F473490

General Info

Members Datasets Scaffolds Average Seq Length
662 382 1324 169

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1276734|Ga0436364_1276734_28156_28737
Length 193
Sequence MTNPYSLRDRTPPRHAFREGIMVAFAKQVEPGRTRESYGRYYEDFTVGDIYEHRPGRTITETDNTWFTLLTMNQHPLHFDKAYAARSEFGRPLVNSCLTLSIVAGMSVSDVSQKAIGNLGWNDIRLTAPVFVGDTIYAESEVLAKRESAKRPTQGIVTVRTTGKKAGGTVFMTYERTVLIPKRGHAVDDVAGY

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
227 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
362 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
371 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
380 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
381 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
382 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 0.15
Rhizoplane 5.29
Rhizosphere 83.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1276734 3300037853 Bacteria 28890
2 JGI25406J46586_10028754 3300003203 Bacteria 2114
3 Ga0065712_10365520 3300005290 Bacteria 769
4 Ga0065712_10522466 3300005290 Bacteria 635
5 Ga0070658_11142887 3300005327 Bacteria 677
6 Ga0070676_10296496 3300005328 Bacteria 1095
7 Ga0070683_100910601 3300005329 Bacteria 844
8 Ga0070690_100014464 3300005330 Bacteria 4682
9 Ga0070670_100074607 3300005331 Bacteria 2914
10 Ga0070670_100299223 3300005331 Bacteria 1407
11 Ga0070677_10024106 3300005333 Bacteria 2259
12 Ga0068869_100829822 3300005334 Bacteria 796
13 Ga0070680_100012727 3300005336 Bacteria 6540
14 Ga0070680_100078746 3300005336 Bacteria 2716
15 Ga0070680_100285558 3300005336 Bacteria 1398
16 Ga0070680_100386820 3300005336 Bacteria 1191
17 Ga0070682_100015512 3300005337 Bacteria 4416
18 Ga0070682_100184655 3300005337 Bacteria 1459
19 Ga0070682_100834131 3300005337 Bacteria 752
20 Ga0068868_100587012 3300005338 Bacteria 986
21 Ga0070660_100455917 3300005339 Bacteria 1061
22 Ga0070660_101007569 3300005339 Bacteria 704
23 Ga0070689_100062442 3300005340 Bacteria 2899
24 Ga0070689_100165947 3300005340 Bacteria 1787
25 Ga0070691_10086235 3300005341 Bacteria 1543
26 Ga0070687_100026938 3300005343 Bacteria 2772
27 Ga0070687_100103086 3300005343 Bacteria 1601
28 Ga0070661_100141526 3300005344 Bacteria 1813
29 Ga0070661_100150701 3300005344 Bacteria 1758
30 Ga0070692_10122910 3300005345 Bacteria 1450
31 Ga0070669_100285438 3300005353 Bacteria 1324
32 Ga0070675_100062403 3300005354 Bacteria 3079
33 Ga0070675_100133383 3300005354 Bacteria 2118
34 Ga0070671_100050357 3300005355 Bacteria 3464
35 Ga0070671_100084127 3300005355 Bacteria 2661
36 Ga0070674_100152370 3300005356 Bacteria 1746
37 Ga0070674_100316809 3300005356 Bacteria 1249
38 Ga0070673_100242029 3300005364 Bacteria 1569
39 Ga0070659_100557151 3300005366 Bacteria 982
40 Ga0070659_101028507 3300005366 Bacteria 724
41 Ga0070667_100017222 3300005367 Bacteria 5985
42 Ga0070667_100653932 3300005367 Bacteria 970
43 Ga0070709_10445532 3300005434 Bacteria 974
44 Ga0070714_100073284 3300005435 Bacteria 2967
45 Ga0070714_100247326 3300005435 Bacteria 1648
46 Ga0070713_100011150 3300005436 Bacteria 6534
47 Ga0070713_100343699 3300005436 Bacteria 1383
48 Ga0070713_100438906 3300005436 Bacteria 1224
49 Ga0070713_100634738 3300005436 Bacteria 1016
50 Ga0070710_10094451 3300005437 Bacteria 1770
51 Ga0070701_10002123 3300005438 Bacteria 7547
52 Ga0070711_100031278 3300005439 Bacteria 3532
53 Ga0070700_100101526 3300005441 Bacteria 1896
54 Ga0070694_100058943 3300005444 Bacteria 2613
55 Ga0070708_100133908 3300005445 Bacteria 2295
56 Ga0070663_100045640 3300005455 Bacteria 3097
57 Ga0070663_100057851 3300005455 Bacteria 2783
58 Ga0070678_100130261 3300005456 Bacteria 1997
59 Ga0070678_101020129 3300005456 Bacteria 761
60 Ga0070662_100275350 3300005457 Bacteria 1360
61 Ga0070681_10010354 3300005458 Bacteria 9207
62 Ga0070681_10057549 3300005458 Bacteria 3868
63 Ga0070681_10291967 3300005458 Bacteria 1540
64 Ga0068867_100045588 3300005459 Bacteria 3217
65 Ga0070685_10329828 3300005466 Bacteria 1037
66 Ga0070707_100004904 3300005468 Bacteria 12540
67 Ga0070698_100294887 3300005471 Bacteria 1553
68 Ga0070699_100165430 3300005518 Bacteria 1959
69 Ga0070679_100020905 3300005530 Bacteria 6385
70 Ga0070679_100132812 3300005530 Bacteria 2470
71 Ga0070684_100001434 3300005535 Bacteria 17187
72 Ga0070684_100009099 3300005535 Bacteria 7809
73 Ga0070684_100327652 3300005535 Bacteria 1407
74 Ga0070697_100300213 3300005536 Bacteria 1380
75 Ga0068853_100039638 3300005539 Bacteria 4018
76 Ga0068853_100062324 3300005539 Bacteria 3227
77 Ga0068853_101311508 3300005539 Bacteria 700
78 Ga0070672_100072328 3300005543 Bacteria 2745
79 Ga0070672_101127206 3300005543 Bacteria 698
80 Ga0070686_100031021 3300005544 Bacteria 3265
81 Ga0070686_100102130 3300005544 Bacteria 1939
82 Ga0070693_100107397 3300005547 Bacteria 1711
83 Ga0070693_100181618 3300005547 Bacteria 1355
84 Ga0070693_100691422 3300005547 Bacteria 746
85 Ga0070665_100003223 3300005548 Bacteria 17537
86 Ga0070665_100482517 3300005548 Bacteria 1250
87 Ga0070665_100488087 3300005548 Bacteria 1243
88 Ga0070704_100047180 3300005549 Bacteria 3010
89 Ga0068855_100051826 3300005563 Bacteria 4833
90 Ga0068855_100076518 3300005563 Bacteria 3884
91 Ga0068855_101405804 3300005563 Bacteria 719
92 Ga0070664_100030905 3300005564 Bacteria 4470
93 Ga0070664_100947503 3300005564 Bacteria 808
94 Ga0068857_100030995 3300005577 Bacteria 4726
95 Ga0068857_100276524 3300005577 Bacteria 1544
96 Ga0068857_100985186 3300005577 Bacteria 811
97 Ga0068854_100429419 3300005578 Bacteria 1099
98 Ga0068856_100058073 3300005614 Bacteria 3821
99 Ga0068856_100085363 3300005614 Bacteria 3136
100 Ga0068856_100775763 3300005614 Bacteria 978
101 Ga0068852_100433326 3300005616 Bacteria 1299
102 Ga0068852_100807937 3300005616 Bacteria 952
103 Ga0068859_100145053 3300005617 Bacteria 2448
104 Ga0068859_100477007 3300005617 Bacteria 1343
105 Ga0068864_100058973 3300005618 Bacteria 3319
106 Ga0068861_100008855 3300005719 Bacteria 6937
107 Ga0068851_10089022 3300005834 Bacteria 1623
108 Ga0068851_10464455 3300005834 Bacteria 754
109 Ga0068870_10084510 3300005840 Bacteria 1762
110 Ga0068863_100005667 3300005841 Bacteria 12266
