867_100005532
768 Ga0068867_100006849
769 Ga0068867_100009094
770 Ga0068867_100033024
771 Ga0068867_100128355
772 Ga0068867_100300638
773 Ga0070685_10019423
774 Ga0070699_100045007
775 Ga0070699_100526224
776 Ga0070679_100010825
777 Ga0070679_100236737
778 Ga0070684_100055214
779 Ga0068853_100059553
780 Ga0068853_100392257
781 Ga0070672_100000362
782 Ga0070672_100005080
783 Ga0070672_100005345
784 Ga0070672_100018795
785 Ga0070672_100037366
786 Ga0070672_100062569
787 Ga0070672_100115791
788 Ga0070672_100142566
789 Ga0070686_100031917
790 Ga0070686_100421875
791 Ga0070693_100086762
792 Ga0070665_100007950
793 Ga0070665_100027920
794 Ga0070665_100477243
795 Ga0068855_100026304
796 Ga0068855_100035899
797 Ga0068855_100164169
798 Ga0070664_100011431
799 Ga0070664_100025779
800 Ga0070664_100209698
801 Ga0068857_100045234
802 Ga0068857_100138896
803 Ga0068854_100096156
804 Ga0068856_100051388
805 Ga0068856_100067182
806 Ga0068856_100145177
807 Ga0068856_100160619
808 Ga0068852_100009536
809 Ga0068852_100010642
810 Ga0068852_100027812
811 Ga0068852_100050657
812 Ga0068852_100066624
813 Ga0068852_100134628
814 Ga0068852_100162593
815 Ga0068852_100265930
816 Ga0068852_100447265
817 Ga0068852_100466025
818 Ga0068859_100036665
819 Ga0068859_100157806
820 Ga0068859_100181956
821 Ga0068859_100242939
822 Ga0068859_100290503
823 Ga0068864_100005033
824 Ga0068864_100005144
825 Ga0068864_100021034
826 Ga0068864_100029242
827 Ga0068864_100079880
828 Ga0068864_100096205
829 Ga0068864_100129948
830 Ga0068864_100144118
831 Ga0068864_100153829
832 Ga0068864_100205316
833 Ga0068866_10002302
834 Ga0068866_10053849
835 Ga0068861_100042073
836 Ga0068861_100239257
837 Ga0068851_10004232
838 Ga0068851_10008387
839 Ga0068863_100006445
840 Ga0068863_100014308
841 Ga0068863_100021677
842 Ga0068863_100025104
843 Ga0068863_100038439
844 Ga0068863_100097802
845 Ga0068863_100264509
846 Ga0068858_100004984
847 Ga0068858_100005660
848 Ga0068858_100008645
849 Ga0068858_100011859
850 Ga0068858_100063509
851 Ga0068858_100145735
852 Ga0068858_100271215
853 Ga0068860_100001042
854 Ga0068860_100006915
855 Ga0068860_100016513
856 Ga0068860_100038264
857 Ga0068860_100092389
858 Ga0068860_100131556
859 Ga0068860_100132703
860 Ga0068862_100009567
861 Ga0068862_100035847
862 Ga0068862_100088278
863 Ga0068862_100131634
864 Ga0068862_100231646
865 Ga0068862_100311633
866 Ga0075365_10082141
867 Ga0075366_10083710
868 Ga0075366_10258443
869 Ga0097621_100004405
870 Ga0097621_100006878
871 Ga0097621_100023190
872 Ga0097621_100025132
873 Ga0097621_100033837
874 Ga0097621_100042318
875 Ga0068871_100008300
876 Ga0068871_100050514
877 Ga0068871_100141833
878 Ga0068871_100242042
879 Ga0075429_100002294
880 Ga0068865_100005451
881 Ga0068865_100021570
882 Ga0068865_100064097
883 Ga0068865_100142105
884 Ga0097620_100036665
885 Ga0097620_100157803
886 Ga0097620_100181966
887 Ga0097620_100242958
888 Ga0097620_100290506
