F473527

General Info

Members Datasets Scaffolds Average Seq Length
663 342 1326 142

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100000021|Ga0070683_10000002148
Length 169
Sequence VWRGFLLGPAGTVDSVDRIFFSYRRIQCHMKRTASAHWTGDLKSGNGTVSTASGTLANAAYSFHTRFEEGKGTNPEELLAAAHAGCFTMALSAQLAQANLVAESLDTTCAISLEKQPDGFAITSSHLEVKAKIPGATQEAFDKAAQAAKAGCPVSKLYKTNITLNAQLL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
6 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
332 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
337 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
338 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
339 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
340 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
341 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
342 2922554459 Rhodococcus sp. 66b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 1.81
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.9
Rhizosphere 96.68
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000021 3300005329 Bacteria 183486
2 JGI24737J22298_10041369 3300001990 Bacteria 1413
3 JGI24737J22298_10063507 3300001990 Bacteria 1109
4 JGI26129J50193_1011067 3300003349 Bacteria 659
5 JGI26145J50221_1009917 3300003371 Bacteria 833
6 JGI26140J50224_103035 3300003383 Bacteria 616
7 JGI26132J50249_103724 3300003405 Bacteria 558
8 Ga0058859_11339659 3300004798 Bacteria 653
9 Ga0058863_11743129 3300004799 Bacteria 600
10 Ga0058863_11832152 3300004799 Bacteria 3195
11 Ga0058861_11780872 3300004800 Bacteria 1126
12 Ga0058861_11963446 3300004800 Bacteria 2209
13 Ga0058862_10044972 3300004803 Bacteria 3038
14 Ga0058862_12467854 3300004803 Bacteria 1197
15 Ga0065704_10002476 3300005289 Bacteria 7415
16 Ga0065715_10135584 3300005293 Bacteria 1936
17 Ga0065715_10345873 3300005293 Bacteria 959
18 Ga0065707_10000857 3300005295 Bacteria 20001
19 Ga0070658_10096023 3300005327 Bacteria 2447
20 Ga0070658_11348470 3300005327 Bacteria 619
21 Ga0070676_10003115 3300005328 Bacteria 8565
22 Ga0070683_100171746 3300005329 Bacteria 2058
23 Ga0070683_100278793 3300005329 Bacteria 1590
24 Ga0070683_100843253 3300005329 Bacteria 879
25 Ga0070683_102092428 3300005329 Bacteria 544
26 Ga0070690_100000268 3300005330 Bacteria 26726
27 Ga0070690_100037489 3300005330 Bacteria 3055
28 Ga0070670_100091760 3300005331 Bacteria 2611
29 Ga0070677_10086894 3300005333 Bacteria 1352
30 Ga0068869_100005060 3300005334 Bacteria 8264
31 Ga0068869_100225946 3300005334 Bacteria 1486
32 Ga0070666_10422093 3300005335 Bacteria 961
33 Ga0070680_100002000 3300005336 Bacteria 15004
34 Ga0070680_100019458 3300005336 Bacteria 5380
35 Ga0070680_100252525 3300005336 Bacteria 1491
36 Ga0070682_100029799 3300005337 Bacteria 3289
37 Ga0070682_100151621 3300005337 Bacteria 1591
38 Ga0070682_100569177 3300005337 Bacteria 890
39 Ga0070682_100763938 3300005337 Bacteria 782
40 Ga0068868_100236063 3300005338 Bacteria 1535
41 Ga0068868_100478961 3300005338 Bacteria 1087
42 Ga0070660_100016427 3300005339 Bacteria 5371
43 Ga0070660_100071120 3300005339 Bacteria 2716
44 Ga0070660_100093622 3300005339 Bacteria 2373
45 Ga0070660_100513213 3300005339 Bacteria 998
46 Ga0070689_100002609 3300005340 Bacteria 11806
47 Ga0070689_100029993 3300005340 Bacteria 4125
48 Ga0070691_10001292 3300005341 Bacteria 10616
49 Ga0070691_10001592 3300005341 Bacteria 9808
50 Ga0070687_100000783 3300005343 Bacteria 10560
51 Ga0070687_100005963 3300005343 Bacteria 4959
52 Ga0070661_100003521 3300005344 Bacteria 10788
53 Ga0070661_100179870 3300005344 Bacteria 1608
54 Ga0070661_100287843 3300005344 Bacteria 1276
55 Ga0070692_10028675 3300005345 Bacteria 2768
56 Ga0070692_10146811 3300005345 Bacteria 1340
57 Ga0070669_100026870 3300005353 Bacteria 4141
58 Ga0070675_100378547 3300005354 Bacteria 1259
59 Ga0070674_100000520 3300005356 Bacteria 19313
60 Ga0070673_100023468 3300005364 Bacteria 4507
61 Ga0070673_100050153 3300005364 Bacteria 3262
62 Ga0070673_101069897 3300005364 Bacteria 753
63 Ga0070688_100165217 3300005365 Bacteria 1523
64 Ga0070659_100006309 3300005366 Bacteria 8565
65 Ga0070659_100519673 3300005366 Bacteria 1016
66 Ga0070659_101367667 3300005366 Bacteria 629
67 Ga0070667_100019748 3300005367 Bacteria 5591
68 Ga0070709_10000446 3300005434 Bacteria 24957
69 Ga0070709_10103967 3300005434 Unclassified 1897
70 Ga0070714_100084975 3300005435 Bacteria 2763
71 Ga0070713_100000119 3300005436 Bacteria 50929
72 Ga0070713_100037766 3300005436 Bacteria 3906
73 Ga0070713_100081644 3300005436 Bacteria 2759
74 Ga0070713_100112676 3300005436 Unclassified 2374
75 Ga0070701_10040066 3300005438 Bacteria 2379
76 Ga0070705_100011725 3300005440 Bacteria 4433
77 Ga0070705_100665889 3300005440 Bacteria 813
78 Ga0070705_100787914 3300005440 Bacteria 755
79 Ga0070700_100009053 3300005441 Bacteria 5455
80 Ga0070694_100004334 3300005444 Bacteria 8529
81 Ga0070694_100997978 3300005444 Bacteria 695
82 Ga0070708_100099360 3300005445 Bacteria 2662
83 Ga0070708_100181989 3300005445 Bacteria 1965
84 Ga0070708_100734093 3300005445 Bacteria 929
85 Ga0070708_100872686 3300005445 Bacteria 845
86 Ga0070663_100131927 3300005455 Bacteria 1898
87 Ga0070678_100001247 3300005456 Bacteria 13476
88 Ga0070678_100503584 3300005456 Bacteria 1069
89 Ga0070662_100005166 3300005457 Bacteria 8326
90 Ga0070681_10000620 3300005458 Bacteria 29093
91 Ga0070681_10009638 3300005458 Bacteria 9499
92 Ga0070681_10019215 3300005458 Bacteria 6839
93 Ga0070681_10107327 3300005458 Bacteria 2733
94 Ga0070681_10312791 3300005458 Bacteria 1480
95 Ga0068867_100005610 3300005459 Bacteria 8890
96 Ga0068867_100178052 3300005459 Bacteria 1689
97 Ga0068867_100418315 3300005459 Bacteria 1135
98 Ga0070685_10183190 3300005466 Bacteria 1350
99 Ga0070706_100059639 3300005467 Bacteria 3522
100 Ga0070706_101172685 3300005467 Unclassified 706
101 Ga0070707_100430453 3300005468 Bacteria 1280
102 Ga0070707_101330521 3300005468 Bacteria 685
103 Ga0070698_100028842 3300005471 Bacteria 5761
104 Ga0070698_100045369 3300005471 Bacteria 4499
105 Ga0070698_100075085 3300005471 Bacteria 3385
106 Ga0070698_100245076 3300005471 Bacteria 1725
107 Ga0070698_101640205 3300005471 Unclassified 595
108 Ga0070699_100552735 3300005518 Bacteria 1048