111 Ga0068863_100473775 3300005841 Bacteria 1230
112 Ga0068858_100083324 3300005842 Bacteria 2974
113 Ga0068858_100373922 3300005842 Bacteria 1367
114 Ga0068860_100772617 3300005843 Bacteria 973
115 Ga0068862_100028714 3300005844 Bacteria 4684
116 Ga0081455_10097718 3300005937 Bacteria 2365
117 Ga0081455_10107038 3300005937 Bacteria 2230
118 Ga0081455_10389209 3300005937 Bacteria 971
119 Ga0081540_1002238 3300005983 Bacteria 15939
120 Ga0081540_1038959 3300005983 Bacteria 2497
121 Ga0081539_10000455 3300005985 Bacteria 87222
122 Ga0081539_10003048 3300005985 Bacteria 21654
123 Ga0081539_10098355 3300005985 Bacteria 1497
124 Ga0070717_10013290 3300006028 Bacteria 6303
125 Ga0070717_10016909 3300006028 Bacteria 5664
126 Ga0070717_10058515 3300006028 Bacteria 3187
127 Ga0070717_10096115 3300006028 Bacteria 2509
128 Ga0070717_10131231 3300006028 Bacteria 2154
129 Ga0075365_10099573 3300006038 Bacteria 1989
130 Ga0075365_10151263 3300006038 Bacteria 1614
131 Ga0075368_10032366 3300006042 Bacteria 2031
132 Ga0075363_100073330 3300006048 Bacteria 1863
133 Ga0070715_10380421 3300006163 Bacteria 779
134 Ga0070716_100205246 3300006173 Bacteria 1313
135 Ga0075362_10009342 3300006177 Bacteria 3789
136 Ga0075367_10139813 3300006178 Bacteria 1500
137 Ga0075366_10004233 3300006195 Bacteria 7690
138 Ga0075366_10332902 3300006195 Bacteria 931
139 Ga0097621_100053263 3300006237 Bacteria 3298
140 Ga0075370_10014197 3300006353 Bacteria 4244
141 Ga0075428_100001683 3300006844 Bacteria 23566
142 Ga0075428_100773243 3300006844 Bacteria 1021
143 Ga0075428_100806708 3300006844 Bacteria 997
144 Ga0075430_100830723 3300006846 Bacteria 761
145 Ga0075431_100000058 3300006847 Bacteria 61801
146 Ga0075433_10025080 3300006852 Bacteria 5039
147 Ga0075434_100170512 3300006871 Bacteria 2196
148 Ga0075434_100700743 3300006871 Bacteria 1030
149 Ga0075429_100497553 3300006880 Bacteria 1068
150 Ga0075429_101169535 3300006880 Bacteria 672
151 Ga0068865_101206137 3300006881 Bacteria 670
152 Ga0075436_100467771 3300006914 Bacteria 920
153 Ga0075436_100837716 3300006914 Bacteria 686
154 Ga0097620_100145049 3300006931 Bacteria 2448
155 Ga0097620_100477012 3300006931 Bacteria 1343
156 Ga0075435_100046863 3300007076 Bacteria 3469
157 Ga0075435_100160260 3300007076 Bacteria 1895
158 Ga0075435_100689380 3300007076 Bacteria 888
159 Ga0075435_101086866 3300007076 Bacteria 699
160 Ga0099794_10106919 3300007265 Bacteria 1399
161 Ga0099795_10030640 3300007788 Bacteria 1848
162 Ga0099795_10036598 3300007788 Bacteria 1723
163 Ga0099795_10367180 3300007788 Bacteria 647
164 Ga0105240_10013493 3300009093 Bacteria 11220
165 Ga0105240_10024143 3300009093 Bacteria 8024
166 Ga0105240_10056204 3300009093 Bacteria 4925
167 Ga0105240_10343266 3300009093 Bacteria 1696
168 Ga0111539_10004981 3300009094 Bacteria 17278
169 Ga0111539_10008578 3300009094 Bacteria 12978
170 Ga0111539_10178865 3300009094 Bacteria 2478
171 Ga0111539_10370361 3300009094 Bacteria 1667
172 Ga0111539_10816239 3300009094 Bacteria 1085
173 Ga0105245_10027618 3300009098 Bacteria 5001
174 Ga0105245_10343692 3300009098 Bacteria 1476
175 Ga0105245_11323294 3300009098 Bacteria 770
176 Ga0105247_10014162 3300009101 Bacteria 4784
177 Ga0105247_10181258 3300009101 Bacteria 1406
178 Ga0105247_10210156 3300009101 Bacteria 1312
179 Ga0105247_10352099 3300009101 Bacteria 1036
180 Ga0114129_10000046 3300009147 Bacteria 105492
181 Ga0114129_10492444 3300009147 Bacteria 1602
182 Ga0105243_10067816 3300009148 Bacteria 2873
183 Ga0105241_10281323 3300009174 Bacteria 1421
184 Ga0105242_10154845 3300009176 Bacteria 2001
185 Ga0105242_10185731 3300009176 Bacteria 1837
186 Ga0105248_10010145 3300009177 Bacteria 10376
187 Ga0105248_10068430 3300009177 Bacteria 3986
188 Ga0105248_10645107 3300009177 Bacteria 1195
189 Ga0105237_10029909 3300009545 Bacteria 5533
190 Ga0105237_10050019 3300009545 Bacteria 4200
191 Ga0105237_10147853 3300009545 Bacteria 2345
192 Ga0105237_10258788 3300009545 Bacteria 1743
193 Ga0105237_10313795 3300009545 Bacteria 1571
194 Ga0105238_10022782 3300009551 Bacteria 6384
195 Ga0105238_10035640 3300009551 Bacteria 5057
196 Ga0105238_10166479 3300009551 Bacteria 2180
197 Ga0105238_10195510 3300009551 Bacteria 1998
198 Ga0105238_10897458 3300009551 Bacteria 905
199 Ga0105249_10189842 3300009553 Bacteria 2005
200 Ga0099796_10017968 3300010159 Bacteria 2115
201 Ga0099796_10038389 3300010159 Bacteria 1606
202 Ga0105239_10051332 3300010375 Bacteria 4521
203 Ga0105239_10534914 3300010375 Bacteria 1334
204 Ga0105246_10041272 3300011119 Bacteria 3118
205 Ga0105246_10338761 3300011119 Bacteria 1228
206 Ga0105246_10623287 3300011119 Bacteria 935
207 Ga0105246_11481557 3300011119 Bacteria 636
208 Ga0157347_1019173 3300012502 Bacteria 788
209 Ga0157373_10434214 3300013100 Bacteria 944
210 Ga0157373_10630772 3300013100 Bacteria 782
211 Ga0157370_10047437 3300013104 Bacteria 4118
212 Ga0157370_10109687 3300013104 Bacteria 2580
213 Ga0157369_10023618 3300013105 Bacteria 6849
214 Ga0157369_10031413 3300013105 Bacteria 5847
215 Ga0157369_12111400 3300013105 Bacteria 571
216 Ga0157374_10013590 3300013296 Bacteria 7110
217 Ga0157374_10016598 3300013296 Bacteria 6476
218 Ga0157374_11083759 3300013296 Bacteria 821
219 Ga0157378_10324874 3300013297 Bacteria 1496
220 Ga0157378_11105910 3300013297 Bacteria 830
221 Ga0163162_10021008 3300013306 Bacteria 6422
222 Ga0163162_10275481 3300013306 Bacteria 1814
223 Ga0157372_10773489 3300013307 Bacteria 1116
224 Ga0157375_11173169 3300013308 Bacteria 900
225 Ga0163163_10008433 3300014325 Bacteria 9157
226 Ga0163163_10504491 3300014325 Bacteria 1272
227 Ga0163163_10652546 3300014325 Bacteria 1116
228 Ga0157380_10183246 3300014326 Bacteria 1842
229 Ga0157380_10636371 3300014326 Bacteria 1061
230 Ga0182008_10046645 3300014497 Bacteria 2154
231 Ga0157379_10010422 3300014968 Bacteria 8100
232 Ga0157376_10025597 3300014969 Bacteria 4650
233 Ga0157376_11278301 3300014969 Bacteria 763
234 Ga0163161_10640366 3300017792 Bacteria 880
235 Ga0213876_10164988 3300021384 Bacteria 1178
236 Ga0213875_10001665 3300021388 Bacteria 13999
237 Ga0213875_10164385 3300021388 Bacteria 1041
238 Ga0209758_1006814 3300025297 Bacteria 8012