889 Ga0105240_10005068
890 Ga0105240_10029445
891 Ga0105240_10033517
892 Ga0105240_10219036
893 Ga0105240_10581432
894 Ga0111539_10419277
895 Ga0105245_10043120
896 Ga0105245_10098378
897 Ga0105245_10376809
898 Ga0105243_10004458
899 Ga0105243_10051567
900 Ga0105243_10454456
901 Ga0105242_10003366
902 Ga0105242_10055908
903 Ga0105242_10093705
904 Ga0105242_10133409
905 Ga0105242_10160427
906 Ga0105248_10002431
907 Ga0105248_10002726
908 Ga0105248_10015932
909 Ga0105248_10035490
910 Ga0105248_10042168
911 Ga0105248_10044753
912 Ga0105248_10045959
913 Ga0105248_10046386
914 Ga0105248_10084741
915 Ga0105248_10112068
916 Ga0105248_10131990
917 Ga0105248_10444312
918 Ga0105237_10138331
919 Ga0105237_10142040
920 Ga0105238_10022233
921 Ga0105238_10026901
922 Ga0105238_10067527
923 Ga0105238_10162702
924 Ga0105249_10001991
925 Ga0105249_10103755
926 Ga0105239_10025716
927 Ga0157373_10013320
928 Ga0157371_10020484
929 Ga0157369_10016713
930 Ga0157369_10130332
931 Ga0157374_10007182
932 Ga0157374_10022816
933 Ga0157374_10075199
934 Ga0157374_10161805
935 Ga0157378_10025923
936 Ga0163162_10001893
937 Ga0163162_10005282
938 Ga0163162_10010523
939 Ga0163162_10090488
940 Ga0163162_10259302
941 Ga0163162_10354476
942 Ga0157372_10007345
943 Ga0157372_10065806
944 Ga0157375_10006696
945 Ga0157375_10016875
946 Ga0157375_10019019
947 Ga0157375_10038905
948 Ga0157375_10086187
949 Ga0157375_10173242
950 Ga0163163_10083656
951 Ga0163163_10349646
952 Ga0157380_10035828
953 Ga0157379_10000632
954 Ga0157379_10001435
955 Ga0157379_10007829
956 Ga0157379_10008418
957 Ga0157379_10013996
958 Ga0157379_10105151
959 Ga0157379_10257236
960 Ga0157376_10005040
961 Ga0157376_10010909
962 Ga0163161_10007699
963 Ga0163161_10044323
964 Ga0163161_10066151
965 Ga0163161_10101066
966 Ga0163161_10108850
967 Ga0213872_10001334
968 Ga0213876_10063430
969 Ga0209563_100044
970 Ga0209675_1004177
971 Ga0209025_1000040
972 Ga0209025_1037943
973 Ga0209050_1001200
974 Ga0209051_1010077
975 Ga0209257_1000049
976 Ga0207697_10020895
977 Ga0207697_10023434
978 Ga0207656_10004680
979 Ga0207656_10009388
980 Ga0207656_10015846
981 Ga0207656_10021238
982 Ga0207682_10001005
983 Ga0207682_10002098
984 Ga0207682_10005051
985 Ga0207682_10022241
986 Ga0207642_10003623
987 Ga0207688_10016160
988 Ga0207688_10083831
989 Ga0207680_10002448
990 Ga0207680_10151345
991 Ga0207680_10182294
992 Ga0207645_10000390
993 Ga0207645_10003275
994 Ga0207645_10030818
995 Ga0207645_10120985
996 Ga0207643_10062337
997 Ga0207705_10012330
998 Ga0207705_10017050
999 Ga0207705_10040425
1000 Ga0207695_10042647
1001 Ga0207695_10105096
1002 Ga0207695_10105395
1003 Ga0207671_10271423
1004 Ga0207671_10308801
1005 Ga0207660_10021106
1006 Ga0207660_10072617
1007 Ga0207660_10164401
1008 Ga0207662_10036122
1009 Ga0207662_10058612
1010 Ga0207657_10097215
1011 Ga0207657_10102826
1012 Ga0207657_10297708
1013 Ga0207649_10007382
1014 Ga0207652_10016058