109 Ga0070679_100219983 3300005530 Bacteria 1860
110 Ga0070679_100376790 3300005530 Bacteria 1366
111 Ga0070679_100486531 3300005530 Bacteria 1178
112 Ga0070679_100563874 3300005530 Bacteria 1082
113 Ga0070684_100000010 3300005535 Bacteria 183486
114 Ga0070684_100002249 3300005535 Bacteria 14196
115 Ga0070684_100059170 3300005535 Bacteria 3349
116 Ga0070684_100095828 3300005535 Bacteria 2644
117 Ga0070684_100231042 3300005535 Bacteria 1689
118 Ga0070684_100394102 3300005535 Bacteria 1276
119 Ga0070697_100775234 3300005536 Bacteria 848
120 Ga0070697_100882186 3300005536 Bacteria 793
121 Ga0068853_100238808 3300005539 Bacteria 1665
122 Ga0068853_100620080 3300005539 Bacteria 1028
123 Ga0068853_101225605 3300005539 Bacteria 725
124 Ga0070672_100144046 3300005543 Bacteria 1968
125 Ga0070672_100546422 3300005543 Bacteria 1005
126 Ga0070686_101201915 3300005544 Bacteria 630
127 Ga0070695_100578869 3300005545 Bacteria 879
128 Ga0070696_100009062 3300005546 Bacteria 6665
129 Ga0070693_100018568 3300005547 Bacteria 3635
130 Ga0070665_100934437 3300005548 Bacteria 880
131 Ga0068855_100022011 3300005563 Bacteria 7644
132 Ga0068855_100063798 3300005563 Bacteria 4298
133 Ga0068855_100089631 3300005563 Bacteria 3551
134 Ga0068855_100166440 3300005563 Bacteria 2499
135 Ga0068855_100538888 3300005563 Bacteria 1265
136 Ga0068855_100937511 3300005563 Bacteria 913
137 Ga0070664_100000380 3300005564 Bacteria 32997
138 Ga0070664_100030439 3300005564 Bacteria 4503
139 Ga0070664_100098344 3300005564 Bacteria 2542
140 Ga0068857_100004222 3300005577 Bacteria 12108
141 Ga0068857_100024493 3300005577 Bacteria 5314
142 Ga0068857_100060242 3300005577 Bacteria 3372
143 Ga0068854_100203646 3300005578 Bacteria 1557
144 Ga0068854_100378044 3300005578 Bacteria 1166
145 Ga0068856_100002664 3300005614 Bacteria 18312
146 Ga0068856_100061759 3300005614 Bacteria 3702
147 Ga0068856_100067035 3300005614 Bacteria 3547
148 Ga0070702_100011191 3300005615 Bacteria 4456
149 Ga0068852_100005315 3300005616 Bacteria 9195
150 Ga0068852_100280835 3300005616 Bacteria 1605
151 Ga0068852_101910032 3300005616 Bacteria 616
152 Ga0068859_100097634 3300005617 Bacteria 2991
153 Ga0068859_101309344 3300005617 Bacteria 798
154 Ga0068859_102690961 3300005617 Bacteria 547
155 Ga0068864_100064625 3300005618 Bacteria 3174
156 Ga0068864_100210194 3300005618 Bacteria 1791
157 Ga0068866_10023635 3300005718 Bacteria 2862
158 Ga0068866_10119946 3300005718 Bacteria 1480
159 Ga0068861_100244087 3300005719 Bacteria 1529
160 Ga0068870_10039853 3300005840 Bacteria 2433
161 Ga0068863_100031444 3300005841 Bacteria 5064
162 Ga0068863_100032933 3300005841 Bacteria 4938
163 Ga0068863_100411252 3300005841 Bacteria 1324
164 Ga0068858_100660396 3300005842 Bacteria 1016
165 Ga0068858_100787752 3300005842 Bacteria 927
166 Ga0068860_100044664 3300005843 Bacteria 4223
167 Ga0068860_100190520 3300005843 Bacteria 1985
168 Ga0068860_100348259 3300005843 Bacteria 1457
169 Ga0068862_100006593 3300005844 Bacteria 9626
170 Ga0068862_102539230 3300005844 Bacteria 524
171 Ga0081455_10000467 3300005937 Bacteria 52611
172 Ga0081539_10022429 3300005985 Bacteria 4177
173 Ga0070717_10461729 3300006028 Bacteria 1145
174 Ga0070717_10568349 3300006028 Bacteria 1027
175 Ga0070717_11032229 3300006028 Bacteria 749
176 Ga0075432_10254486 3300006058 Bacteria 714
177 Ga0070716_100006709 3300006173 Bacteria 5637
178 Ga0070712_100097073 3300006175 Bacteria 2171
179 Ga0070712_100303909 3300006175 Bacteria 1292
180 Ga0070712_100306663 3300006175 Bacteria 1287
181 Ga0097621_100004949 3300006237 Bacteria 9340
182 Ga0097621_100028674 3300006237 Bacteria 4389
183 Ga0097621_100041784 3300006237 Bacteria 3692
184 Ga0097621_100080090 3300006237 Bacteria 2716
185 Ga0097621_100780780 3300006237 Bacteria 884
186 Ga0068871_100068500 3300006358 Bacteria 2914
187 Ga0068871_100132439 3300006358 Bacteria 2115
188 Ga0068871_100230371 3300006358 Bacteria 1608
189 Ga0068871_100266392 3300006358 Bacteria 1496
190 Ga0075428_100027839 3300006844 Bacteria 6254
191 Ga0075428_100063824 3300006844 Bacteria 4033
192 Ga0075428_102755259 3300006844 Bacteria 500
193 Ga0075430_100006368 3300006846 Bacteria 9954
194 Ga0075431_100544845 3300006847 Bacteria 1148
195 Ga0075431_101374684 3300006847 Bacteria 666
196 Ga0075433_10051179 3300006852 Bacteria 3596
197 Ga0075433_10244867 3300006852 Bacteria 1591
198 Ga0075433_10329276 3300006852 Bacteria 1351
199 Ga0075434_100014412 3300006871 Bacteria 7556
200 Ga0075434_100740804 3300006871 Bacteria 1000
201 Ga0075434_100837957 3300006871 Bacteria 935
202 Ga0075429_100170849 3300006880 Bacteria 1904
203 Ga0068865_100000901 3300006881 Bacteria 16859
204 Ga0068865_100011465 3300006881 Bacteria 5553
205 Ga0068865_100383393 3300006881 Bacteria 1147
206 Ga0075436_100008785 3300006914 Bacteria 6908
207 Ga0075436_100024972 3300006914 Bacteria 4109
208 Ga0075436_100029683 3300006914 Bacteria 3760
209 Ga0075436_100209701 3300006914 Bacteria 1381
210 Ga0097620_100097636 3300006931 Bacteria 2991
211 Ga0097620_101309331 3300006931 Bacteria 798
212 Ga0097620_102690949 3300006931 Bacteria 547
213 Ga0075435_100006218 3300007076 Bacteria 8427
214 Ga0075435_100308306 3300007076 Bacteria 1354
215 Ga0075435_100311751 3300007076 Unclassified 1346
216 Ga0105240_10002166 3300009093 Bacteria 32053
217 Ga0105240_10002863 3300009093 Bacteria 27276
218 Ga0105240_10026522 3300009093 Bacteria 7603
219 Ga0105240_10084344 3300009093 Bacteria 3896
220 Ga0105240_10237016 3300009093 Bacteria 2117
221 Ga0105240_10403707 3300009093 Bacteria 1539
222 Ga0105240_12251099 3300009093 Bacteria 565
223 Ga0105245_10001350 3300009098 Bacteria 22211
224 Ga0105245_10002469 3300009098 Bacteria 16725
225 Ga0105245_10006512 3300009098 Bacteria 10260
226 Ga0105245_10020657 3300009098 Bacteria 5774
227 Ga0105245_10813560 3300009098 Bacteria 973
228 Ga0105245_10956278 3300009098 Bacteria 900
229 Ga0114129_10025566 3300009147 Bacteria 8365
230 Ga0114129_10393390 3300009147 Bacteria 1828
231 Ga0105243_10001764 3300009148 Bacteria 18611
232 Ga0105243_10110049 3300009148 Bacteria 2303
233 Ga0105241_10009108 3300009174 Bacteria 7305
234 Ga0105241_10174222 3300009174 Bacteria 1779
235 Ga0105241_12699648 3300009174 Bacteria 500
236 Ga0105242_10000591 3300009176 Bacteria 28628
