F473468

General Info

Members Datasets Scaffolds Average Seq Length
662 288 1324 168

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10227923|Ga0114129_102279233
Length 203
Sequence LPIGCCFAPIDNLQSSIDDSNLQSAICNRQSVVMDHLWSSWRLAYITGERRTTDCVFCTALTDEEAAPLILFRGRTCFIILNLFPYNNGHLMVVPNRHIGTLAAAEPDELSELIELTRRSEIALTEAYAPHGMNVGINLGKPAGAGILDHLHMHVVPRWNGDTNFMTVIGRTRVLPEELPQTGERLRPLFEKLARVSGPTDKA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
197 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
234 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
254 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0
Rhizoplane 2.27
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 11.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10227923 3300009147 Bacteria 2510
2 JGI25405J52794_10003876 3300003911 Bacteria 2652
3 Ga0065704_10367406 3300005289 Unclassified 789
4 Ga0065712_10080734 3300005290 Bacteria 3074
5 Ga0065712_10248216 3300005290 Bacteria 966
6 Ga0065712_10669721 3300005290 Unclassified 559
7 Ga0065715_10136338 3300005293 Bacteria 1919
8 Ga0065715_10485302 3300005293 Unclassified 793
9 Ga0065707_10003097 3300005295 Bacteria 3996
10 Ga0065707_10012929 3300005295 Bacteria 3077
11 Ga0065707_10095779 3300005295 Bacteria 3326
12 Ga0065707_10162245 3300005295 Bacteria 1553
13 Ga0065707_10204508 3300005295 Bacteria 1294
14 Ga0070676_10053968 3300005328 Bacteria 2368
15 Ga0070690_100061335 3300005330 Bacteria 2422
16 Ga0070670_100151079 3300005331 Bacteria 2010
17 Ga0070670_100312409 3300005331 Bacteria 1376
18 Ga0070666_10192794 3300005335 Bacteria 1432
19 Ga0070680_100125337 3300005336 Bacteria 2146
20 Ga0070682_100511040 3300005337 Bacteria 933
21 Ga0070660_100035719 3300005339 Bacteria 3762
22 Ga0070689_100217026 3300005340 Bacteria 1568
23 Ga0070689_100621325 3300005340 Bacteria 938
24 Ga0070689_101044730 3300005340 Bacteria 728
25 Ga0070687_100851360 3300005343 Bacteria 650
26 Ga0070661_100048620 3300005344 Bacteria 3105
27 Ga0070661_100067498 3300005344 Bacteria 2628
28 Ga0070661_100679949 3300005344 Bacteria 837
29 Ga0070692_10011870 3300005345 Bacteria 4016
30 Ga0070692_10068093 3300005345 Bacteria 1891
31 Ga0070692_10411969 3300005345 Bacteria 856
32 Ga0070669_100007109 3300005353 Bacteria 8043
33 Ga0070669_100009945 3300005353 Bacteria 6768
34 Ga0070669_100024754 3300005353 Bacteria 4307
35 Ga0070669_100271726 3300005353 Bacteria 1356
36 Ga0070675_100000781 3300005354 Bacteria 22291
37 Ga0070675_100694573 3300005354 Bacteria 926
38 Ga0070675_100805922 3300005354 Bacteria 858
39 Ga0070675_101119383 3300005354 Bacteria 724
40 Ga0070671_100060629 3300005355 Bacteria 3150
41 Ga0070674_100181429 3300005356 Bacteria 1613
42 Ga0070674_101077035 3300005356 Bacteria 709
43 Ga0070673_100002008 3300005364 Bacteria 12277
44 Ga0070673_100125840 3300005364 Bacteria 2144
45 Ga0070673_100213711 3300005364 Bacteria 1667