239 Ga0207656_10313119 3300025321 Bacteria 779
240 Ga0207682_10000447 3300025893 Bacteria 19016
241 Ga0207692_10121405 3300025898 Bacteria 1464
242 Ga0207692_10278980 3300025898 Bacteria 1010
243 Ga0207710_10023476 3300025900 Bacteria 2650
244 Ga0207688_10042321 3300025901 Bacteria 2536
245 Ga0207680_10245660 3300025903 Bacteria 1235
246 Ga0207699_10043142 3300025906 Bacteria 2619
247 Ga0207699_10124094 3300025906 Bacteria 1674
248 Ga0207645_10039571 3300025907 Bacteria 3021
249 Ga0207645_10526024 3300025907 Bacteria 801
250 Ga0207643_10344581 3300025908 Bacteria 934
251 Ga0207705_10375727 3300025909 Bacteria 1097
252 Ga0207684_10132051 3300025910 Bacteria 2143
253 Ga0207654_10179477 3300025911 Bacteria 1380
254 Ga0207654_10514174 3300025911 Bacteria 847
255 Ga0207707_10000204 3300025912 Bacteria 63042
256 Ga0207707_10001911 3300025912 Bacteria 18955
257 Ga0207707_10042040 3300025912 Bacteria 3991
258 Ga0207695_10050511 3300025913 Bacteria 4374
259 Ga0207695_10203541 3300025913 Bacteria 1893
260 Ga0207695_10245922 3300025913 Bacteria 1689
261 Ga0207695_10407513 3300025913 Bacteria 1244
262 Ga0207671_10102405 3300025914 Bacteria 2170
263 Ga0207671_10161778 3300025914 Bacteria 1734
264 Ga0207671_10174611 3300025914 Bacteria 1670
265 Ga0207671_10250515 3300025914 Bacteria 1392
266 Ga0207693_10076906 3300025915 Bacteria 2613
267 Ga0207663_10116973 3300025916 Bacteria 1818
268 Ga0207660_10052669 3300025917 Bacteria 2898
269 Ga0207660_10074688 3300025917 Bacteria 2475
270 Ga0207660_10310933 3300025917 Bacteria 1256
271 Ga0207660_10328227 3300025917 Bacteria 1223
272 Ga0207662_10255072 3300025918 Bacteria 1153
273 Ga0207649_10204574 3300025920 Bacteria 1397
274 Ga0207652_10072580 3300025921 Bacteria 2993
275 Ga0207652_10169939 3300025921 Bacteria 1956
276 Ga0207646_10055185 3300025922 Bacteria 3553
277 Ga0207681_11044980 3300025923 Bacteria 686
278 Ga0207694_10015593 3300025924 Bacteria 5731
279 Ga0207694_10048442 3300025924 Bacteria 3288
280 Ga0207650_10038596 3300025925 Bacteria 3489
281 Ga0207659_10089630 3300025926 Bacteria 2294
282 Ga0207659_10153567 3300025926 Bacteria 1800
283 Ga0207687_10167045 3300025927 Bacteria 1694
284 Ga0207687_10282562 3300025927 Bacteria 1331
285 Ga0207700_10097134 3300025928 Bacteria 2341
286 Ga0207700_10196283 3300025928 Bacteria 1698
287 Ga0207700_10255046 3300025928 Bacteria 1500
288 Ga0207664_10194620 3300025929 Bacteria 1747
289 Ga0207664_10200057 3300025929 Bacteria 1724
290 Ga0207664_10288057 3300025929 Bacteria 1443
291 Ga0207664_10473627 3300025929 Bacteria 1120
292 Ga0207664_10935509 3300025929 Bacteria 778
293 Ga0207644_10089551 3300025931 Bacteria 2290
294 Ga0207706_10353749 3300025933 Bacteria 1277
295 Ga0207706_10505521 3300025933 Bacteria 1043
296 Ga0207709_10309953 3300025935 Bacteria 1177
297 Ga0207709_10322879 3300025935 Bacteria 1156
298 Ga0207670_10728915 3300025936 Bacteria 822
299 Ga0207665_10040602 3300025939 Bacteria 3105
300 Ga0207665_10223098 3300025939 Bacteria 1382
301 Ga0207691_10929137 3300025940 Bacteria 727
302 Ga0207711_10010286 3300025941 Bacteria 7770
303 Ga0207711_10038975 3300025941 Bacteria 4040
304 Ga0207689_10016206 3300025942 Bacteria 6312
305 Ga0207689_10697428 3300025942 Bacteria 856
306 Ga0207689_11305720 3300025942 Bacteria 610
307 Ga0207661_10016694 3300025944 Bacteria 5418
308 Ga0207661_10193864 3300025944 Bacteria 1782
309 Ga0207661_10398558 3300025944 Bacteria 1248
310 Ga0207661_11276418 3300025944 Bacteria 675
311 Ga0207661_11663301 3300025944 Bacteria 583
312 Ga0207679_10030697 3300025945 Bacteria 3755
313 Ga0207667_10050188 3300025949 Bacteria 4403
314 Ga0207667_10136884 3300025949 Bacteria 2522
315 Ga0207667_11254957 3300025949 Bacteria 719
316 Ga0207667_11688399 3300025949 Bacteria 600
317 Ga0207651_10422675 3300025960 Bacteria 1138
318 Ga0207712_10145229 3300025961 Bacteria 1825
319 Ga0207712_10605680 3300025961 Bacteria 948
320 Ga0207668_10598843 3300025972 Bacteria 960
321 Ga0207640_10022109 3300025981 Bacteria 3801
322 Ga0207658_10418948 3300025986 Bacteria 1180
323 Ga0207658_11852085 3300025986 Bacteria 550
324 Ga0207677_10013896 3300026023 Bacteria 4680
325 Ga0207677_10634398 3300026023 Bacteria 941
326 Ga0207703_10086536 3300026035 Bacteria 2625
327 Ga0207703_10907071 3300026035 Bacteria 844
328 Ga0207639_10078101 3300026041 Bacteria 2612
329 Ga0207639_10553272 3300026041 Bacteria 1057
330 Ga0207639_10719298 3300026041 Bacteria 927
331 Ga0207639_10720069 3300026041 Bacteria 927
332 Ga0207678_10049678 3300026067 Bacteria 3625
333 Ga0207678_10482706 3300026067 Bacteria 1079
334 Ga0207678_10600816 3300026067 Bacteria 965
335 Ga0207708_10405661 3300026075 Bacteria 1128
336 Ga0207702_10018421 3300026078 Bacteria 5776
337 Ga0207702_10342642 3300026078 Bacteria 1428
338 Ga0207702_10925712 3300026078 Bacteria 864
339 Ga0207641_10010240 3300026088 Bacteria 7712
340 Ga0207641_10568984 3300026088 Bacteria 1107
341 Ga0207648_10020919 3300026089 Bacteria 5891
342 Ga0207676_10046422 3300026095 Bacteria 3361
343 Ga0207676_11153645 3300026095 Bacteria 767
344 Ga0207676_11210930 3300026095 Bacteria 749
345 Ga0207674_10085797 3300026116 Bacteria 3143
346 Ga0207674_10150390 3300026116 Bacteria 2285
347 Ga0207674_10270530 3300026116 Bacteria 1646
348 Ga0207674_10615837 3300026116 Bacteria 1049
349 Ga0207683_10002719 3300026121 Bacteria 15442
350 Ga0207698_10530376 3300026142 Bacteria 1150
351 Ga0209813_10138117 3300027866 Bacteria 863
352 Ga0207428_10004515 3300027907 Bacteria 13203
353 Ga0207428_10132197 3300027907 Bacteria 1909
354 Ga0268266_10004376 3300028379 Bacteria 13554
355 Ga0268266_10047496 3300028379 Bacteria 3678
356 Ga0268266_10127588 3300028379 Bacteria 2272
357 Ga0268265_10037339 3300028380 Bacteria 3565
358 Ga0268264_10414135 3300028381 Bacteria 1298
359 Ga0268264_11009399 3300028381 Bacteria 839
360 Ga0265334_10011527 3300028573 Bacteria 3720
361 Ga0307517_10306140 3300028786 Bacteria 888
362 Ga0307515_10094977 3300028794 Bacteria 3676
363 Ga0307515_10357228 3300028794 Bacteria 1104
364 Ga0265338_10015403 3300028800 Bacteria 8404
365 Ga0265327_10091657 3300031251 Bacteria 1481
366 Ga0307513_10349315 3300031456 Bacteria 1227
367 Ga0307513_10486732 3300031456 Bacteria 952