237 Ga0105242_10044445 3300009176 Bacteria 3598
238 Ga0105248_10009114 3300009177 Bacteria 10916
239 Ga0105248_10592118 3300009177 Bacteria 1251
240 Ga0105248_10642383 3300009177 Bacteria 1197
241 Ga0105248_10680515 3300009177 Bacteria 1161
242 Ga0105237_10003660 3300009545 Bacteria 18126
243 Ga0105237_10016708 3300009545 Bacteria 7619
244 Ga0105237_10046896 3300009545 Bacteria 4344
245 Ga0105237_10049472 3300009545 Bacteria 4224
246 Ga0105237_10747605 3300009545 Bacteria 984
247 Ga0105237_10830533 3300009545 Bacteria 931
248 Ga0105238_10001548 3300009551 Bacteria 23069
249 Ga0105238_10012626 3300009551 Bacteria 8526
250 Ga0105238_10045208 3300009551 Bacteria 4449
251 Ga0105238_10088746 3300009551 Bacteria 3078
252 Ga0105238_10392837 3300009551 Unclassified 1379
253 Ga0105238_10475721 3300009551 Bacteria 1248
254 Ga0105238_10899890 3300009551 Bacteria 903
255 Ga0105249_10009114 3300009553 Bacteria 8679
256 Ga0105249_10031987 3300009553 Bacteria 4758
257 Ga0105249_10446601 3300009553 Unclassified 1331
258 Ga0105239_10001360 3300010375 Bacteria 32860
259 Ga0105239_10031962 3300010375 Bacteria 5783
260 Ga0105239_10772143 3300010375 Bacteria 1100
261 Ga0105239_11044522 3300010375 Bacteria 940
262 Ga0105239_12266945 3300010375 Bacteria 632
263 Ga0105239_12333011 3300010375 Bacteria 623
264 Ga0105246_10006006 3300011119 Bacteria 7414
265 Ga0105246_10589562 3300011119 Bacteria 959
266 Ga0105246_10884147 3300011119 Unclassified 800
267 Ga0157373_10805440 3300013100 Bacteria 693
268 Ga0157371_10028863 3300013102 Bacteria 4017
269 Ga0157371_10292981 3300013102 Bacteria 1177
270 Ga0157371_11252142 3300013102 Bacteria 573
271 Ga0157370_10002156 3300013104 Bacteria 24036
272 Ga0157370_10003135 3300013104 Bacteria 19581
273 Ga0157370_11443583 3300013104 Bacteria 619
274 Ga0157369_10002061 3300013105 Bacteria 24256
275 Ga0157369_10041393 3300013105 Bacteria 5029
276 Ga0157369_10043843 3300013105 Bacteria 4873
277 Ga0157369_10133531 3300013105 Bacteria 2629
278 Ga0157369_10772179 3300013105 Bacteria 988
279 Ga0157374_10023423 3300013296 Bacteria 5523
280 Ga0157374_10488182 3300013296 Unclassified 1235
281 Ga0157374_10808073 3300013296 Bacteria 954
282 Ga0157374_11041667 3300013296 Bacteria 838
283 Ga0157374_12048158 3300013296 Bacteria 599
284 Ga0157378_10006880 3300013297 Bacteria 9920
285 Ga0157378_10009658 3300013297 Bacteria 8400
286 Ga0157378_10441241 3300013297 Bacteria 1290
287 Ga0163162_10080451 3300013306 Bacteria 3326
288 Ga0157372_10001346 3300013307 Bacteria 26583
289 Ga0157372_10075021 3300013307 Bacteria 3815
290 Ga0157372_10172665 3300013307 Bacteria 2501
291 Ga0157372_10885438 3300013307 Bacteria 1036
292 Ga0157375_10005249 3300013308 Bacteria 11247
293 Ga0157375_11099400 3300013308 Bacteria 930
294 Ga0163163_10098198 3300014325 Bacteria 2949
295 Ga0163163_10463395 3300014325 Bacteria 1328
296 Ga0163163_11219624 3300014325 Bacteria 815
297 Ga0163163_12079659 3300014325 Unclassified 627
298 Ga0157377_10009609 3300014745 Bacteria 4755
299 Ga0157377_10432758 3300014745 Bacteria 904
300 Ga0157376_10000259 3300014969 Bacteria 36111
301 Ga0157376_10079002 3300014969 Bacteria 2819
302 Ga0157376_12069781 3300014969 Bacteria 607
303 Ga0206350_11324736 3300020080 Bacteria 514
304 Ga0154015_1114426 3300020610 Bacteria 631
305 Ga0213874_10022611 3300021377 Bacteria 1747
306 Ga0213875_10176345 3300021388 Bacteria 1004
307 Ga0224712_10471472 3300022467 Bacteria 604
308 Ga0224712_10582567 3300022467 Bacteria 545
309 Ga0207697_10031828 3300025315 Bacteria 2158
310 Ga0207653_10254284 3300025885 Unclassified 674
311 Ga0207682_10002726 3300025893 Bacteria 7839
312 Ga0207692_10218341 3300025898 Bacteria 1129
313 Ga0207692_10494371 3300025898 Bacteria 775
314 Ga0207642_10092105 3300025899 Bacteria 1500
315 Ga0207642_10131168 3300025899 Bacteria 1308
316 Ga0207688_10148017 3300025901 Bacteria 1385
317 Ga0207680_10348744 3300025903 Bacteria 1039
318 Ga0207647_10296051 3300025904 Bacteria 922
319 Ga0207685_10144086 3300025905 Bacteria 1071
320 Ga0207699_10000052 3300025906 Bacteria 99134
321 Ga0207699_10106417 3300025906 Bacteria 1790
322 Ga0207643_10115445 3300025908 Bacteria 1585
323 Ga0207654_10147456 3300025911 Bacteria 1507
324 Ga0207654_10181276 3300025911 Bacteria 1374
325 Ga0207707_10002949 3300025912 Bacteria 15152
326 Ga0207707_10011102 3300025912 Bacteria 7833
327 Ga0207707_10055585 3300025912 Bacteria 3443
328 Ga0207707_10156659 3300025912 Bacteria 1992
329 Ga0207707_10192865 3300025912 Bacteria 1777
330 Ga0207695_10001934 3300025913 Bacteria 32168
331 Ga0207695_10041163 3300025913 Bacteria 4946
332 Ga0207695_10264896 3300025913 Bacteria 1615
333 Ga0207695_10313549 3300025913 Bacteria 1458
334 Ga0207695_10550595 3300025913 Bacteria 1035
335 Ga0207671_10009483 3300025914 Bacteria 8130
336 Ga0207671_10043940 3300025914 Bacteria 3303
337 Ga0207671_11251149 3300025914 Bacteria 579
338 Ga0207693_10215036 3300025915 Bacteria 1510
339 Ga0207693_10343291 3300025915 Bacteria 1169
340 Ga0207693_10488511 3300025915 Bacteria 961
341 Ga0207663_10029621 3300025916 Bacteria 3218
342 Ga0207663_10343689 3300025916 Unclassified 1128
343 Ga0207663_10440638 3300025916 Bacteria 1003
344 Ga0207660_10002657 3300025917 Bacteria 11725
345 Ga0207660_11178064 3300025917 Bacteria 624
346 Ga0207662_10017270 3300025918 Bacteria 4079
347 Ga0207662_10550822 3300025918 Bacteria 799
348 Ga0207657_10019164 3300025919 Bacteria 6506
349 Ga0207657_10079047 3300025919 Bacteria 2768
350 Ga0207657_10740474 3300025919 Bacteria 762
351 Ga0207649_10051218 3300025920 Bacteria 2556
352 Ga0207649_10058054 3300025920 Bacteria 2422
353 Ga0207652_10066392 3300025921 Bacteria 3126
354 Ga0207652_10278803 3300025921 Bacteria 1508
355 Ga0207652_10316666 3300025921 Bacteria 1408
356 Ga0207652_10411802 3300025921 Bacteria 1219
357 Ga0207681_10002340 3300025923 Bacteria 12058
358 Ga0207694_10002139 3300025924 Bacteria 16230
359 Ga0207694_10005306 3300025924 Bacteria 9934
360 Ga0207694_10059787 3300025924 Bacteria 2965
361 Ga0207694_10156616 3300025924 Bacteria 1838
362 Ga0207650_10006151 3300025925 Bacteria 8181
363 Ga0207659_10079042 3300025926 Bacteria 2425
364 Ga0207687_10001423 3300025927 Bacteria 16352
365 Ga0207687_10002581 3300025927 Bacteria 12301