1015 Ga0207652_10016721
1016 Ga0207681_10000675
1017 Ga0207681_10003053
1018 Ga0207681_10011715
1019 Ga0207681_10045699
1020 Ga0207681_10048696
1021 Ga0207681_10073626
1022 Ga0207694_10064266
1023 Ga0207694_10068841
1024 Ga0207694_10218805
1025 Ga0207650_10000548
1026 Ga0207650_10009480
1027 Ga0207650_10052809
1028 Ga0207650_10071134
1029 Ga0207650_10084748
1030 Ga0207650_10110957
1031 Ga0207650_10128616
1032 Ga0207650_10141031
1033 Ga0207659_10003731
1034 Ga0207659_10005425
1035 Ga0207659_10005549
1036 Ga0207659_10006585
1037 Ga0207659_10019174
1038 Ga0207659_10019777
1039 Ga0207659_10028539
1040 Ga0207659_10045135
1041 Ga0207659_10073847
1042 Ga0207659_10082015
1043 Ga0207659_10124418
1044 Ga0207644_10002501
1045 Ga0207644_10004015
1046 Ga0207644_10004735
1047 Ga0207644_10022717
1048 Ga0207644_10038136
1049 Ga0207644_10049383
1050 Ga0207644_10209441
1051 Ga0207644_10243345
1052 Ga0207690_10014595
1053 Ga0207706_10003084
1054 Ga0207706_10021208
1055 Ga0207706_10053029
1056 Ga0207706_10246749
1057 Ga0207706_10335194
1058 Ga0207686_10018455
1059 Ga0207686_10036777
1060 Ga0207686_10251766
1061 Ga0207686_10387386
1062 Ga0207709_10010315
1063 Ga0207670_10004097
1064 Ga0207669_10000537
1065 Ga0207669_10040385
1066 Ga0207669_10096966
1067 Ga0207669_10174345
1068 Ga0207669_10299562
1069 Ga0207704_10002824
1070 Ga0207704_10032404
1071 Ga0207704_10040583
1072 Ga0207704_10090825
1073 Ga0207704_10102211
1074 Ga0207704_10107279
1075 Ga0207665_10117777
1076 Ga0207691_10000390
1077 Ga0207691_10000629
1078 Ga0207691_10003901
1079 Ga0207691_10005390
1080 Ga0207691_10027723
1081 Ga0207691_10031684
1082 Ga0207691_10044950
1083 Ga0207691_10047703
1084 Ga0207691_10079355
1085 Ga0207711_10004634
1086 Ga0207711_10005818
1087 Ga0207711_10006916
1088 Ga0207711_10010776
1089 Ga0207711_10023802
1090 Ga0207711_10026506
1091 Ga0207711_10052128
1092 Ga0207711_10060767
1093 Ga0207711_10069378
1094 Ga0207711_10254847
1095 Ga0207689_10001729
1096 Ga0207689_10004319
1097 Ga0207689_10006256
1098 Ga0207689_10006485
1099 Ga0207661_10028188
1100 Ga0207661_10054524
1101 Ga0207679_10025627
1102 Ga0207679_10072701
1103 Ga0207667_10102772
1104 Ga0207667_10433310
1105 Ga0207651_10000650
1106 Ga0207651_10014132
1107 Ga0207651_10033267
1108 Ga0207651_10036296
1109 Ga0207651_10037958
1110 Ga0207651_10092459
1111 Ga0207651_10170828
1112 Ga0207651_10178176
1113 Ga0207651_10206297
1114 Ga0207712_10014950
1115 Ga0207668_10002995
1116 Ga0207668_10017323
1117 Ga0207668_10055988
1118 Ga0207668_10076394
1119 Ga0207668_10095823
1120 Ga0207668_10143501
1121 Ga0207640_10045551
1122 Ga0207640_10216325
1123 Ga0207658_10004261
1124 Ga0207658_10004266
1125 Ga0207658_10006548
1126 Ga0207677_10003065
1127 Ga0207677_10004606
1128 Ga0207677_10005295
1129 Ga0207677_10041841
1130 Ga0207677_10047843
1131 Ga0207677_10327295
1132 Ga0207677_10361753
1133 Ga0207703_10004561
1134 Ga0207703_10006227
1135 Ga0207703_10007497