368 Ga0307509_10002023 3300031507 Bacteria 33484
369 Ga0307509_10648580 3300031507 Bacteria 725
370 Ga0307508_10350784 3300031616 Bacteria 1067
371 Ga0307508_10394598 3300031616 Bacteria 975
372 Ga0307412_11139083 3300031911 Bacteria 696
373 Ga0307409_101017481 3300031995 Bacteria 847
374 Ga0373926_0059180 3300035083 Bacteria 1394
375 Ga0373944_0108807 3300035089 Bacteria 944
376 Ga0373923_0013314 3300035111 Bacteria 3063
377 Ga0373936_0017133 3300035113 Bacteria 2788
378 Ga0373936_0385754 3300035113 Bacteria 641
379 Ga0373953_0035639 3300035117 Bacteria 1956
380 Ga0373953_0138905 3300035117 Bacteria 1039
381 Ga0373956_0040965 3300035119 Bacteria 2056
382 Ga0373956_0050749 3300035119 Bacteria 1863
383 Ga0373957_0018005 3300035120 Bacteria 2469
384 Ga0373943_0000502 3300035170 Bacteria 16761
385 Ga0373943_0035961 3300035170 Bacteria 2370
386 Ga0373946_0129305 3300035171 Bacteria 1160
387 Ga0373955_0007054 3300035172 Bacteria 5147
388 Ga0373955_0091979 3300035172 Bacteria 1730
389 Ga0373955_0192049 3300035172 Bacteria 1214
390 Ga0373961_0065756 3300035241 Bacteria 1111
391 Ga0373924_0027783 3300035410 Bacteria 2251
392 Ga0373931_0275337 3300035691 Bacteria 1032
393 Ga0373935_0002992 3300035692 Bacteria 9747
394 Ga0373935_0047319 3300035692 Bacteria 2719
395 Ga0373927_0000713 3300035695 Bacteria 25468
396 Ga0373927_0007626 3300035695 Bacteria 7328
397 Ga0373927_0165646 3300035695 Bacteria 1448
398 Ga0373927_0255266 3300035695 Bacteria 1153
399 Ga0373933_0001612 3300035724 Bacteria 13194
400 Ga0373933_0141707 3300035724 Bacteria 1518
401 Ga0373947_0001028 3300035725 Bacteria 17076
402 Ga0373947_0053731 3300035725 Bacteria 2429
403 Ga0373947_0120296 3300035725 Bacteria 1667
404 Ga0373947_0330851 3300035725 Bacteria 1020
405 Ga0373937_0001052 3300036401 Bacteria 23314
406 Ga0373937_0059431 3300036401 Bacteria 3513
407 Ga0373937_1076998 3300036401 Bacteria 752
408 Ga0373925_0044172 3300037068 Bacteria 3308
409 Ga0373925_0065944 3300037068 Bacteria 2728
410 Ga0373925_0093164 3300037068 Bacteria 2305
411 Ga0373925_0137600 3300037068 Bacteria 1909
412 Ga0395898_0002852 3300037466 Bacteria 19765
413 Ga0436364_0172918 3300037853 Bacteria 18712
414 Ga0436364_0879319 3300037853 Bacteria 1478
415 Ga0436364_1537609 3300037853 Bacteria 736
416 Ga0395901_0085332 3300038443 Bacteria 3301
417 Ga0436365_0455477 3300039437 Bacteria 3342
418 Ga0436365_0503700 3300039437 Bacteria 2622
419 Ga0436365_0771146 3300039437 Bacteria 1641
420 Ga0436365_0894121 3300039437 Bacteria 663
421 Ga0436365_1145304 3300039437 Bacteria 1008
422 Ga0436365_1753676 3300039437 Bacteria 8495
423 Ga0436360_0678860 3300039438 Bacteria 595
424 Ga0436360_0937157 3300039438 Bacteria 882
425 Ga0436360_1221610 3300039438 Bacteria 720
426 Ga0436361_0967157 3300039447 Bacteria 563
427 Ga0436363_1636879 3300039450 Bacteria 696
428 Ga0436362_0355965 3300039453 Bacteria 1133
429 Ga0439453_0000641 3300041408 Bacteria 3961
430 Ga0439461_0080895 3300041410 Bacteria 767
431 Ga0451807_1442481 3300041486 Bacteria 745
432 Ga0439435_0003932 3300042436 Bacteria 3151
433 Ga0439464_0060396 3300042439 Bacteria 1109
434 Ga0439440_0090135 3300042993 Bacteria 822
435 Ga0466963_0177436 3300044694 Bacteria 1487
436 Ga0466957_0082949 3300044842 Bacteria 1999
437 Ga0466959_0074772 3300045049 Bacteria 2449
438 Ga0451576_0141639 3300045051 Bacteria 2507
439 Ga0451576_1017186 3300045051 Bacteria 868
440 Ga0466967_0868993 3300045976 Bacteria 896
441 Ga0495592_0043386 3300046454 Bacteria 3365
442 Ga0495592_0101877 3300046454 Bacteria 2045
443 Ga0495592_0216672 3300046454 Bacteria 1282
444 Ga0495603_0001039 3300046455 Bacteria 16059
445 Ga0495590_0009288 3300046457 Bacteria 3729
446 Ga0495629_0000093 3300046459 Bacteria 77978
447 Ga0495629_0004234 3300046459 Bacteria 10755
448 Ga0495638_0013385 3300046460 Bacteria 5586
449 Ga0495638_0129224 3300046460 Bacteria 1486
450 Ga0495638_0222028 3300046460 Bacteria 1055
451 Ga0495641_0001918 3300046461 Bacteria 16982
452 Ga0495651_0000606 3300046462 Bacteria 27884
453 Ga0495653_0005276 3300046463 Bacteria 10512
454 Ga0495650_0072610 3300046471 Bacteria 1346
455 Ga0495580_0003124 3300046472 Bacteria 14191
456 Ga0495580_0091569 3300046472 Bacteria 2116
457 Ga0495580_0790380 3300046472 Bacteria 616
458 Ga0495582_0000010 3300046473 Bacteria 118676
459 Ga0495582_0090142 3300046473 Bacteria 1709
460 Ga0495605_0049668 3300046474 Bacteria 2049
461 Ga0495639_0000319 3300046475 Bacteria 23333
462 Ga0495662_0134296 3300046476 Bacteria 1217
463 Ga0495662_0166067 3300046476 Bacteria 1087
464 Ga0495664_0041015 3300046477 Bacteria 2738
465 Ga0495664_0056101 3300046477 Bacteria 2343
466 Ga0495594_0000713 3300046499 Bacteria 17130
467 Ga0495596_0022818 3300046500 Bacteria 2545
468 Ga0495583_0051105 3300046506 Bacteria 1886
469 Ga0495606_0034904 3300046507 Bacteria 3445
470 Ga0495608_0000591 3300046511 Bacteria 24964
471 Ga0495608_0248350 3300046511 Bacteria 1110
472 Ga0495610_0086842 3300046512 Bacteria 1424
473 Ga0495618_0001466 3300046514 Bacteria 15809
474 Ga0495618_0113084 3300046514 Bacteria 1738
475 Ga0495628_0030478 3300046516 Bacteria 4367
476 Ga0495628_0075591 3300046516 Bacteria 2623
477 Ga0495630_0000513 3300046517 Bacteria 28631
478 Ga0495630_0217777 3300046517 Bacteria 1457
479 Ga0495632_0005487 3300046519 Bacteria 8378
480 Ga0495632_0034139 3300046519 Bacteria 2606
481 Ga0495648_0076730 3300046524 Bacteria 1918
482 Ga0495666_0012033 3300046526 Bacteria 4318
483 Ga0495652_0029877 3300046529 Bacteria 4783
484 Ga0495652_0036828 3300046529 Bacteria 4249
485 Ga0495665_0000092 3300046531 Bacteria 40990
486 Ga0495665_0022412 3300046531 Bacteria 3395
487 Ga0495640_0003901 3300046533 Bacteria 11938
488 Ga0495640_0023323 3300046533 Bacteria 4510
489 Ga0495640_0374630 3300046533 Bacteria 876
490 Ga0495586_0033136 3300046535 Bacteria 2772
491 Ga0495587_0004165 3300046536 Bacteria 9572
492 Ga0495587_0248241 3300046536 Bacteria 1001
493 Ga0495621_0008255 3300046539 Bacteria 3114
494 Ga0495621_0099595 3300046539 Bacteria 1105
495 Ga0495645_0176895 3300046543 Bacteria 1465
496 Ga0495622_0014960 3300046557 Bacteria 3607
497 Ga0495667_0287290 3300046559 Bacteria 1043