46 Ga0070673_100263632 3300005364 Bacteria 1506
47 Ga0070688_100125159 3300005365 Archaea 1727
48 Ga0070688_100303850 3300005365 Bacteria 1154
49 Ga0070659_100046529 3300005366 Unclassified 3401
50 Ga0070659_100664806 3300005366 Unclassified 899
51 Ga0070667_100111494 3300005367 Bacteria 2373
52 Ga0070667_100718639 3300005367 Bacteria 925
53 Ga0070703_10026057 3300005406 Bacteria 1737
54 Ga0070714_100022510 3300005435 Bacteria 5168
55 Ga0070701_10026588 3300005438 Bacteria 2823
56 Ga0070701_10389120 3300005438 Bacteria 881
57 Ga0070701_10590768 3300005438 Bacteria 734
58 Ga0070711_100168159 3300005439 Bacteria 1668
59 Ga0070705_100087806 3300005440 Bacteria 1929
60 Ga0070705_100158158 3300005440 Bacteria 1512
61 Ga0070705_101009227 3300005440 Bacteria 676
62 Ga0070700_100079928 3300005441 Bacteria 2108
63 Ga0070700_100101761 3300005441 Bacteria 1894
64 Ga0070694_100000309 3300005444 Bacteria 26248
65 Ga0070694_100647578 3300005444 Bacteria 855
66 Ga0070694_100841287 3300005444 Bacteria 755
67 Ga0070694_100894379 3300005444 Bacteria 733
68 Ga0070708_100111872 3300005445 Bacteria 2511
69 Ga0070708_100169717 3300005445 Bacteria 2036
70 Ga0070678_100067704 3300005456 Bacteria 2659
71 Ga0070678_101382683 3300005456 Unclassified 657
72 Ga0070662_100103567 3300005457 Bacteria 2158
73 Ga0070662_100740451 3300005457 Bacteria 833
74 Ga0068867_100126289 3300005459 Bacteria 1983
75 Ga0068867_100261262 3300005459 Bacteria 1412
76 Ga0070706_100168985 3300005467 Bacteria 2042
77 Ga0070706_100522003 3300005467 Bacteria 1105
78 Ga0070707_100129978 3300005468 Unclassified 2449
79 Ga0070698_100127266 3300005471 Bacteria 2504
80 Ga0070698_100383076 3300005471 Bacteria 1339
81 Ga0070699_100198252 3300005518 Bacteria 1785
82 Ga0070699_100210476 3300005518 Unclassified 1731
83 Ga0070699_100222351 3300005518 Bacteria 1683
84 Ga0070679_100377228 3300005530 Bacteria 1365
85 Ga0070684_100001322 3300005535 Bacteria 17760
86 Ga0070697_101696791 3300005536 Archaea 565
87 Ga0068853_100202415 3300005539 Bacteria 1807
88 Ga0068853_100620408 3300005539 Unclassified 1028
89 Ga0070672_100000975 3300005543 Bacteria 17304
90 Ga0070672_100181940 3300005543 Bacteria 1752
91 Ga0070686_100060487 3300005544 Bacteria 2444
92 Ga0070686_100116802 3300005544 Bacteria 1826
93 Ga0070686_100348055 3300005544 Bacteria 1112
94 Ga0070686_100413274 3300005544 Bacteria 1029
95 Ga0070695_100056174 3300005545 Bacteria 2540
96 Ga0070695_100102616 3300005545 Unclassified 1929
97 Ga0070695_100192206 3300005545 Bacteria 1453
98 Ga0070695_100622080 3300005545 Bacteria 850
99 Ga0070696_100053636 3300005546 Bacteria 2807
100 Ga0070696_100082859 3300005546 Bacteria 2274
101 Ga0070696_100139645 3300005546 Archaea 1770
102 Ga0070696_100248651 3300005546 Bacteria 1344
103 Ga0070693_100073251 3300005547 Bacteria 2023
104 Ga0070693_100151364 3300005547 Unclassified 1470