1136 Ga0207703_10012235
1137 Ga0207703_10022098
1138 Ga0207703_10076779
1139 Ga0207639_10015678
1140 Ga0207639_10142289
1141 Ga0207639_10159153
1142 Ga0207639_10262978
1143 Ga0207639_10398040
1144 Ga0207678_10001027
1145 Ga0207678_10423928
1146 Ga0207708_10079831
1147 Ga0207702_10018519
1148 Ga0207702_10028710
1149 Ga0207702_10072413
1150 Ga0207702_10078492
1151 Ga0207702_10169755
1152 Ga0207641_10004255
1153 Ga0207641_10004293
1154 Ga0207641_10009041
1155 Ga0207641_10011162
1156 Ga0207641_10059682
1157 Ga0207641_10407627
1158 Ga0207648_10000364
1159 Ga0207648_10001878
1160 Ga0207648_10005035
1161 Ga0207648_10012904
1162 Ga0207648_10068346
1163 Ga0207648_10130846
1164 Ga0207648_10156590
1165 Ga0207648_10274056
1166 Ga0207676_10006858
1167 Ga0207676_10007475
1168 Ga0207676_10019043
1169 Ga0207676_10040307
1170 Ga0207676_10097064
1171 Ga0207676_10118832
1172 Ga0207676_10263972
1173 Ga0207674_10035971
1174 Ga0207674_10059448
1175 Ga0207675_100000267
1176 Ga0207675_100000401
1177 Ga0207675_100023619
1178 Ga0207675_100066420
1179 Ga0207683_10000076
1180 Ga0207683_10003684
1181 Ga0207683_10004593
1182 Ga0207683_10021450
1183 Ga0207683_10025117
1184 Ga0207683_10033869
1185 Ga0207698_10022294
1186 Ga0207698_10061997
1187 Ga0207698_10081812
1188 Ga0207698_10139195
1189 Ga0207698_10257412
1190 Ga0207698_10279881
1191 Ga0268266_10069518
1192 Ga0268266_10081063
1193 Ga0268266_10084083
1194 Ga0268266_10149807
1195 Ga0268266_10178861
1196 Ga0268266_10479387
1197 Ga0268265_10055867
1198 Ga0268265_10068194
1199 Ga0268265_10248398
1200 Ga0268264_10007375
1201 Ga0268264_10071101
1202 Ga0268264_10085206
1203 Ga0268264_10157221
1204 Ga0307515_10064322
1205 Ga0265332_10001641
1206 Ga0265328_10002184
1207 Ga0265331_10009053
1208 Ga0265327_10000028
1209 Ga0265327_10000773
1210 Ga0307513_10116415
1211 Ga0307408_100398011
1212 Ga0265314_10003637
1213 Ga0316576_10074870
1214 Ga0307516_10256923
1215 Ga0307405_10001548
1216 Ga0307405_10016397
1217 Ga0307413_10017224
1218 Ga0307410_10012873
1219 Ga0307410_10273934
1220 Ga0307406_10031577
1221 Ga0307407_10059462
1222 Ga0307409_100020401
1223 Ga0307409_100031414
1224 Ga0307409_100171661
1225 Ga0307409_100327194
1226 Ga0307416_100027794
1227 Ga0307416_100033175
1228 Ga0307416_100104866
1229 Ga0307416_100625829
1230 Ga0307414_10179900
1231 Ga0307411_10039101
1232 Ga0307411_10152116
1233 Ga0307415_100031923
1234 Ga0373926_0050923
1235 Ga0373931_0015217
1236 Ga0373937_0015680
1237 Ga0373937_0207946
1238 Ga0373925_0007713
1239 Ga0373925_0134109
1240 Ga0395899_0053075
1241 Ga0395900_0156319
1242 Ga0395905_0034212
1243 Ga0395905_0185368
1244 Ga0395905_0396216
1245 Ga0395901_0088458
1246 Ga0436365_1713127
1247 Ga0436361_0368333
1248 Ga0436361_0457870
1249 Ga0436361_0698438
1250 Ga0439464_0033602
1251 Ga0451577_0030534
1252 Ga0466966_0031348
1253 Ga0466966_0192346
1254 Ga0466961_0013874
1255 Ga0466961_0199094
1256 Ga0466970_0059165
1257 Ga0466957_0085662