498 Ga0495668_0008522 3300046616 Bacteria 6386
499 Ga0495634_0001326 3300046642 Bacteria 22584
500 Ga0495634_0002842 3300046642 Bacteria 14216
501 Ga0495611_0017417 3300046648 Bacteria 3074
502 Ga0495625_0018282 3300046660 Bacteria 5475
503 Ga0495625_0533237 3300046660 Bacteria 713
504 Ga0495635_0000388 3300046663 Bacteria 27965
505 Ga0495635_0003751 3300046663 Bacteria 10547
506 Ga0495635_0016770 3300046663 Bacteria 5117
507 Ga0495588_0007914 3300046674 Bacteria 4857
508 Ga0495657_0095314 3300046675 Bacteria 1902
509 Ga0495599_0000564 3300046678 Bacteria 21162
510 Ga0495623_0001431 3300046679 Bacteria 16178
511 Ga0495646_0004951 3300046680 Bacteria 8412
512 Ga0495646_0171473 3300046680 Bacteria 1195
513 Ga0495647_0001969 3300046681 Bacteria 6407
514 Ga0495647_0227918 3300046681 Bacteria 824
515 Ga0495658_0000663 3300046683 Bacteria 18682
516 Ga0495658_0968197 3300046683 Bacteria 543
517 Ga0495613_0002487 3300046689 Bacteria 13905
518 Ga0495613_0076442 3300046689 Bacteria 2437
519 Ga0495613_0223634 3300046689 Bacteria 1321
520 Ga0495624_0001295 3300046690 Bacteria 19700
521 Ga0495671_0055926 3300046692 Bacteria 1954
522 Ga0495589_0074330 3300046794 Bacteria 1658
523 Ga0495600_0004060 3300046809 Bacteria 8704
524 Ga0495600_0063579 3300046809 Bacteria 2412
525 Ga0495581_0000093 3300047315 Bacteria 36772
526 Ga0495604_0003818 3300047317 Bacteria 11995
527 Ga0495604_0207129 3300047317 Bacteria 1357
528 Ga0495636_0226190 3300047318 Bacteria 860
529 Ga0495674_0000050 3300047319 Bacteria 77111
530 Ga0495674_0009998 3300047319 Bacteria 8990
531 Ga0495674_0012847 3300047319 Bacteria 7886
532 Ga0495672_0018230 3300047320 Bacteria 4670
533 Ga0495676_0024195 3300047321 Bacteria 5261
534 Ga0495676_0066222 3300047321 Bacteria 2801
535 Ga0495676_0222228 3300047321 Bacteria 1301
536 Ga0495680_0001686 3300047322 Bacteria 23465
537 Ga0495675_0023814 3300047444 Bacteria 3901
538 Ga0495684_0002801 3300047471 Bacteria 13756
539 Ga0495684_0044080 3300047471 Bacteria 3415
540 Ga0495684_0049326 3300047471 Bacteria 3217
541 Ga0495593_0013156 3300047673 Bacteria 4724
542 Ga0495602_0021798 3300048088 Bacteria 6291
543 Ga0495614_0017080 3300048089 Bacteria 3154
544 Ga0496100_0032514 3300048903 Bacteria 3255
545 Ga0496101_0140213 3300048904 Bacteria 1842
546 Ga0496101_0592857 3300048904 Bacteria 876
547 Ga0496102_0584158 3300048905 Bacteria 1040
548 Ga0496104_0004606 3300048907 Bacteria 12019
549 Ga0496104_0326756 3300048907 Bacteria 1447
550 Ga0496104_0390073 3300048907 Bacteria 1305
551 Ga0496104_0853598 3300048907 Bacteria 816
552 Ga0496104_1461758 3300048907 Bacteria 586
553 Ga0496105_0104727 3300048908 Bacteria 2336
554 Ga0496105_0253313 3300048908 Bacteria 1426
555 Ga0496106_0882296 3300048909 Bacteria 707
556 Ga0496106_0974564 3300048909 Bacteria 668
557 Ga0496106_1282432 3300048909 Bacteria 569
558 Ga0496107_0022157 3300048910 Bacteria 4489
559 Ga0496108_0631701 3300048911 Bacteria 932
560 Ga0496109_0244825 3300048912 Bacteria 1688
561 Ga0496109_0726014 3300048912 Bacteria 931
562 Ga0496110_0779408 3300048913 Bacteria 860
563 Ga0496111_0185045 3300048914 Bacteria 1549
564 Ga0496111_0315130 3300048914 Bacteria 1159
565 Ga0496111_0510436 3300048914 Bacteria 884
566 Ga0496112_0127040 3300048915 Bacteria 2520
567 Ga0496112_0189657 3300048915 Bacteria 2018
568 Ga0496112_0305721 3300048915 Bacteria 1535
569 Ga0496112_0424417 3300048915 Bacteria 1268
570 Ga0496112_0731514 3300048915 Bacteria 916
571 Ga0496113_0025527 3300048916 Bacteria 4213
572 Ga0496113_0054421 3300048916 Bacteria 2996
573 Ga0496113_1061830 3300048916 Bacteria 636
574 Ga0496114_0610202 3300048917 Bacteria 962
575 Ga0496115_0142464 3300048918 Bacteria 1978
576 Ga0496115_0144766 3300048918 Bacteria 1961
577 Ga0496115_0454951 3300048918 Bacteria 1033
578 Ga0496117_0342830 3300048920 Bacteria 775
579 Ga0496121_0000385 3300048924 Bacteria 90105
580 Ga0496126_0077911 3300048929 Bacteria 2938
581 Ga0496126_0096551 3300048929 Bacteria 2591
582 Ga0496126_0165354 3300048929 Bacteria 1888
583 Ga0496126_0175676 3300048929 Bacteria 1822
584 Ga0495682_0041380 3300049460 Bacteria 1689
585 Ga0501298_089502 3300049521 Bacteria 688
586 Ga0501031_0148418 3300049568 Bacteria 1532
587 Ga0501033_0816079 3300049570 Bacteria 630
588 Ga0501034_0305440 3300049571 Bacteria 1527
589 Ga0501034_0709008 3300049571 Bacteria 904
590 Ga0501036_0122419 3300049572 Bacteria 2197
591 Ga0501038_0867348 3300049574 Bacteria 668
592 Ga0501039_0349954 3300049575 Bacteria 1161
593 Ga0501043_0370297 3300049579 Bacteria 1086
594 Ga0501046_0044994 3300049580 Bacteria 3509
595 Ga0501046_0597526 3300049580 Bacteria 783
596 Ga0501047_0420797 3300049581 Bacteria 1167
597 Ga0501048_1028304 3300049582 Bacteria 593
598 Ga0501071_0053441 3300049587 Bacteria 2914
599 Ga0501073_0395531 3300049589 Bacteria 955
600 Ga0501074_0250633 3300049590 Bacteria 1259
601 Ga0501074_0678466 3300049590 Bacteria 727
602 Ga0501080_0059736 3300049742 Bacteria 3548
603 Ga0501080_0832566 3300049742 Bacteria 808
604 Ga0501035_0346374 3300049822 Bacteria 1244
605 Ga0501044_0039309 3300049823 Bacteria 4936
606 Ga0501044_0089485 3300049823 Bacteria 3107
607 nmdc:mga03n38_553397_c1 3300050490 Bacteria 651
608 nmdc:mga0yw44_231734_c1 3300050492 Bacteria 1226
609 nmdc:mga06z11_178859_c1 3300050494 Bacteria 1222
610 nmdc:mga06z11_237697_c1 3300050494 Bacteria 1069
611 nmdc:mga06z11_541117_c1 3300050494 Bacteria 707
612 nmdc:mga04h51_39896_c1 3300050495 Bacteria 1527
613 nmdc:mga07m45_19355_c1 3300050496 Bacteria 3688
614 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
615 nmdc:mga05p37_99556_c1 3300050507 Bacteria 3580
616 nmdc:mga09592_1011_c1 3300050508 Bacteria 22343
617 nmdc:mga0qj67_103961_c1 3300050509 Bacteria 2291
618 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
619 nmdc:mga08y16_561222_c1 3300050511 Bacteria 1154
620 nmdc:mga08y16_91_c2 3300050511 Bacteria 43815
621 nmdc:mga0n895_145498_c1 3300050512 Bacteria 2399
622 nmdc:mga0n895_840432_c1 3300050512 Bacteria 906
623 nmdc:mga0rr50_30099_c1 3300050513 Bacteria 3839
624 nmdc:mga08x19_482596_c1 3300050514 Bacteria 874
625 nmdc:mga0a205_726393_c1 3300050515 Bacteria 842
626 nmdc:mga0a205_74928_c1 3300050515 Bacteria 3270