366 Ga0207687_10076690 3300025927 Bacteria 2402
367 Ga0207687_10999063 3300025927 Bacteria 717
368 Ga0207700_10000157 3300025928 Bacteria 40638
369 Ga0207700_10061976 3300025928 Bacteria 2839
370 Ga0207700_10823734 3300025928 Bacteria 830
371 Ga0207664_10128174 3300025929 Bacteria 2132
372 Ga0207664_11975457 3300025929 Bacteria 506
373 Ga0207644_11670231 3300025931 Bacteria 534
374 Ga0207690_10002281 3300025932 Bacteria 11696
375 Ga0207690_10519057 3300025932 Bacteria 965
376 Ga0207690_10889237 3300025932 Bacteria 738
377 Ga0207706_10000184 3300025933 Bacteria 69924
378 Ga0207686_10009700 3300025934 Bacteria 5231
379 Ga0207686_10010882 3300025934 Bacteria 4963
380 Ga0207686_10028047 3300025934 Bacteria 3305
381 Ga0207709_10027936 3300025935 Bacteria 3257
382 Ga0207670_10026060 3300025936 Bacteria 3680
383 Ga0207670_10080485 3300025936 Bacteria 2277
384 Ga0207669_10001788 3300025937 Bacteria 9117
385 Ga0207704_10002453 3300025938 Bacteria 8346
386 Ga0207704_10023162 3300025938 Bacteria 3342
387 Ga0207704_10562023 3300025938 Bacteria 929
388 Ga0207665_10008069 3300025939 Bacteria 6949
389 Ga0207691_10000363 3300025940 Bacteria 45697
390 Ga0207691_10084864 3300025940 Bacteria 2842
391 Ga0207711_10000207 3300025941 Bacteria 62922
392 Ga0207711_10372212 3300025941 Bacteria 1325
393 Ga0207689_10001295 3300025942 Bacteria 24109
394 Ga0207689_10092565 3300025942 Bacteria 2483
395 Ga0207689_10522190 3300025942 Bacteria 996
396 Ga0207689_11788936 3300025942 Bacteria 507
397 Ga0207661_10000012 3300025944 Bacteria 354345
398 Ga0207661_10011885 3300025944 Bacteria 6322
399 Ga0207661_10030806 3300025944 Bacteria 4136
400 Ga0207661_10066271 3300025944 Bacteria 2933
401 Ga0207661_10107997 3300025944 Bacteria 2348
402 Ga0207661_10144249 3300025944 Bacteria 2052
403 Ga0207661_10867075 3300025944 Bacteria 831
404 Ga0207661_11002976 3300025944 Bacteria 769
405 Ga0207679_10003923 3300025945 Bacteria 9236
406 Ga0207679_10099343 3300025945 Bacteria 2272
407 Ga0207679_10245577 3300025945 Bacteria 1519
408 Ga0207667_10001595 3300025949 Bacteria 28504
409 Ga0207667_10094741 3300025949 Bacteria 3082
410 Ga0207667_10135983 3300025949 Bacteria 2531
411 Ga0207667_10308325 3300025949 Bacteria 1617
412 Ga0207651_10040083 3300025960 Bacteria 3095
413 Ga0207651_10096835 3300025960 Bacteria 2177
414 Ga0207651_10763399 3300025960 Bacteria 855
415 Ga0207712_10083256 3300025961 Bacteria 2334
416 Ga0207712_11080439 3300025961 Bacteria 714
417 Ga0207668_10161232 3300025972 Bacteria 1748
418 Ga0207640_10145241 3300025981 Bacteria 1735
419 Ga0207640_10628720 3300025981 Bacteria 912
420 Ga0207677_10456913 3300026023 Bacteria 1095
421 Ga0207703_10006549 3300026035 Bacteria 9287
422 Ga0207639_10213501 3300026041 Bacteria 1662
423 Ga0207639_10714151 3300026041 Bacteria 930
424 Ga0207708_10000065 3300026075 Bacteria 85174
425 Ga0207708_11938961 3300026075 Bacteria 516
426 Ga0207702_10021106 3300026078 Bacteria 5389
427 Ga0207702_10636608 3300026078 Bacteria 1048
428 Ga0207641_10120727 3300026088 Bacteria 2338
429 Ga0207641_10261389 3300026088 Bacteria 1621
430 Ga0207641_10528238 3300026088 Bacteria 1148
431 Ga0207648_10011163 3300026089 Bacteria 8474
432 Ga0207648_10035852 3300026089 Bacteria 4371
433 Ga0207648_10617323 3300026089 Unclassified 1000
434 Ga0207676_10156406 3300026095 Bacteria 1970
435 Ga0207676_10208950 3300026095 Unclassified 1730
436 Ga0207674_10000252 3300026116 Bacteria 66798
437 Ga0207674_10013086 3300026116 Bacteria 9236
438 Ga0207674_10029239 3300026116 Bacteria 5804
439 Ga0207675_100313523 3300026118 Bacteria 1530
440 Ga0207683_10004783 3300026121 Bacteria 11657
441 Ga0207683_10204534 3300026121 Bacteria 1795
442 Ga0207683_10834414 3300026121 Bacteria 856
443 Ga0207698_10008263 3300026142 Bacteria 6572
444 Ga0207698_10337238 3300026142 Bacteria 1418
445 Ga0209973_1025202 3300027252 Bacteria 813
446 Ga0209969_1000054 3300027360 Bacteria 13208
447 Ga0209967_1000181 3300027364 Bacteria 8752
448 Ga0209996_1000076 3300027395 Bacteria 13502
449 Ga0209984_1006776 3300027424 Bacteria 1411
450 Ga0210000_1000116 3300027462 Bacteria 11120
451 Ga0209995_1000217 3300027471 Bacteria 9215
452 Ga0209968_1000149 3300027526 Bacteria 12240
453 Ga0209999_1043780 3300027543 Bacteria 841
454 Ga0209982_1000358 3300027552 Bacteria 5541
455 Ga0210002_1000112 3300027617 Bacteria 12816
456 Ga0209971_1000040 3300027682 Bacteria 41997
457 Ga0209966_1000051 3300027695 Bacteria 50839
458 Ga0209998_10001705 3300027717 Bacteria 5243
459 Ga0209974_10005576 3300027876 Bacteria 4423
460 Ga0207428_10003293 3300027907 Bacteria 15707
461 Ga0268266_11161225 3300028379 Bacteria 747
462 Ga0268265_10153778 3300028380 Bacteria 1944
463 Ga0268265_12215496 3300028380 Bacteria 556
464 Ga0268264_10107900 3300028381 Bacteria 2433
465 Ga0268264_10268982 3300028381 Bacteria 1591
466 Ga0268264_10840444 3300028381 Bacteria 919
467 Ga0265337_1098683 3300028556 Bacteria 795
468 Ga0265338_10129452 3300028800 Bacteria 1996
469 Ga0265338_10323957 3300028800 Bacteria 1115
470 Ga0265330_10275972 3300031235 Bacteria 708
471 Ga0265320_10227803 3300031240 Bacteria 829
472 Ga0265340_10008036 3300031247 Bacteria 5717
473 Ga0265313_10009430 3300031595 Bacteria 6341
474 Ga0265314_10002846 3300031711 Bacteria 17224
475 Ga0316576_10000227 3300031727 Bacteria 24075
476 Ga0307405_11180987 3300031731 Bacteria 661
477 Ga0307407_10607919 3300031903 Bacteria 815
478 Ga0307409_100182390 3300031995 Bacteria 1860
479 Ga0307409_100421917 3300031995 Bacteria 1280
480 Ga0307416_101440605 3300032002 Bacteria 795
481 Ga0307416_102903002 3300032002 Bacteria 573
482 Ga0307415_100021552 3300032126 Bacteria 3963
483 Ga0373950_0069176 3300034818 Bacteria 721
484 Ga0373926_0089464 3300035083 Unclassified 1144
485 Ga0373934_0008335 3300035086 Bacteria 3862
486 Ga0373951_0034184 3300035091 Bacteria 1207
487 Ga0373952_0143137 3300035092 Bacteria 665
488 Ga0373923_0016388 3300035111 Bacteria 2815
489 Ga0373939_0126769 3300035114 Bacteria 907
490 Ga0373941_0127432 3300035115 Bacteria 914
491 Ga0373953_0084925 3300035117 Bacteria 1320
492 Ga0373953_0153450 3300035117 Bacteria 988
493 Ga0373954_0007248 3300035118 Bacteria 4846
494 Ga0373954_0072344 3300035118 Unclassified 1640