1258 Ga0466959_0008418
1259 Ga0451576_0000386
1260 Ga0466958_0013949
1261 Ga0495629_0163269
1262 Ga0495580_0028882
1263 Ga0495628_0085567
1264 Ga0495643_0008229
1265 Ga0495642_0004925
1266 Ga0495652_0063161
1267 Ga0495621_0046053
1268 Ga0495621_0068231
1269 Ga0495645_0029044
1270 Ga0495645_0191251
1271 Ga0495667_0095822
1272 Ga0495635_0219798
1273 Ga0495635_0249291
1274 Ga0495661_0001706
1275 Ga0495599_0001643
1276 Ga0495623_0076833
1277 Ga0495646_0112037
1278 Ga0495647_0063151
1279 Ga0495658_0122533
1280 Ga0495636_0093266
1281 Ga0495686_0198256
1282 Ga0495615_0011627
1283 Ga0496102_0009476
1284 Ga0496104_0041094
1285 Ga0496104_0145151
1286 Ga0496104_0284154
1287 Ga0496105_0048217
1288 Ga0496106_0008514
1289 Ga0496107_0007111
1290 Ga0496109_0198695
1291 Ga0496110_0240919
1292 Ga0496110_0262817
1293 Ga0496112_0232428
1294 Ga0496113_0051136
1295 Ga0496113_0069430
1296 Ga0496114_0073574
1297 Ga0496114_0082336
1298 Ga0496116_0007313
1299 Ga0496121_0013498
1300 Ga0496121_0029079
1301 Ga0496121_0065589
1302 Ga0496122_0000272
1303 Ga0496123_0000221
1304 Ga0496124_0033936
1305 Ga0501033_0016170
1306 Ga0501034_0035860
1307 Ga0501047_0042160
1308 Ga0501035_0007355
1309 Ga0501044_0002878
1310 nmdc:mga0k408_1129_c1
1311 nmdc:mga09592_3054_c1
1312 nmdc:mga0qj67_2967_c1
1313 Ga0495595_0042977
1314 Ga0495619_0083554
1315 Ga0495619_0084722
1316 Ga0500559_0001066
1317 2644060590
1318 2644073911
1319 2739242613
1320 2739249404
1321 2816473066
1322 2842738012
1323 2855736629
1324 2855773566
1325 2876770069
1326 2881417928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

45

96

0.89

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

45

276

0.75

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

57

276

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8463 27 309
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8288 27 309
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8282 27 309
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8239 27 309
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.812 27 320
ID Description Score Start End Superfamily
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8086 28 320 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7986 28 320 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7948 29 308 3.60.15.10
af_Q8IK95_37_136_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7826 77 225 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7746 29 308 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A524QA81-F1-model_v4 MBL fold metallo-hydrolase 0.9974 27 322 GO:0016787
AF-A0A433BN31-F1-model_v4 MBL fold metallo-hydrolase 0.9964 204 323 GO:0016787
AF-A0A523KPM4-F1-model_v4 MBL fold metallo-hydrolase 0.9938 119 322 GO:0016787
AF-A0A7X2SCB1-F1-model_v4 MBL fold metallo-hydrolase 0.9932 21 323 GO:0016787
AF-A0A6L4YJA8-F1-model_v4 Metal-dependent hydrolase 0.9918 83 322 GO:0016787

Map