627 Ga0495601_0002960 3300053077 Bacteria 9660
628 Ga0495601_0146183 3300053077 Bacteria 1543
629 Ga0495612_0007058 3300053078 Bacteria 4595
630 Ga0500635_0086955 3300053080 Bacteria 1131
631 Ga0495595_0000552 3300053084 Bacteria 14281
632 Ga0495619_0012899 3300053085 Bacteria 5263
633 Ga0495619_0145696 3300053085 Bacteria 1632
634 Ga0495619_0362143 3300053085 Bacteria 1003
635 Ga0500644_0109194 3300053088 Bacteria 1063
636 Ga0500651_0083210 3300053093 Bacteria 1980
637 Ga0500566_0000024 3300053094 Bacteria 79576
638 Ga0500650_0102868 3300053098 Bacteria 1336
639 Ga0500554_010097 3300053102 Bacteria 2286
640 Ga0500555_138432 3300053103 Bacteria 601
641 Ga0500562_017712 3300053108 Bacteria 1838
642 Ga0500595_003153 3300053119 Bacteria 7809
643 Ga0500658_0009752 3300053134 Bacteria 3539
644 Ga0500559_0000216 3300053136 Bacteria 46251
645 Ga0500561_0003171 3300053137 Bacteria 2847
646 Ga0500568_0096476 3300053139 Bacteria 1112
647 Ga0500577_0021506 3300053142 Bacteria 2127
648 Ga0500589_050456 3300053147 Bacteria 1931
649 Ga0500603_000742 3300053150 Bacteria 7959
650 Ga0500616_0063068 3300053153 Bacteria 1912
651 Ga0500616_0210244 3300053153 Bacteria 856
652 Ga0500622_0050559 3300053156 Bacteria 2142
653 Ga0500634_0195769 3300053161 Bacteria 893
654 Ga0500637_0036310 3300053178 Bacteria 2766
655 Ga0500637_0450063 3300053178 Bacteria 653
656 Ga0500645_104531 3300053730 Bacteria 797
657 Ga0501084_1195166 3300054114 Bacteria 638
658 Ga0501082_0312052 3300060353 Bacteria 1369
659 2885389071 2885383462 Bacteria 9473874
660 2929202675 2929199973 Bacteria 7260745
661 8016588342 8016583857 Bacteria 10421953
662 8055910247 8055909800 Bacteria 7278581
663 Ga0436364_1276734
664 JGI25406J46586_10028754
665 Ga0065712_10365520
666 Ga0065712_10522466
667 Ga0070658_11142887
668 Ga0070676_10296496
669 Ga0070683_100910601
670 Ga0070690_100014464
671 Ga0070670_100074607
672 Ga0070670_100299223
673 Ga0070677_10024106
674 Ga0068869_100829822
675 Ga0070680_100012727
676 Ga0070680_100078746
677 Ga0070680_100285558
678 Ga0070680_100386820
679 Ga0070682_100015512
680 Ga0070682_100184655
681 Ga0070682_100834131
682 Ga0068868_100587012
683 Ga0070660_100455917
684 Ga0070660_101007569
685 Ga0070689_100062442
686 Ga0070689_100165947
687 Ga0070691_10086235
688 Ga0070687_100026938
689 Ga0070687_100103086
690 Ga0070661_100141526
691 Ga0070661_100150701
692 Ga0070692_10122910
693 Ga0070669_100285438
694 Ga0070675_100062403
695 Ga0070675_100133383
696 Ga0070671_100050357
697 Ga0070671_100084127
698 Ga0070674_100152370
699 Ga0070674_100316809
700 Ga0070673_100242029
701 Ga0070659_100557151
702 Ga0070659_101028507
703 Ga0070667_100017222
704 Ga0070667_100653932
705 Ga0070709_10445532
706 Ga0070714_100073284
707 Ga0070714_100247326
708 Ga0070713_100011150
709 Ga0070713_100343699
710 Ga0070713_100438906
711 Ga0070713_100634738
712 Ga0070710_10094451
713 Ga0070701_10002123
714 Ga0070711_100031278
715 Ga0070700_100101526
716 Ga0070694_100058943
717 Ga0070708_100133908
718 Ga0070663_100045640
719 Ga0070663_100057851
720 Ga0070678_100130261
721 Ga0070678_101020129
722 Ga0070662_100275350
723 Ga0070681_10010354
724 Ga0070681_10057549
725 Ga0070681_10291967
726 Ga0068867_100045588
727 Ga0070685_10329828
728 Ga0070707_100004904
729 Ga0070698_100294887
730 Ga0070699_100165430
731 Ga0070679_100020905
732 Ga0070679_100132812
733 Ga0070684_100001434
734 Ga0070684_100009099
735 Ga0070684_100327652
736 Ga0070697_100300213
737 Ga0068853_100039638
738 Ga0068853_100062324
739 Ga0068853_101311508
740 Ga0070672_100072328
741 Ga0070672_101127206
742 Ga0070686_100031021
743 Ga0070686_100102130
744 Ga0070693_100107397
745 Ga0070693_100181618
746 Ga0070693_100691422
747 Ga0070665_100003223
748 Ga0070665_100482517
749 Ga0070665_100488087
750 Ga0070704_100047180
751 Ga0068855_100051826
752 Ga0068855_100076518
753 Ga0068855_101405804
754 Ga0070664_100030905
755 Ga0070664_100947503
756 Ga0068857_100030995
757 Ga0068857_100276524
758 Ga0068857_100985186
759 Ga0068854_100429419
760 Ga0068856_100058073
761 Ga0068856_100085363
762 Ga0068856_100775763
763 Ga0068852_100433326
764 Ga0068852_100807937
765 Ga0068859_100145053
766 Ga0068859_100477007
767 Ga0068864_100058973
768 Ga0068861_100008855
769 Ga0068851_10089022
770 Ga0068851_10464455
771 Ga0068870_10084510
772 Ga0068863_100005667
773 Ga0068863_100473775
774 Ga0068858_100083324
775 Ga0068858_100373922
776 Ga0068860_100772617
777 Ga0068862_100028714
778 Ga0081455_10097718
779 Ga0081455_10107038
780 Ga0081455_10389209
781 Ga0081540_1002238
782 Ga0081540_1038959
783 Ga0081539_10000455
784 Ga0081539_10003048
785 Ga0081539_10098355
786 Ga0070717_10013290
787 Ga0070717_10016909
788 Ga0070717_10058515
789 Ga0070717_10096115
790 Ga0070717_10131231
791 Ga0075365_10099573
792 Ga0075365_10151263
793 Ga0075368_10032366
794 Ga0075363_100073330
795 Ga0070715_10380421
796 Ga0070716_100205246
797 Ga0075362_10009342
798 Ga0075367_10139813
799 Ga0075366_10004233
800 Ga0075366_10332902
801 Ga0097621_100053263
802 Ga0075370_10014197
803 Ga0075428_100001683
804 Ga0075428_100773243
805 Ga0075428_100806708
806 Ga0075430_100830723
807 Ga0075431_100000058
808 Ga0075433_10025080
809 Ga0075434_100170512
810 Ga0075434_100700743
811 Ga0075429_100497553
812 Ga0075429_101169535
813 Ga0068865_101206137
814 Ga0075436_100467771
815 Ga0075436_100837716
816 Ga0097620_100145049
817 Ga0097620_100477012
818 Ga0075435_100046863
819 Ga0075435_100160260
820 Ga0075435_100689380
821 Ga0075435_101086866
822 Ga0099794_10106919
823 Ga0099795_10030640
824 Ga0099795_10036598
825 Ga0099795_10367180
826 Ga0105240_10013493
827 Ga0105240_10024143
828 Ga0105240_10056204
829 Ga0105240_10343266
830 Ga0111539_10004981
831 Ga0111539_10008578
832 Ga0111539_10178865
833 Ga0111539_10370361
834 Ga0111539_10816239
835 Ga0105245_10027618
836 Ga0105245_10343692
837 Ga0105245_11323294
838 Ga0105247_10014162
839 Ga0105247_10181258
840 Ga0105247_10210156
841 Ga0105247_10352099
842 Ga0114129_10000046
843 Ga0114129_10492444
844 Ga0105243_10067816
845 Ga0105241_10281323
846 Ga0105242_10154845
847 Ga0105242_10185731
848 Ga0105248_10010145
849 Ga0105248_10068430
850 Ga0105248_10645107
851 Ga0105237_10029909