495 Ga0373954_0215376 3300035118 Bacteria 944
496 Ga0373956_0017254 3300035119 Bacteria 3042
497 Ga0373956_0136809 3300035119 Bacteria 1149
498 Ga0373957_0041105 3300035120 Bacteria 1740
499 Ga0373960_0222256 3300035121 Bacteria 676
500 Ga0373955_0027857 3300035172 Bacteria 2925
501 Ga0373955_0028275 3300035172 Bacteria 2906
502 Ga0373942_0121594 3300035207 Bacteria 816
503 Ga0373961_0030242 3300035241 Bacteria 1505
504 Ga0373961_0047742 3300035241 Bacteria 1259
505 Ga0373962_0020288 3300035242 Bacteria 1745
506 Ga0316574_0152641 3300035398 Bacteria 1488
507 Ga0373931_0348150 3300035691 Bacteria 927
508 Ga0373931_0945890 3300035691 Bacteria 581
509 Ga0373935_0363942 3300035692 Unclassified 1033
510 Ga0373935_0670215 3300035692 Bacteria 762
511 Ga0373927_0009413 3300035695 Bacteria 6549
512 Ga0373933_0005773 3300035724 Bacteria 6730
513 Ga0373933_0593546 3300035724 Unclassified 727
514 Ga0373947_0679469 3300035725 Unclassified 702
515 Ga0373937_0005093 3300036401 Bacteria 11193
516 Ga0373937_0013966 3300036401 Bacteria 7081
517 Ga0373937_0042712 3300036401 Bacteria 4136
518 Ga0373937_0421800 3300036401 Bacteria 1266
519 Ga0373925_0004597 3300037068 Bacteria 10425
520 Ga0395905_0892128 3300037471 Unclassified 792
521 Ga0436364_0554668 3300037853 Bacteria 1347
522 Ga0436364_0734541 3300037853 Unclassified 855
523 Ga0395901_0400683 3300038443 Bacteria 1410
524 Ga0436365_1273222 3300039437 Bacteria 1260
525 Ga0436360_0185284 3300039438 Bacteria 642
526 Ga0436363_0656068 3300039450 Bacteria 709
527 Ga0436362_0545667 3300039453 Bacteria 741
528 Ga0450892_011169 3300042130 Bacteria 794
529 Ga0466969_0546784 3300044656 Bacteria 530
530 Ga0466963_0073695 3300044694 Bacteria 2302
531 Ga0466963_0220091 3300044694 Bacteria 1329
532 Ga0466963_1079694 3300044694 Bacteria 565
533 Ga0453684_0168859 3300044712 Bacteria 2580
534 Ga0453684_0403966 3300044712 Bacteria 1529
535 Ga0466971_0295742 3300044719 Bacteria 777
536 Ga0451576_0010167 3300045051 Bacteria 10826
537 Ga0451576_0140183 3300045051 Bacteria 2521
538 Ga0451576_0195868 3300045051 Bacteria 2111
539 Ga0466958_0449299 3300045836 Bacteria 834
540 Ga0466967_0904638 3300045976 Bacteria 878
541 Ga0466967_1019322 3300045976 Bacteria 824
542 Ga0495651_0408596 3300046462 Unclassified 885
543 Ga0495580_0041413 3300046472 Bacteria 3285
544 Ga0495580_0099975 3300046472 Bacteria 2018
545 Ga0495580_0109399 3300046472 Unclassified 1919
546 Ga0495580_0583150 3300046472 Bacteria 740
547 Ga0495582_0165921 3300046473 Bacteria 1257
548 Ga0495639_0052120 3300046475 Bacteria 1862
549 Ga0495639_0303401 3300046475 Bacteria 796
550 Ga0495639_0338509 3300046475 Bacteria 754
551 Ga0495664_0021797 3300046477 Bacteria 3703
552 Ga0495664_0562807 3300046477 Bacteria 679
553 Ga0495594_0037796 3300046499 Bacteria 2635
554 Ga0495594_0506302 3300046499 Bacteria 686
555 Ga0495583_0001490 3300046506 Bacteria 23383
556 Ga0495616_0000052 3300046513 Bacteria 105258
557 Ga0495644_0084097 3300046523 Bacteria 1200
558 Ga0495666_0216955 3300046526 Unclassified 877
559 Ga0495666_0325342 3300046526 Bacteria 694
560 Ga0495642_0070762 3300046528 Bacteria 1459
561 Ga0495665_0126790 3300046531 Unclassified 1337
562 Ga0495640_0910802 3300046533 Bacteria 521
563 Ga0495586_0051345 3300046535 Bacteria 2232
564 Ga0495587_0004500 3300046536 Bacteria 9167
565 Ga0495645_0260812 3300046543 Unclassified 1147
566 Ga0495622_0085059 3300046557 Bacteria 1455
567 Ga0495667_0094747 3300046559 Bacteria 1933
568 Ga0495667_0283660 3300046559 Unclassified 1051
569 Ga0495634_0343484 3300046642 Bacteria 895
570 Ga0495635_0402641 3300046663 Unclassified 909
571 Ga0495635_1107963 3300046663 Bacteria 501
572 Ga0495661_0265840 3300046665 Bacteria 870
573 Ga0495588_0285101 3300046674 Bacteria 870
574 Ga0495599_0018035 3300046678 Bacteria 4396
575 Ga0495599_0272627 3300046678 Bacteria 1026
576 Ga0495623_0092986 3300046679 Bacteria 1847
577 Ga0495658_0011920 3300046683 Bacteria 4387
578 Ga0495669_0120404 3300046684 Unclassified 1229
579 Ga0495613_0020938 3300046689 Unclassified 4875
580 Ga0495581_0195292 3300047315 Bacteria 1184
581 Ga0495581_0685758 3300047315 Bacteria 591
582 Ga0495672_0139927 3300047320 Bacteria 1265
583 Ga0495676_0089042 3300047321 Bacteria 2313
584 Ga0495675_0248160 3300047444 Unclassified 1070
585 Ga0495684_0015924 3300047471 Bacteria 5790
586 Ga0495684_0267778 3300047471 Bacteria 1237
587 Ga0495593_0369317 3300047673 Bacteria 717
588 Ga0495602_0018650 3300048088 Bacteria 6919
589 Ga0495602_0847413 3300048088 Unclassified 611
590 Ga0496102_1440366 3300048905 Bacteria 608
591 Ga0496105_0796363 3300048908 Bacteria 719
592 Ga0496108_0764114 3300048911 Unclassified 835
593 Ga0496110_0494874 3300048913 Bacteria 1113
594 Ga0496112_0070738 3300048915 Bacteria 3448
595 Ga0496113_0832402 3300048916 Bacteria 732
596 Ga0501031_0135524 3300049568 Bacteria 1609
597 Ga0501032_0051985 3300049569 Bacteria 2761
598 Ga0501032_0286662 3300049569 Bacteria 1066
599 Ga0501034_0001743 3300049571 Bacteria 27930
600 Ga0501034_0196594 3300049571 Bacteria 1976
601 Ga0501034_0452596 3300049571 Bacteria 1201
602 Ga0501034_0508925 3300049571 Bacteria 1117
603 Ga0501036_0138758 3300049572 Bacteria 2052
604 Ga0501036_0224349 3300049572 Bacteria 1577
605 Ga0501036_0441647 3300049572 Bacteria 1084
606 Ga0501036_0559425 3300049572 Bacteria 950
607 Ga0501037_0016011 3300049573 Bacteria 5519
608 Ga0501038_0030026 3300049574 Bacteria 4812
609 Ga0501038_0196569 3300049574 Bacteria 1621
610 Ga0501038_0343541 3300049574 Bacteria 1164
611 Ga0501039_0154512 3300049575 Bacteria 1802
612 Ga0501040_0094397 3300049576 Bacteria 2081
613 Ga0501040_0913112 3300049576 Bacteria 636
614 Ga0501041_0004134 3300049577 Bacteria 8394
615 Ga0501042_0089593 3300049578 Bacteria 2207
616 Ga0501042_0137773 3300049578 Bacteria 1759
617 Ga0501043_0263761 3300049579 Bacteria 1324
618 Ga0501046_0030891 3300049580 Bacteria 4347
619 Ga0501046_0080812 3300049580 Bacteria 2511
620 Ga0501048_0027920 3300049582 Bacteria 4099
621 Ga0501072_0372612 3300049588 Bacteria 1133
622 Ga0501074_1221780 3300049590 Bacteria 527
623 Ga0501076_0429872 3300049592 Bacteria 1087
624 Ga0501076_0588690 3300049592 Bacteria 918
625 Ga0501035_0095550 3300049822 Bacteria 2613
626 Ga0501044_0080560 3300049823 Bacteria 3298