105 Ga0070704_100053245 3300005549 Bacteria 2860
106 Ga0070704_100071052 3300005549 Bacteria 2527
107 Ga0070704_100305317 3300005549 Bacteria 1327
108 Ga0070704_101155392 3300005549 Bacteria 705
109 Ga0068855_100243776 3300005563 Bacteria 2007
110 Ga0070664_100003797 3300005564 Bacteria 12192
111 Ga0070664_100368578 3300005564 Bacteria 1309
112 Ga0068857_100307303 3300005577 Bacteria 1463
113 Ga0068857_101218371 3300005577 Bacteria 729
114 Ga0068857_101349494 3300005577 Bacteria 693
115 Ga0068854_100154611 3300005578 Bacteria 1771
116 Ga0070702_100258950 3300005615 Archaea 1183
117 Ga0068859_100012967 3300005617 Bacteria 8374
118 Ga0068859_100582451 3300005617 Archaea 1212
119 Ga0068859_101100904 3300005617 Bacteria 874
120 Ga0068864_100118295 3300005618 Bacteria 2366
121 Ga0068864_100837637 3300005618 Bacteria 906
122 Ga0068861_100084366 3300005719 Bacteria 2494
123 Ga0068861_100197849 3300005719 Unclassified 1685
124 Ga0068861_101221600 3300005719 Bacteria 728
125 Ga0068861_101340621 3300005719 Bacteria 697
126 Ga0068863_100048453 3300005841 Bacteria 4029
127 Ga0068863_100208570 3300005841 Bacteria 1881
128 Ga0068863_100483577 3300005841 Bacteria 1218
129 Ga0068858_100009344 3300005842 Bacteria 9362
130 Ga0068858_100074731 3300005842 Bacteria 3147
131 Ga0068858_100347482 3300005842 Archaea 1420
132 Ga0068858_100894936 3300005842 Unclassified 868
133 Ga0068860_100033966 3300005843 Bacteria 4893
134 Ga0068860_100467684 3300005843 Bacteria 1255
135 Ga0068862_100017921 3300005844 Bacteria 5897
136 Ga0068862_101221555 3300005844 Bacteria 751
137 Ga0068862_101693639 3300005844 Bacteria 640
138 Ga0081455_10000468 3300005937 Bacteria 52454
139 Ga0081455_10186886 3300005937 Bacteria 1564
140 Ga0081540_1003419 3300005983 Bacteria 12553
141 Ga0075365_10046282 3300006038 Bacteria 2856
142 Ga0075365_10276285 3300006038 Bacteria 1182
143 Ga0075368_10007092 3300006042 Bacteria 3945
144 Ga0075364_10006402 3300006051 Bacteria 6922
145 Ga0075364_10035040 3300006051 Bacteria 3242
146 Ga0075364_10117120 3300006051 Bacteria 1781
147 Ga0070716_100273058 3300006173 Bacteria 1163
148 Ga0075362_10002551 3300006177 Bacteria 6149
149 Ga0075362_10307384 3300006177 Bacteria 788
150 Ga0075367_10007720 3300006178 Bacteria 5530
151 Ga0075367_10025548 3300006178 Bacteria 3341
152 Ga0075367_10364994 3300006178 Bacteria 912
153 Ga0075369_10122379 3300006186 Unclassified 1179
154 Ga0075366_10028823 3300006195 Bacteria 3260
155 Ga0075366_10039216 3300006195 Bacteria 2800
156 Ga0075366_10077022 3300006195 Bacteria 1990
157 Ga0075366_10133149 3300006195 Bacteria 1501
158 Ga0097621_100876589 3300006237 Archaea 835
159 Ga0075370_10006370 3300006353 Bacteria 5928
160 Ga0075428_100033177 3300006844 Bacteria 5701
161 Ga0075428_100038016 3300006844 Bacteria 5297
162 Ga0075428_100402113 3300006844 Bacteria 1468
163 Ga0075428_101116186 3300006844 Bacteria 833