852 Ga0105237_10050019
853 Ga0105237_10147853
854 Ga0105237_10258788
855 Ga0105237_10313795
856 Ga0105238_10022782
857 Ga0105238_10035640
858 Ga0105238_10166479
859 Ga0105238_10195510
860 Ga0105238_10897458
861 Ga0105249_10189842
862 Ga0099796_10017968
863 Ga0099796_10038389
864 Ga0105239_10051332
865 Ga0105239_10534914
866 Ga0105246_10041272
867 Ga0105246_10338761
868 Ga0105246_10623287
869 Ga0105246_11481557
870 Ga0157347_1019173
871 Ga0157373_10434214
872 Ga0157373_10630772
873 Ga0157370_10047437
874 Ga0157370_10109687
875 Ga0157369_10023618
876 Ga0157369_10031413
877 Ga0157369_12111400
878 Ga0157374_10013590
879 Ga0157374_10016598
880 Ga0157374_11083759
881 Ga0157378_10324874
882 Ga0157378_11105910
883 Ga0163162_10021008
884 Ga0163162_10275481
885 Ga0157372_10773489
886 Ga0157375_11173169
887 Ga0163163_10008433
888 Ga0163163_10504491
889 Ga0163163_10652546
890 Ga0157380_10183246
891 Ga0157380_10636371
892 Ga0182008_10046645
893 Ga0157379_10010422
894 Ga0157376_10025597
895 Ga0157376_11278301
896 Ga0163161_10640366
897 Ga0213876_10164988
898 Ga0213875_10001665
899 Ga0213875_10164385
900 Ga0209758_1006814
901 Ga0207656_10313119
902 Ga0207682_10000447
903 Ga0207692_10121405
904 Ga0207692_10278980
905 Ga0207710_10023476
906 Ga0207688_10042321
907 Ga0207680_10245660
908 Ga0207699_10043142
909 Ga0207699_10124094
910 Ga0207645_10039571
911 Ga0207645_10526024
912 Ga0207643_10344581
913 Ga0207705_10375727
914 Ga0207684_10132051
915 Ga0207654_10179477
916 Ga0207654_10514174
917 Ga0207707_10000204
918 Ga0207707_10001911
919 Ga0207707_10042040
920 Ga0207695_10050511
921 Ga0207695_10203541
922 Ga0207695_10245922
923 Ga0207695_10407513
924 Ga0207671_10102405
925 Ga0207671_10161778
926 Ga0207671_10174611
927 Ga0207671_10250515
928 Ga0207693_10076906
929 Ga0207663_10116973
930 Ga0207660_10052669
931 Ga0207660_10074688
932 Ga0207660_10310933
933 Ga0207660_10328227
934 Ga0207662_10255072
935 Ga0207649_10204574
936 Ga0207652_10072580
937 Ga0207652_10169939
938 Ga0207646_10055185
939 Ga0207681_11044980
940 Ga0207694_10015593
941 Ga0207694_10048442
942 Ga0207650_10038596
943 Ga0207659_10089630
944 Ga0207659_10153567
945 Ga0207687_10167045
946 Ga0207687_10282562
947 Ga0207700_10097134
948 Ga0207700_10196283
949 Ga0207700_10255046
950 Ga0207664_10194620
951 Ga0207664_10200057
952 Ga0207664_10288057
953 Ga0207664_10473627
954 Ga0207664_10935509
955 Ga0207644_10089551
956 Ga0207706_10353749
957 Ga0207706_10505521
958 Ga0207709_10309953
959 Ga0207709_10322879
960 Ga0207670_10728915
961 Ga0207665_10040602
962 Ga0207665_10223098
963 Ga0207691_10929137
964 Ga0207711_10010286
965 Ga0207711_10038975
966 Ga0207689_10016206
967 Ga0207689_10697428
968 Ga0207689_11305720
969 Ga0207661_10016694
970 Ga0207661_10193864
971 Ga0207661_10398558
972 Ga0207661_11276418
973 Ga0207661_11663301
974 Ga0207679_10030697
975 Ga0207667_10050188
976 Ga0207667_10136884
977 Ga0207667_11254957
978 Ga0207667_11688399
979 Ga0207651_10422675
980 Ga0207712_10145229
981 Ga0207712_10605680
982 Ga0207668_10598843
983 Ga0207640_10022109
984 Ga0207658_10418948
985 Ga0207658_11852085
986 Ga0207677_10013896
987 Ga0207677_10634398
988 Ga0207703_10086536
989 Ga0207703_10907071
990 Ga0207639_10078101
991 Ga0207639_10553272
992 Ga0207639_10719298
993 Ga0207639_10720069
994 Ga0207678_10049678
995 Ga0207678_10482706
996 Ga0207678_10600816
997 Ga0207708_10405661
998 Ga0207702_10018421
999 Ga0207702_10342642
1000 Ga0207702_10925712
1001 Ga0207641_10010240
1002 Ga0207641_10568984
1003 Ga0207648_10020919
1004 Ga0207676_10046422
1005 Ga0207676_11153645
1006 Ga0207676_11210930
1007 Ga0207674_10085797
1008 Ga0207674_10150390
1009 Ga0207674_10270530
1010 Ga0207674_10615837
1011 Ga0207683_10002719
1012 Ga0207698_10530376
1013 Ga0209813_10138117
1014 Ga0207428_10004515
1015 Ga0207428_10132197
1016 Ga0268266_10004376
1017 Ga0268266_10047496
1018 Ga0268266_10127588
1019 Ga0268265_10037339
1020 Ga0268264_10414135
1021 Ga0268264_11009399
1022 Ga0265334_10011527
1023 Ga0307517_10306140
1024 Ga0307515_10094977
1025 Ga0307515_10357228
1026 Ga0265338_10015403
1027 Ga0265327_10091657
1028 Ga0307513_10349315
1029 Ga0307513_10486732
1030 Ga0307509_10002023
1031 Ga0307509_10648580
1032 Ga0307508_10350784
1033 Ga0307508_10394598
1034 Ga0307412_11139083
1035 Ga0307409_101017481
1036 Ga0373926_0059180
1037 Ga0373944_0108807
1038 Ga0373923_0013314
1039 Ga0373936_0017133
1040 Ga0373936_0385754
1041 Ga0373953_0035639
1042 Ga0373953_0138905
1043 Ga0373956_0040965
1044 Ga0373956_0050749
1045 Ga0373957_0018005
1046 Ga0373943_0000502
1047 Ga0373943_0035961
1048 Ga0373946_0129305
1049 Ga0373955_0007054
1050 Ga0373955_0091979
1051 Ga0373955_0192049
1052 Ga0373961_0065756
1053 Ga0373924_0027783
1054 Ga0373931_0275337
1055 Ga0373935_0002992
1056 Ga0373935_0047319
1057 Ga0373927_0000713
1058 Ga0373927_0007626
1059 Ga0373927_0165646
1060 Ga0373927_0255266
1061 Ga0373933_0001612
1062 Ga0373933_0141707
1063 Ga0373947_0001028
1064 Ga0373947_0053731
1065 Ga0373947_0120296
1066 Ga0373947_0330851
1067 Ga0373937_0001052
1068 Ga0373937_0059431
1069 Ga0373937_1076998
1070 Ga0373925_0044172
1071 Ga0373925_0065944
1072 Ga0373925_0093164
1073 Ga0373925_0137600
1074 Ga0395898_0002852
1075 Ga0436364_0172918
1076 Ga0436364_0879319
1077 Ga0436364_1537609
1078 Ga0395901_0085332
1079 Ga0436365_0455477
1080 Ga0436365_0503700
1081 Ga0436365_0771146
1082 Ga0436365_0894121
1083 Ga0436365_1145304
1084 Ga0436365_1753676
1085 Ga0436360_0678860
1086 Ga0436360_0937157
1087 Ga0436360_1221610
1088 Ga0436361_0967157
1089 Ga0436363_1636879
1090 Ga0436362_0355965
1091 Ga0439453_0000641
1092 Ga0439461_0080895
1093 Ga0451807_1442481
1094 Ga0439435_0003932
1095 Ga0439464_0060396
1096 Ga0439440_0090135
1097 Ga0466963_0177436
1098 Ga0466957_0082949
1099 Ga0466959_0074772
1100 Ga0451576_0141639
1101 Ga0451576_1017186
1102 Ga0466967_0868993
1103 Ga0495592_0043386
1104 Ga0495592_0101877
1105 Ga0495592_0216672
1106 Ga0495603_0001039
1107 Ga0495590_0009288
1108 Ga0495629_0000093
1109 Ga0495629_0004234
1110 Ga0495638_0013385
1111 Ga0495638_0129224
1112 Ga0495638_0222028
1113 Ga0495641_0001918
1114 Ga0495651_0000606
1115 Ga0495653_0005276
1116 Ga0495650_0072610