627 Ga0501045_0062890 3300049824 Bacteria 2724
628 nmdc:mga05p37_304355_c1 3300050507 Bacteria 1892
629 nmdc:mga05p37_430673_c1 3300050507 Bacteria 1533
630 nmdc:mga09592_534786_c1 3300050508 Bacteria 1007
631 nmdc:mga09592_83674_c1 3300050508 Bacteria 2720
632 nmdc:mga0qj67_121976_c1 3300050509 Bacteria 2109
633 nmdc:mga06r32_1560907_c1 3300050510 Bacteria 599
634 nmdc:mga06r32_545562_c1 3300050510 Bacteria 1134
635 nmdc:mga0n895_1187033_c1 3300050512 Bacteria 738
636 nmdc:mga0n895_518697_c1 3300050512 Bacteria 1199
637 nmdc:mga0n895_779298_c1 3300050512 Bacteria 948
638 nmdc:mga0rr50_113900_c1 3300050513 Bacteria 2144
639 nmdc:mga0rr50_1434693_c1 3300050513 Bacteria 584
640 nmdc:mga08x19_24522_c1 3300050514 Bacteria 3750
641 nmdc:mga08x19_340732_c1 3300050514 Bacteria 1046
642 nmdc:mga08x19_465306_c1 3300050514 Bacteria 891
643 nmdc:mga0a205_282059_c1 3300050515 Bacteria 1537
644 nmdc:mga0a205_370118_c1 3300050515 Bacteria 1299
645 nmdc:mga0a205_372452_c1 3300050515 Bacteria 1294
646 Ga0495601_0114064 3300053077 Bacteria 1752
647 Ga0500610_0168504 3300053079 Bacteria 1083
648 Ga0495619_0087652 3300053085 Bacteria 2105
649 Ga0500568_0004567 3300053139 Bacteria 7376
650 Ga0500588_0002110 3300053146 Bacteria 3966
651 Ga0590077_025435 3300059426 Bacteria 1275
652 Ga0587091_045462 3300059511 Bacteria 882
653 Ga0501082_0014633 3300060353 Bacteria 6758
654 Ga0501082_0617910 3300060353 Bacteria 948
655 Ga0501082_1595733 3300060353 Unclassified 570
656 Ga0530510_0370084 3300061734 Bacteria 1078
657 2644504734 2643221690 Bacteria 4654705
658 2644523799 2643221694 Bacteria 4392972
659 2644667902 2643221722 Bacteria 4247614
660 2738891698 2738541308 Bacteria 7020677
661 2884998029 2884994152 Bacteria 4492978
662 2904540502 2904535858 Bacteria 6308016
663 2922554586 2922554459 Bacteria 6683962
664 Ga0070683_100000021
665 JGI24737J22298_10041369
666 JGI24737J22298_10063507
667 JGI26129J50193_1011067
668 JGI26145J50221_1009917
669 JGI26140J50224_103035
670 JGI26132J50249_103724
671 Ga0058859_11339659
672 Ga0058863_11743129
673 Ga0058863_11832152
674 Ga0058861_11780872
675 Ga0058861_11963446
676 Ga0058862_10044972
677 Ga0058862_12467854
678 Ga0065704_10002476
679 Ga0065715_10135584
680 Ga0065715_10345873
681 Ga0065707_10000857
682 Ga0070658_10096023
683 Ga0070658_11348470
684 Ga0070676_10003115
685 Ga0070683_100171746
686 Ga0070683_100278793
687 Ga0070683_100843253
688 Ga0070683_102092428
689 Ga0070690_100000268
690 Ga0070690_100037489
691 Ga0070670_100091760
692 Ga0070677_10086894
693 Ga0068869_100005060
694 Ga0068869_100225946
695 Ga0070666_10422093
696 Ga0070680_100002000
697 Ga0070680_100019458
698 Ga0070680_100252525
699 Ga0070682_100029799
700 Ga0070682_100151621
701 Ga0070682_100569177
702 Ga0070682_100763938
703 Ga0068868_100236063
704 Ga0068868_100478961
705 Ga0070660_100016427
706 Ga0070660_100071120
707 Ga0070660_100093622
708 Ga0070660_100513213
709 Ga0070689_100002609
710 Ga0070689_100029993
711 Ga0070691_10001292
712 Ga0070691_10001592
713 Ga0070687_100000783
714 Ga0070687_100005963
715 Ga0070661_100003521
716 Ga0070661_100179870
717 Ga0070661_100287843
718 Ga0070692_10028675
719 Ga0070692_10146811
720 Ga0070669_100026870
721 Ga0070675_100378547
722 Ga0070674_100000520
723 Ga0070673_100023468
724 Ga0070673_100050153
725 Ga0070673_101069897
726 Ga0070688_100165217
727 Ga0070659_100006309
728 Ga0070659_100519673
729 Ga0070659_101367667
730 Ga0070667_100019748
731 Ga0070709_10000446
732 Ga0070709_10103967
733 Ga0070714_100084975
734 Ga0070713_100000119
735 Ga0070713_100037766
736 Ga0070713_100081644
737 Ga0070713_100112676
738 Ga0070701_10040066
739 Ga0070705_100011725
740 Ga0070705_100665889
741 Ga0070705_100787914
742 Ga0070700_100009053
743 Ga0070694_100004334
744 Ga0070694_100997978
745 Ga0070708_100099360
746 Ga0070708_100181989
747 Ga0070708_100734093
748 Ga0070708_100872686
749 Ga0070663_100131927
750 Ga0070678_100001247
751 Ga0070678_100503584
752 Ga0070662_100005166
753 Ga0070681_10000620
754 Ga0070681_10009638
755 Ga0070681_10019215
756 Ga0070681_10107327
757 Ga0070681_10312791
758 Ga0068867_100005610
759 Ga0068867_100178052
760 Ga0068867_100418315
761 Ga0070685_10183190
762 Ga0070706_100059639
763 Ga0070706_101172685
764 Ga0070707_100430453
765 Ga0070707_101330521
766 Ga0070698_100028842
767 Ga0070698_100045369
768 Ga0070698_100075085
769 Ga0070698_100245076
770 Ga0070698_101640205
771 Ga0070699_100552735
772 Ga0070679_100219983
773 Ga0070679_100376790
774 Ga0070679_100486531
775 Ga0070679_100563874
776 Ga0070684_100000010
777 Ga0070684_100002249
778 Ga0070684_100059170
779 Ga0070684_100095828
780 Ga0070684_100231042
781 Ga0070684_100394102
782 Ga0070697_100775234
783 Ga0070697_100882186
784 Ga0068853_100238808
785 Ga0068853_100620080
786 Ga0068853_101225605
787 Ga0070672_100144046
788 Ga0070672_100546422
789 Ga0070686_101201915
790 Ga0070695_100578869
791 Ga0070696_100009062
792 Ga0070693_100018568
793 Ga0070665_100934437
794 Ga0068855_100022011
795 Ga0068855_100063798
796 Ga0068855_100089631
797 Ga0068855_100166440
798 Ga0068855_100538888
799 Ga0068855_100937511
800 Ga0070664_100000380
801 Ga0070664_100030439
802 Ga0070664_100098344
803 Ga0068857_100004222
804 Ga0068857_100024493
805 Ga0068857_100060242
806 Ga0068854_100203646
807 Ga0068854_100378044
808 Ga0068856_100002664
809 Ga0068856_100061759
810 Ga0068856_100067035
811 Ga0070702_100011191
812 Ga0068852_100005315
813 Ga0068852_100280835
814 Ga0068852_101910032
815 Ga0068859_100097634
816 Ga0068859_101309344
817 Ga0068859_102690961
818 Ga0068864_100064625
819 Ga0068864_100210194
820 Ga0068866_10023635
821 Ga0068866_10119946
822 Ga0068861_100244087
823 Ga0068870_10039853
824 Ga0068863_100031444
825 Ga0068863_100032933
826 Ga0068863_100411252
827 Ga0068858_100660396
828 Ga0068858_100787752
829 Ga0068860_100044664
830 Ga0068860_100190520
831 Ga0068860_100348259
832 Ga0068862_100006593
833 Ga0068862_102539230
834 Ga0081455_10000467
835 Ga0081539_10022429
836 Ga0070717_10461729
837 Ga0070717_10568349
838 Ga0070717_11032229
839 Ga0075432_10254486
840 Ga0070716_100006709
841 Ga0070712_100097073
842 Ga0070712_100303909
843 Ga0070712_100306663
844 Ga0097621_100004949
845 Ga0097621_100028674
846 Ga0097621_100041784