164 Ga0075430_100005106 3300006846 Bacteria 11049
165 Ga0075430_100044620 3300006846 Bacteria 3748
166 Ga0075430_100170221 3300006846 Bacteria 1812
167 Ga0075431_100038544 3300006847 Bacteria 4921
168 Ga0075431_100040127 3300006847 Bacteria 4823
169 Ga0075431_100173125 3300006847 Bacteria 2218
170 Ga0075431_100195543 3300006847 Bacteria 2071
171 Ga0075433_10008060 3300006852 Bacteria 8386
172 Ga0075433_10027392 3300006852 Bacteria 4834
173 Ga0075433_10103807 3300006852 Bacteria 2518
174 Ga0075433_10622873 3300006852 Unclassified 947
175 Ga0075433_10660420 3300006852 Bacteria 916
176 Ga0075434_100189444 3300006871 Bacteria 2077
177 Ga0075434_100275519 3300006871 Archaea 1702
178 Ga0075434_100642262 3300006871 Bacteria 1080
179 Ga0075429_100003439 3300006880 Bacteria 13510
180 Ga0075429_100008576 3300006880 Bacteria 8894
181 Ga0075429_100064682 3300006880 Bacteria 3185
182 Ga0075429_100096531 3300006880 Bacteria 2578
183 Ga0068865_100100240 3300006881 Bacteria 2119
184 Ga0068865_100325432 3300006881 Bacteria 1238
185 Ga0068865_100861007 3300006881 Bacteria 786
186 Ga0075436_100041569 3300006914 Bacteria 3172
187 Ga0075436_100041665 3300006914 Bacteria 3168
188 Ga0097620_100012967 3300006931 Bacteria 8374
189 Ga0097620_100582434 3300006931 Archaea 1212
190 Ga0097620_101101012 3300006931 Bacteria 874
191 Ga0097620_101242537 3300006931 Bacteria 821
192 Ga0097620_101458582 3300006931 Bacteria 755
193 Ga0075435_100005011 3300007076 Bacteria 9193
194 Ga0075435_100022575 3300007076 Bacteria 4855
195 Ga0075435_100127266 3300007076 Bacteria 2130
196 Ga0075435_100173030 3300007076 Bacteria 1822
197 Ga0105240_10217787 3300009093 Bacteria 2226
198 Ga0105240_11557804 3300009093 Bacteria 692
199 Ga0111539_10004273 3300009094 Bacteria 18702
200 Ga0111539_10009869 3300009094 Bacteria 12047
201 Ga0111539_10009968 3300009094 Bacteria 11977
202 Ga0111539_10079007 3300009094 Bacteria 3869
203 Ga0111539_10150707 3300009094 Bacteria 2722
204 Ga0111539_10171996 3300009094 Bacteria 2530
205 Ga0111539_10248007 3300009094 Bacteria 2073
206 Ga0111539_10280111 3300009094 Bacteria 1940
207 Ga0111539_11377817 3300009094 Unclassified 818
208 Ga0111539_11510739 3300009094 Bacteria 779
209 Ga0111539_11540199 3300009094 Bacteria 771
210 Ga0105245_10087393 3300009098 Bacteria 2861
211 Ga0105245_10169351 3300009098 Bacteria 2079
212 Ga0105245_10304171 3300009098 Bacteria 1566
213 Ga0105245_11207876 3300009098 Bacteria 804
214 Ga0105247_10057237 3300009101 Archaea 2410
215 Ga0105247_10326035 3300009101 Bacteria 1073
216 Ga0114129_10000986 3300009147 Bacteria 37220
217 Ga0114129_10005024 3300009147 Bacteria 18611
218 Ga0114129_10009698 3300009147 Bacteria 13741
219 Ga0114129_10035570 3300009147 Bacteria 7037
220 Ga0114129_10282004 3300009147 Bacteria 2219
221 Ga0114129_10723588 3300009147 Bacteria 1277