1117 Ga0495580_0003124
1118 Ga0495580_0091569
1119 Ga0495580_0790380
1120 Ga0495582_0000010
1121 Ga0495582_0090142
1122 Ga0495605_0049668
1123 Ga0495639_0000319
1124 Ga0495662_0134296
1125 Ga0495662_0166067
1126 Ga0495664_0041015
1127 Ga0495664_0056101
1128 Ga0495594_0000713
1129 Ga0495596_0022818
1130 Ga0495583_0051105
1131 Ga0495606_0034904
1132 Ga0495608_0000591
1133 Ga0495608_0248350
1134 Ga0495610_0086842
1135 Ga0495618_0001466
1136 Ga0495618_0113084
1137 Ga0495628_0030478
1138 Ga0495628_0075591
1139 Ga0495630_0000513
1140 Ga0495630_0217777
1141 Ga0495632_0005487
1142 Ga0495632_0034139
1143 Ga0495648_0076730
1144 Ga0495666_0012033
1145 Ga0495652_0029877
1146 Ga0495652_0036828
1147 Ga0495665_0000092
1148 Ga0495665_0022412
1149 Ga0495640_0003901
1150 Ga0495640_0023323
1151 Ga0495640_0374630
1152 Ga0495586_0033136
1153 Ga0495587_0004165
1154 Ga0495587_0248241
1155 Ga0495621_0008255
1156 Ga0495621_0099595
1157 Ga0495645_0176895
1158 Ga0495622_0014960
1159 Ga0495667_0287290
1160 Ga0495668_0008522
1161 Ga0495634_0001326
1162 Ga0495634_0002842
1163 Ga0495611_0017417
1164 Ga0495625_0018282
1165 Ga0495625_0533237
1166 Ga0495635_0000388
1167 Ga0495635_0003751
1168 Ga0495635_0016770
1169 Ga0495588_0007914
1170 Ga0495657_0095314
1171 Ga0495599_0000564
1172 Ga0495623_0001431
1173 Ga0495646_0004951
1174 Ga0495646_0171473
1175 Ga0495647_0001969
1176 Ga0495647_0227918
1177 Ga0495658_0000663
1178 Ga0495658_0968197
1179 Ga0495613_0002487
1180 Ga0495613_0076442
1181 Ga0495613_0223634
1182 Ga0495624_0001295
1183 Ga0495671_0055926
1184 Ga0495589_0074330
1185 Ga0495600_0004060
1186 Ga0495600_0063579
1187 Ga0495581_0000093
1188 Ga0495604_0003818
1189 Ga0495604_0207129
1190 Ga0495636_0226190
1191 Ga0495674_0000050
1192 Ga0495674_0009998
1193 Ga0495674_0012847
1194 Ga0495672_0018230
1195 Ga0495676_0024195
1196 Ga0495676_0066222
1197 Ga0495676_0222228
1198 Ga0495680_0001686
1199 Ga0495675_0023814
1200 Ga0495684_0002801
1201 Ga0495684_0044080
1202 Ga0495684_0049326
1203 Ga0495593_0013156
1204 Ga0495602_0021798
1205 Ga0495614_0017080
1206 Ga0496100_0032514
1207 Ga0496101_0140213
1208 Ga0496101_0592857
1209 Ga0496102_0584158
1210 Ga0496104_0004606
1211 Ga0496104_0326756
1212 Ga0496104_0390073
1213 Ga0496104_0853598
1214 Ga0496104_1461758
1215 Ga0496105_0104727
1216 Ga0496105_0253313
1217 Ga0496106_0882296
1218 Ga0496106_0974564
1219 Ga0496106_1282432
1220 Ga0496107_0022157
1221 Ga0496108_0631701
1222 Ga0496109_0244825
1223 Ga0496109_0726014
1224 Ga0496110_0779408
1225 Ga0496111_0185045
1226 Ga0496111_0315130
1227 Ga0496111_0510436
1228 Ga0496112_0127040
1229 Ga0496112_0189657
1230 Ga0496112_0305721
1231 Ga0496112_0424417
1232 Ga0496112_0731514
1233 Ga0496113_0025527
1234 Ga0496113_0054421
1235 Ga0496113_1061830
1236 Ga0496114_0610202
1237 Ga0496115_0142464
1238 Ga0496115_0144766
1239 Ga0496115_0454951
1240 Ga0496117_0342830
1241 Ga0496121_0000385
1242 Ga0496126_0077911
1243 Ga0496126_0096551
1244 Ga0496126_0165354
1245 Ga0496126_0175676
1246 Ga0495682_0041380
1247 Ga0501298_089502
1248 Ga0501031_0148418
1249 Ga0501033_0816079
1250 Ga0501034_0305440
1251 Ga0501034_0709008
1252 Ga0501036_0122419
1253 Ga0501038_0867348
1254 Ga0501039_0349954
1255 Ga0501043_0370297
1256 Ga0501046_0044994
1257 Ga0501046_0597526
1258 Ga0501047_0420797
1259 Ga0501048_1028304
1260 Ga0501071_0053441
1261 Ga0501073_0395531
1262 Ga0501074_0250633
1263 Ga0501074_0678466
1264 Ga0501080_0059736
1265 Ga0501080_0832566
1266 Ga0501035_0346374
1267 Ga0501044_0039309
1268 Ga0501044_0089485
1269 nmdc:mga03n38_553397_c1
1270 nmdc:mga0yw44_231734_c1
1271 nmdc:mga06z11_178859_c1
1272 nmdc:mga06z11_237697_c1
1273 nmdc:mga06z11_541117_c1
1274 nmdc:mga04h51_39896_c1
1275 nmdc:mga07m45_19355_c1
1276 nmdc:mga05p37_138_c1
1277 nmdc:mga05p37_99556_c1
1278 nmdc:mga09592_1011_c1
1279 nmdc:mga0qj67_103961_c1
1280 nmdc:mga06r32_15_c1
1281 nmdc:mga08y16_561222_c1
1282 nmdc:mga08y16_91_c2
1283 nmdc:mga0n895_145498_c1
1284 nmdc:mga0n895_840432_c1
1285 nmdc:mga0rr50_30099_c1
1286 nmdc:mga08x19_482596_c1
1287 nmdc:mga0a205_726393_c1
1288 nmdc:mga0a205_74928_c1
1289 Ga0495601_0002960
1290 Ga0495601_0146183
1291 Ga0495612_0007058
1292 Ga0500635_0086955
1293 Ga0495595_0000552
1294 Ga0495619_0012899
1295 Ga0495619_0145696
1296 Ga0495619_0362143
1297 Ga0500644_0109194
1298 Ga0500651_0083210
1299 Ga0500566_0000024
1300 Ga0500650_0102868
1301 Ga0500554_010097
1302 Ga0500555_138432
1303 Ga0500562_017712
1304 Ga0500595_003153
1305 Ga0500658_0009752
1306 Ga0500559_0000216
1307 Ga0500561_0003171
1308 Ga0500568_0096476
1309 Ga0500577_0021506
1310 Ga0500589_050456
1311 Ga0500603_000742
1312 Ga0500616_0063068
1313 Ga0500616_0210244
1314 Ga0500622_0050559
1315 Ga0500634_0195769
1316 Ga0500637_0036310
1317 Ga0500637_0450063
1318 Ga0500645_104531
1319 Ga0501084_1195166
1320 Ga0501082_0312052
1321 2885389071
1322 2929202675
1323 8016588342
1324 8055910247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

19

192

0.94

PF01575

MaoC_dehydratas

MaoC like domain

44

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.92 18 162
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.9119 20 162
7sh3-assembly1.cif.gz_B crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi in complex with a synthetic virb8 miniprotein binder 0.9029 115 160
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.9024 18 168
2bi0-assembly1.cif.gz_A rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold 0.8843 18 168
ID Description Score Start End Superfamily
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9469 16 163 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9119 20 162 3.10.129.10
4e3eB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8963 18 168 3.10.129.10
2bi0A01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8925 18 161 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8891 16 163 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A534T6U4-F1-model_v4 MaoC family dehydratase 0.9757 17 162
AF-W9H5Q8-F1-model_v4 MaoC family dehydratase 0.9736 16 165
AF-A0A4P8J1S3-F1-model_v4 MaoC family dehydratase 0.9721 16 163
AF-A0A355B5M4-F1-model_v4 Dehydratase 0.9712 27 164
AF-A0A7T9GG44-F1-model_v4 deleted 0.9705 16 162

Map