847 Ga0097621_100080090
848 Ga0097621_100780780
849 Ga0068871_100068500
850 Ga0068871_100132439
851 Ga0068871_100230371
852 Ga0068871_100266392
853 Ga0075428_100027839
854 Ga0075428_100063824
855 Ga0075428_102755259
856 Ga0075430_100006368
857 Ga0075431_100544845
858 Ga0075431_101374684
859 Ga0075433_10051179
860 Ga0075433_10244867
861 Ga0075433_10329276
862 Ga0075434_100014412
863 Ga0075434_100740804
864 Ga0075434_100837957
865 Ga0075429_100170849
866 Ga0068865_100000901
867 Ga0068865_100011465
868 Ga0068865_100383393
869 Ga0075436_100008785
870 Ga0075436_100024972
871 Ga0075436_100029683
872 Ga0075436_100209701
873 Ga0097620_100097636
874 Ga0097620_101309331
875 Ga0097620_102690949
876 Ga0075435_100006218
877 Ga0075435_100308306
878 Ga0075435_100311751
879 Ga0105240_10002166
880 Ga0105240_10002863
881 Ga0105240_10026522
882 Ga0105240_10084344
883 Ga0105240_10237016
884 Ga0105240_10403707
885 Ga0105240_12251099
886 Ga0105245_10001350
887 Ga0105245_10002469
888 Ga0105245_10006512
889 Ga0105245_10020657
890 Ga0105245_10813560
891 Ga0105245_10956278
892 Ga0114129_10025566
893 Ga0114129_10393390
894 Ga0105243_10001764
895 Ga0105243_10110049
896 Ga0105241_10009108
897 Ga0105241_10174222
898 Ga0105241_12699648
899 Ga0105242_10000591
900 Ga0105242_10044445
901 Ga0105248_10009114
902 Ga0105248_10592118
903 Ga0105248_10642383
904 Ga0105248_10680515
905 Ga0105237_10003660
906 Ga0105237_10016708
907 Ga0105237_10046896
908 Ga0105237_10049472
909 Ga0105237_10747605
910 Ga0105237_10830533
911 Ga0105238_10001548
912 Ga0105238_10012626
913 Ga0105238_10045208
914 Ga0105238_10088746
915 Ga0105238_10392837
916 Ga0105238_10475721
917 Ga0105238_10899890
918 Ga0105249_10009114
919 Ga0105249_10031987
920 Ga0105249_10446601
921 Ga0105239_10001360
922 Ga0105239_10031962
923 Ga0105239_10772143
924 Ga0105239_11044522
925 Ga0105239_12266945
926 Ga0105239_12333011
927 Ga0105246_10006006
928 Ga0105246_10589562
929 Ga0105246_10884147
930 Ga0157373_10805440
931 Ga0157371_10028863
932 Ga0157371_10292981
933 Ga0157371_11252142
934 Ga0157370_10002156
935 Ga0157370_10003135
936 Ga0157370_11443583
937 Ga0157369_10002061
938 Ga0157369_10041393
939 Ga0157369_10043843
940 Ga0157369_10133531
941 Ga0157369_10772179
942 Ga0157374_10023423
943 Ga0157374_10488182
944 Ga0157374_10808073
945 Ga0157374_11041667
946 Ga0157374_12048158
947 Ga0157378_10006880
948 Ga0157378_10009658
949 Ga0157378_10441241
950 Ga0163162_10080451
951 Ga0157372_10001346
952 Ga0157372_10075021
953 Ga0157372_10172665
954 Ga0157372_10885438
955 Ga0157375_10005249
956 Ga0157375_11099400
957 Ga0163163_10098198
958 Ga0163163_10463395
959 Ga0163163_11219624
960 Ga0163163_12079659
961 Ga0157377_10009609
962 Ga0157377_10432758
963 Ga0157376_10000259
964 Ga0157376_10079002
965 Ga0157376_12069781
966 Ga0206350_11324736
967 Ga0154015_1114426
968 Ga0213874_10022611
969 Ga0213875_10176345
970 Ga0224712_10471472
971 Ga0224712_10582567
972 Ga0207697_10031828
973 Ga0207653_10254284
974 Ga0207682_10002726
975 Ga0207692_10218341
976 Ga0207692_10494371
977 Ga0207642_10092105
978 Ga0207642_10131168
979 Ga0207688_10148017
980 Ga0207680_10348744
981 Ga0207647_10296051
982 Ga0207685_10144086
983 Ga0207699_10000052
984 Ga0207699_10106417
985 Ga0207643_10115445
986 Ga0207654_10147456
987 Ga0207654_10181276
988 Ga0207707_10002949
989 Ga0207707_10011102
990 Ga0207707_10055585
991 Ga0207707_10156659
992 Ga0207707_10192865
993 Ga0207695_10001934
994 Ga0207695_10041163
995 Ga0207695_10264896
996 Ga0207695_10313549
997 Ga0207695_10550595
998 Ga0207671_10009483
999 Ga0207671_10043940
1000 Ga0207671_11251149
1001 Ga0207693_10215036
1002 Ga0207693_10343291
1003 Ga0207693_10488511
1004 Ga0207663_10029621
1005 Ga0207663_10343689
1006 Ga0207663_10440638
1007 Ga0207660_10002657
1008 Ga0207660_11178064
1009 Ga0207662_10017270
1010 Ga0207662_10550822
1011 Ga0207657_10019164
1012 Ga0207657_10079047
1013 Ga0207657_10740474
1014 Ga0207649_10051218
1015 Ga0207649_10058054
1016 Ga0207652_10066392
1017 Ga0207652_10278803
1018 Ga0207652_10316666
1019 Ga0207652_10411802
1020 Ga0207681_10002340
1021 Ga0207694_10002139
1022 Ga0207694_10005306
1023 Ga0207694_10059787
1024 Ga0207694_10156616
1025 Ga0207650_10006151
1026 Ga0207659_10079042
1027 Ga0207687_10001423
1028 Ga0207687_10002581
1029 Ga0207687_10076690
1030 Ga0207687_10999063
1031 Ga0207700_10000157
1032 Ga0207700_10061976
1033 Ga0207700_10823734
1034 Ga0207664_10128174
1035 Ga0207664_11975457
1036 Ga0207644_11670231
1037 Ga0207690_10002281
1038 Ga0207690_10519057
1039 Ga0207690_10889237
1040 Ga0207706_10000184
1041 Ga0207686_10009700
1042 Ga0207686_10010882
1043 Ga0207686_10028047
1044 Ga0207709_10027936
1045 Ga0207670_10026060
1046 Ga0207670_10080485
1047 Ga0207669_10001788
1048 Ga0207704_10002453
1049 Ga0207704_10023162
1050 Ga0207704_10562023
1051 Ga0207665_10008069
1052 Ga0207691_10000363
1053 Ga0207691_10084864
1054 Ga0207711_10000207
1055 Ga0207711_10372212
1056 Ga0207689_10001295
1057 Ga0207689_10092565
1058 Ga0207689_10522190
1059 Ga0207689_11788936
1060 Ga0207661_10000012
1061 Ga0207661_10011885
1062 Ga0207661_10030806
1063 Ga0207661_10066271
1064 Ga0207661_10107997
1065 Ga0207661_10144249
1066 Ga0207661_10867075
1067 Ga0207661_11002976
1068 Ga0207679_10003923
1069 Ga0207679_10099343
1070 Ga0207679_10245577
1071 Ga0207667_10001595
1072 Ga0207667_10094741
1073 Ga0207667_10135983
1074 Ga0207667_10308325
1075 Ga0207651_10040083
1076 Ga0207651_10096835
1077 Ga0207651_10763399
1078 Ga0207712_10083256
1079 Ga0207712_11080439
1080 Ga0207668_10161232
1081 Ga0207640_10145241
1082 Ga0207640_10628720
1083 Ga0207677_10456913
1084 Ga0207703_10006549
1085 Ga0207639_10213501
1086 Ga0207639_10714151
1087 Ga0207708_10000065
1088 Ga0207708_11938961
1089 Ga0207702_10021106
1090 Ga0207702_10636608
1091 Ga0207641_10120727
1092 Ga0207641_10261389
1093 Ga0207641_10528238
1094 Ga0207648_10011163
1095 Ga0207648_10035852
1096 Ga0207648_10617323
1097 Ga0207676_10156406
1098 Ga0207676_10208950
1099 Ga0207674_10000252
1100 Ga0207674_10013086
1101 Ga0207674_10029239
1102 Ga0207675_100313523
1103 Ga0207683_10004783
1104 Ga0207683_10204534
1105 Ga0207683_10834414
1106 Ga0207698_10008263
1107 Ga0207698_10337238
1108 Ga0209973_1025202
1109 Ga0209969_1000054
1110 Ga0209967_1000181