222 Ga0114129_10817458 3300009147 Bacteria 1187
223 Ga0114129_11109095 3300009147 Unclassified 990
224 Ga0105243_10011250 3300009148 Bacteria 6768
225 Ga0105243_10180890 3300009148 Bacteria 1833
226 Ga0105243_10388136 3300009148 Bacteria 1293
227 Ga0105243_11542495 3300009148 Bacteria 689
228 Ga0105242_10033972 3300009176 Bacteria 4087
229 Ga0105242_10054602 3300009176 Bacteria 3266
230 Ga0105242_10166039 3300009176 Bacteria 1937
231 Ga0105248_10041333 3300009177 Bacteria 5169
232 Ga0105248_10054401 3300009177 Bacteria 4488
233 Ga0105248_10609746 3300009177 Bacteria 1231
234 Ga0105248_10945814 3300009177 Bacteria 973
235 Ga0105237_12001898 3300009545 Bacteria 588
236 Ga0105249_10002401 3300009553 Bacteria 16277
237 Ga0105249_10115780 3300009553 Bacteria 2540
238 Ga0105249_10119231 3300009553 Unclassified 2505
239 Ga0105249_10214081 3300009553 Bacteria 1892
240 Ga0105249_10336982 3300009553 Bacteria 1524
241 Ga0105249_10356603 3300009553 Bacteria 1483
242 Ga0105249_11374935 3300009553 Unclassified 778
243 Ga0105249_11398286 3300009553 Bacteria 772
244 Ga0105249_11805612 3300009553 Unclassified 684
245 Ga0105239_10183125 3300010375 Bacteria 2344
246 Ga0105239_12065424 3300010375 Bacteria 662
247 Ga0105246_11051221 3300011119 Bacteria 740
248 Ga0157370_10661856 3300013104 Bacteria 954
249 Ga0157369_10259756 3300013105 Bacteria 1811
250 Ga0157374_10029354 3300013296 Bacteria 4979
251 Ga0157374_10136353 3300013296 Bacteria 2380
252 Ga0157378_10611502 3300013297 Archaea 1102
253 Ga0163162_10043720 3300013306 Bacteria 4486
254 Ga0163162_10061570 3300013306 Bacteria 3791
255 Ga0163162_10087923 3300013306 Bacteria 3187
256 Ga0163162_10939614 3300013306 Bacteria 976
257 Ga0157372_10224507 3300013307 Bacteria 2178
258 Ga0157372_10605340 3300013307 Unclassified 1277
259 Ga0157375_10142652 3300013308 Bacteria 2523
260 Ga0157375_10196667 3300013308 Bacteria 2171
261 Ga0157375_10713963 3300013308 Bacteria 1156
262 Ga0163163_10000206 3300014325 Bacteria 60942
263 Ga0157380_10013573 3300014326 Bacteria 5946
264 Ga0157380_10022763 3300014326 Bacteria 4724
265 Ga0157380_10044560 3300014326 Bacteria 3478
266 Ga0157380_10059140 3300014326 Unclassified 3057
267 Ga0157380_10569244 3300014326 Bacteria 1115
268 Ga0157380_10733791 3300014326 Bacteria 997
269 Ga0157380_10997424 3300014326 Bacteria 871
270 Ga0157380_11071180 3300014326 Bacteria 844
271 Ga0157380_11282861 3300014326 Unclassified 779
272 Ga0157377_10191580 3300014745 Bacteria 1292
273 Ga0157377_10299748 3300014745 Bacteria 1060
274 Ga0157379_10061269 3300014968 Bacteria 3364
275 Ga0157379_10076115 3300014968 Bacteria 3005
276 Ga0157379_10578045 3300014968 Archaea 1047
277 Ga0157376_10073967 3300014969 Bacteria 2904
278 Ga0157376_10246629 3300014969 Unclassified 1666
279 Ga0157376_10616925 3300014969 Archaea 1081
280 Ga0206353_10782449 3300020082 Unclassified 1214
281 Ga0207697_10033273 3300025315 Bacteria 2110
282 Ga0207697_10041434 3300025315 Bacteria 1891
283 Ga0207653_10042123 3300025885 Unclassified 1501
284 Ga0207682_10121905 3300025893 Archaea 1157
285 Ga0207682_10300993 3300025893 Bacteria 752
286 Ga0207682_10332275 3300025893 Bacteria 715
287 Ga0207688_10065989 3300025901 Archaea 2046
288 Ga0207680_10205755 3300025903 Archaea 1343
289 Ga0207680_10476220 3300025903 Bacteria 888
290 Ga0207645_10007481 3300025907 Bacteria 7708
291 Ga0207643_10228535 3300025908 Bacteria 1141
292 Ga0207684_10428482 3300025910 Bacteria 1136
293 Ga0207684_10433584 3300025910 Bacteria 1129
294 Ga0207654_10890813 3300025911 Unclassified 645
295 Ga0207663_10563761 3300025916 Bacteria 891
296 Ga0207660_10089407 3300025917 Bacteria 2280
297 Ga0207662_10002282 3300025918 Bacteria 9597
298 Ga0207662_10590270 3300025918 Unclassified 772
299 Ga0207657_10170165 3300025919 Bacteria 1765
300 Ga0207657_10684988 3300025919 Unclassified 797
301 Ga0207649_10120941 3300025920 Bacteria 1765
302 Ga0207649_10782585 3300025920 Bacteria 744
303 Ga0207652_10207561 3300025921 Bacteria 1763
304 Ga0207652_10691448 3300025921 Unclassified 910
305 Ga0207646_10261132 3300025922 Bacteria 1565
306 Ga0207681_10006746 3300025923 Bacteria 7046
307 Ga0207681_10014690 3300025923 Bacteria 4874
308 Ga0207681_10113348 3300025923 Bacteria 1976
309 Ga0207650_10356465 3300025925 Bacteria 1204
310 Ga0207659_10539570 3300025926 Unclassified 990
311 Ga0207659_10560303 3300025926 Bacteria 972
312 Ga0207687_10087206 3300025927 Bacteria 2268
313 Ga0207687_10548442 3300025927 Unclassified 970
314 Ga0207644_10288626 3300025931 Bacteria 1319
315 Ga0207690_10119993 3300025932 Bacteria 1908
316 Ga0207690_10162280 3300025932 Bacteria 1667
317 Ga0207690_10471026 3300025932 Bacteria 1012
318 Ga0207706_10123649 3300025933 Bacteria 2276
319 Ga0207706_10163520 3300025933 Bacteria 1956
320 Ga0207706_10292257 3300025933 Unclassified 1421
321 Ga0207706_10534029 3300025933 Bacteria 1011
322 Ga0207686_10195072 3300025934 Bacteria 1446
323 Ga0207670_10010479 3300025936 Bacteria 5344
324 Ga0207670_10614342 3300025936 Unclassified 894
325 Ga0207670_11442055 3300025936 Bacteria 585
326 Ga0207669_10178325 3300025937 Bacteria 1520
327 Ga0207669_10230812 3300025937 Bacteria 1365
328 Ga0207669_10293328 3300025937 Bacteria 1232
329 Ga0207669_10717735 3300025937 Bacteria 823
330 Ga0207669_10980453 3300025937 Unclassified 709
331 Ga0207665_10168652 3300025939 Bacteria 1579
332 Ga0207691_10046769 3300025940 Bacteria 3974
333 Ga0207691_10562817 3300025940 Bacteria 966
334 Ga0207711_10009176 3300025941 Bacteria 8262
335 Ga0207711_10595727 3300025941 Bacteria 1031
336 Ga0207689_10375989 3300025942 Unclassified 1183
337 Ga0207661_10003532 3300025944 Bacteria 10859
338 Ga0207679_10093044 3300025945 Bacteria 2337
339 Ga0207679_10365241 3300025945 Bacteria 1262