1111 Ga0209996_1000076
1112 Ga0209984_1006776
1113 Ga0210000_1000116
1114 Ga0209995_1000217
1115 Ga0209968_1000149
1116 Ga0209999_1043780
1117 Ga0209982_1000358
1118 Ga0210002_1000112
1119 Ga0209971_1000040
1120 Ga0209966_1000051
1121 Ga0209998_10001705
1122 Ga0209974_10005576
1123 Ga0207428_10003293
1124 Ga0268266_11161225
1125 Ga0268265_10153778
1126 Ga0268265_12215496
1127 Ga0268264_10107900
1128 Ga0268264_10268982
1129 Ga0268264_10840444
1130 Ga0265337_1098683
1131 Ga0265338_10129452
1132 Ga0265338_10323957
1133 Ga0265330_10275972
1134 Ga0265320_10227803
1135 Ga0265340_10008036
1136 Ga0265313_10009430
1137 Ga0265314_10002846
1138 Ga0316576_10000227
1139 Ga0307405_11180987
1140 Ga0307407_10607919
1141 Ga0307409_100182390
1142 Ga0307409_100421917
1143 Ga0307416_101440605
1144 Ga0307416_102903002
1145 Ga0307415_100021552
1146 Ga0373950_0069176
1147 Ga0373926_0089464
1148 Ga0373934_0008335
1149 Ga0373951_0034184
1150 Ga0373952_0143137
1151 Ga0373923_0016388
1152 Ga0373939_0126769
1153 Ga0373941_0127432
1154 Ga0373953_0084925
1155 Ga0373953_0153450
1156 Ga0373954_0007248
1157 Ga0373954_0072344
1158 Ga0373954_0215376
1159 Ga0373956_0017254
1160 Ga0373956_0136809
1161 Ga0373957_0041105
1162 Ga0373960_0222256
1163 Ga0373955_0027857
1164 Ga0373955_0028275
1165 Ga0373942_0121594
1166 Ga0373961_0030242
1167 Ga0373961_0047742
1168 Ga0373962_0020288
1169 Ga0316574_0152641
1170 Ga0373931_0348150
1171 Ga0373931_0945890
1172 Ga0373935_0363942
1173 Ga0373935_0670215
1174 Ga0373927_0009413
1175 Ga0373933_0005773
1176 Ga0373933_0593546
1177 Ga0373947_0679469
1178 Ga0373937_0005093
1179 Ga0373937_0013966
1180 Ga0373937_0042712
1181 Ga0373937_0421800
1182 Ga0373925_0004597
1183 Ga0395905_0892128
1184 Ga0436364_0554668
1185 Ga0436364_0734541
1186 Ga0395901_0400683
1187 Ga0436365_1273222
1188 Ga0436360_0185284
1189 Ga0436363_0656068
1190 Ga0436362_0545667
1191 Ga0450892_011169
1192 Ga0466969_0546784
1193 Ga0466963_0073695
1194 Ga0466963_0220091
1195 Ga0466963_1079694
1196 Ga0453684_0168859
1197 Ga0453684_0403966
1198 Ga0466971_0295742
1199 Ga0451576_0010167
1200 Ga0451576_0140183
1201 Ga0451576_0195868
1202 Ga0466958_0449299
1203 Ga0466967_0904638
1204 Ga0466967_1019322
1205 Ga0495651_0408596
1206 Ga0495580_0041413
1207 Ga0495580_0099975
1208 Ga0495580_0109399
1209 Ga0495580_0583150
1210 Ga0495582_0165921
1211 Ga0495639_0052120
1212 Ga0495639_0303401
1213 Ga0495639_0338509
1214 Ga0495664_0021797
1215 Ga0495664_0562807
1216 Ga0495594_0037796
1217 Ga0495594_0506302
1218 Ga0495583_0001490
1219 Ga0495616_0000052
1220 Ga0495644_0084097
1221 Ga0495666_0216955
1222 Ga0495666_0325342
1223 Ga0495642_0070762
1224 Ga0495665_0126790
1225 Ga0495640_0910802
1226 Ga0495586_0051345
1227 Ga0495587_0004500
1228 Ga0495645_0260812
1229 Ga0495622_0085059
1230 Ga0495667_0094747
1231 Ga0495667_0283660
1232 Ga0495634_0343484
1233 Ga0495635_0402641
1234 Ga0495635_1107963
1235 Ga0495661_0265840
1236 Ga0495588_0285101
1237 Ga0495599_0018035
1238 Ga0495599_0272627
1239 Ga0495623_0092986
1240 Ga0495658_0011920
1241 Ga0495669_0120404
1242 Ga0495613_0020938
1243 Ga0495581_0195292
1244 Ga0495581_0685758
1245 Ga0495672_0139927
1246 Ga0495676_0089042
1247 Ga0495675_0248160
1248 Ga0495684_0015924
1249 Ga0495684_0267778
1250 Ga0495593_0369317
1251 Ga0495602_0018650
1252 Ga0495602_0847413
1253 Ga0496102_1440366
1254 Ga0496105_0796363
1255 Ga0496108_0764114
1256 Ga0496110_0494874
1257 Ga0496112_0070738
1258 Ga0496113_0832402
1259 Ga0501031_0135524
1260 Ga0501032_0051985
1261 Ga0501032_0286662
1262 Ga0501034_0001743
1263 Ga0501034_0196594
1264 Ga0501034_0452596
1265 Ga0501034_0508925
1266 Ga0501036_0138758
1267 Ga0501036_0224349
1268 Ga0501036_0441647
1269 Ga0501036_0559425
1270 Ga0501037_0016011
1271 Ga0501038_0030026
1272 Ga0501038_0196569
1273 Ga0501038_0343541
1274 Ga0501039_0154512
1275 Ga0501040_0094397
1276 Ga0501040_0913112
1277 Ga0501041_0004134
1278 Ga0501042_0089593
1279 Ga0501042_0137773
1280 Ga0501043_0263761
1281 Ga0501046_0030891
1282 Ga0501046_0080812
1283 Ga0501048_0027920
1284 Ga0501072_0372612
1285 Ga0501074_1221780
1286 Ga0501076_0429872
1287 Ga0501076_0588690
1288 Ga0501035_0095550
1289 Ga0501044_0080560
1290 Ga0501045_0062890
1291 nmdc:mga05p37_304355_c1
1292 nmdc:mga05p37_430673_c1
1293 nmdc:mga09592_534786_c1
1294 nmdc:mga09592_83674_c1
1295 nmdc:mga0qj67_121976_c1
1296 nmdc:mga06r32_1560907_c1
1297 nmdc:mga06r32_545562_c1
1298 nmdc:mga0n895_1187033_c1
1299 nmdc:mga0n895_518697_c1
1300 nmdc:mga0n895_779298_c1
1301 nmdc:mga0rr50_113900_c1
1302 nmdc:mga0rr50_1434693_c1
1303 nmdc:mga08x19_24522_c1
1304 nmdc:mga08x19_340732_c1
1305 nmdc:mga08x19_465306_c1
1306 nmdc:mga0a205_282059_c1
1307 nmdc:mga0a205_370118_c1
1308 nmdc:mga0a205_372452_c1
1309 Ga0495601_0114064
1310 Ga0500610_0168504
1311 Ga0495619_0087652
1312 Ga0500568_0004567
1313 Ga0500588_0002110
1314 Ga0590077_025435
1315 Ga0587091_045462
1316 Ga0501082_0014633
1317 Ga0501082_0617910
1318 Ga0501082_1595733
1319 Ga0530510_0370084
1320 2644504734
1321 2644523799
1322 2644667902
1323 2738891698
1324 2884998029
1325 2904540502
1326 2922554586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

68

167

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9891 1 141
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9882 1 141
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9875 1 141
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9843 1 141
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9822 1 141
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9862 1 141 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9794 1 141 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9341 1 140 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9276 1 140 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9251 4 140 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V9ZYP9-F1-model_v4 OsmC family peroxiredoxin 0.9982 1 141 GO:0004601
GO:0006979
AF-W1YUD1-F1-model_v4 Peroxiredoxin osmC 0.9982 1 96 GO:0004601
GO:0006979
AF-A0A6A7S9V2-F1-model_v4 Peroxiredoxin OsmC 0.9977 1 141 GO:0004601
GO:0006979
AF-A0A3M5V3N6-F1-model_v4 Peroxiredoxin OsmC 0.9966 1 141 GO:0004601
GO:0006979
AF-A0A7Y2CT86-F1-model_v4 OsmC family protein 0.9962 1 141 GO:0004601
GO:0006979

Map