340 Ga0207679_10493906 3300025945 Unclassified 1091
341 Ga0207651_10003115 3300025960 Bacteria 8065
342 Ga0207651_10062419 3300025960 Bacteria 2597
343 Ga0207651_10261504 3300025960 Bacteria 1421
344 Ga0207651_10781744 3300025960 Bacteria 845
345 Ga0207712_10735092 3300025961 Unclassified 863
346 Ga0207640_10014062 3300025981 Bacteria 4600
347 Ga0207658_10140060 3300025986 Archaea 1956
348 Ga0207677_10073747 3300026023 Bacteria 2418
349 Ga0207677_10323273 3300026023 Archaea 1283
350 Ga0207703_10108449 3300026035 Bacteria 2365
351 Ga0207703_10124510 3300026035 Bacteria 2217
352 Ga0207703_10384352 3300026035 Bacteria 1299
353 Ga0207703_10412559 3300026035 Bacteria 1255
354 Ga0207703_10883653 3300026035 Bacteria 855
355 Ga0207639_10246559 3300026041 Bacteria 1556
356 Ga0207678_11031294 3300026067 Bacteria 728
357 Ga0207708_10114387 3300026075 Bacteria 2097
358 Ga0207708_10279719 3300026075 Bacteria 1352
359 Ga0207708_10351460 3300026075 Bacteria 1209
360 Ga0207708_10708576 3300026075 Bacteria 861
361 Ga0207702_11415584 3300026078 Unclassified 689
362 Ga0207641_10027144 3300026088 Bacteria 4728
363 Ga0207641_10091770 3300026088 Bacteria 2658
364 Ga0207641_10145038 3300026088 Bacteria 2146
365 Ga0207641_10232842 3300026088 Bacteria 1713
366 Ga0207648_10161450 3300026089 Bacteria 1979
367 Ga0207676_10439270 3300026095 Bacteria 1228
368 Ga0207676_10529081 3300026095 Bacteria 1123
369 Ga0207676_10934122 3300026095 Bacteria 852
370 Ga0207675_100059045 3300026118 Bacteria 3580
371 Ga0207675_100203952 3300026118 Bacteria 1900
372 Ga0207675_100311503 3300026118 Unclassified 1535
373 Ga0207675_100349408 3300026118 Bacteria 1449
374 Ga0207675_100580812 3300026118 Bacteria 1122
375 Ga0207683_10040941 3300026121 Bacteria 4045
376 Ga0207683_10216595 3300026121 Bacteria 1744
377 Ga0207683_10368101 3300026121 Unclassified 1320
378 Ga0207683_10397443 3300026121 Archaea 1268
379 Ga0207698_10046576 3300026142 Bacteria 3276
380 Ga0209813_10091046 3300027866 Unclassified 1024
381 Ga0209974_10041346 3300027876 Bacteria 1534
382 Ga0207428_10008395 3300027907 Bacteria 9326
383 Ga0207428_10021520 3300027907 Bacteria 5460
384 Ga0207428_10028395 3300027907 Bacteria 4648
385 Ga0207428_10108839 3300027907 Bacteria 2134
386 Ga0207428_10150018 3300027907 Bacteria 1775
387 Ga0268266_10033597 3300028379 Bacteria 4360
388 Ga0268265_10006736 3300028380 Bacteria 7776
389 Ga0268265_10041536 3300028380 Unclassified 3405
390 Ga0268265_10401011 3300028380 Bacteria 1268
391 Ga0268265_10645270 3300028380 Bacteria 1017
392 Ga0268265_10989894 3300028380 Bacteria 830
393 Ga0268264_11028300 3300028381 Unclassified 831
394 Ga0307408_100009320 3300031548 Bacteria 6471
395 Ga0307408_100012248 3300031548 Bacteria 5678
396 Ga0316576_10312661 3300031727 Bacteria 1173
397 Ga0307405_10052337 3300031731 Bacteria 2538
398 Ga0307413_10144868 3300031824 Bacteria 1647
399 Ga0307413_11836469 3300031824 Archaea 543
400 Ga0307410_10337053 3300031852 Bacteria 1201
401 Ga0307410_10886151 3300031852 Bacteria 764
402 Ga0307406_10998999 3300031901 Bacteria 718
403 Ga0307407_10295112 3300031903 Bacteria 1128
404 Ga0307407_10311900 3300031903 Bacteria 1101
405 Ga0307409_100185022 3300031995 Bacteria 1848
406 Ga0307409_100435299 3300031995 Bacteria 1262
407 Ga0307409_100485322 3300031995 Bacteria 1200
408 Ga0307409_100943563 3300031995 Archaea 878
409 Ga0307409_101359795 3300031995 Bacteria 736
410 Ga0307416_100021269 3300032002 Bacteria 4653
411 Ga0307416_100223142 3300032002 Unclassified 1809
412 Ga0307416_100271414 3300032002 Bacteria 1665
413 Ga0307416_100413009 3300032002 Bacteria 1391
414 Ga0307416_100446361 3300032002 Bacteria 1345
415 Ga0307416_101130681 3300032002 Bacteria 888
416 Ga0307416_101238474 3300032002 Bacteria 852
417 Ga0307416_102362512 3300032002 Bacteria 631
418 Ga0307414_10091122 3300032004 Bacteria 2265
419 Ga0307411_10262973 3300032005 Unclassified 1363
420 Ga0307411_10682170 3300032005 Bacteria 893
421 Ga0307415_100065420 3300032126 Bacteria 2533
422 Ga0373944_0122634 3300035089 Unclassified 897
423 Ga0373932_0105112 3300035112 Archaea 924
424 Ga0373936_0227583 3300035113 Bacteria 829
425 Ga0373945_0269483 3300035116 Unclassified 723
426 Ga0373953_0085287 3300035117 Bacteria 1317
427 Ga0373954_0127875 3300035118 Bacteria 1236
428 Ga0373954_0137744 3300035118 Bacteria 1190
429 Ga0373956_0168515 3300035119 Bacteria 1033
430 Ga0373957_0044112 3300035120 Archaea 1687
431 Ga0373957_0277334 3300035120 Bacteria 708
432 Ga0373957_0451993 3300035120 Bacteria 556
433 Ga0373943_0065245 3300035170 Bacteria 1830
434 Ga0373946_0046607 3300035171 Bacteria 1797
435 Ga0373955_0009453 3300035172 Bacteria 4565
436 Ga0373955_0216939 3300035172 Bacteria 1142
437 Ga0373924_0002552 3300035410 Bacteria 6148
438 Ga0373931_0114212 3300035691 Archaea 1536
439 Ga0373935_0007700 3300035692 Bacteria 6456
440 Ga0373927_0226543 3300035695 Bacteria 1228
441 Ga0373933_0037962 3300035724 Bacteria 2829
442 Ga0373947_0029148 3300035725 Bacteria 3237
443 Ga0373937_0000136 3300036401 Bacteria 71049
444 Ga0373937_0252336 3300036401 Bacteria 1663
445 Ga0373925_0160671 3300037068 Bacteria 1769
446 Ga0395900_0076846 3300037418 Bacteria 3431
447 Ga0395898_0005528 3300037466 Bacteria 13636
448 Ga0439453_0010647 3300041408 Bacteria 1521
449 Ga0451851_0695081 3300041507 Bacteria 594
450 Ga0439463_092433 3300042016 Bacteria 779
451 Ga0439446_0312455 3300042156 Bacteria 554
452 Ga0439435_0005608 3300042436 Bacteria 2771
453 Ga0439435_0025982 3300042436 Bacteria 1556
454 Ga0439464_0009309 3300042439 Bacteria 2584
455 Ga0439460_0256051 3300042461 Unclassified 606
456 Ga0451577_0620669 3300042876 Bacteria 981
457 Ga0453684_0697332 3300044712 Bacteria 1104
458 Ga0451576_0163446 3300045051 Bacteria 2323
459 Ga0495592_0024074 3300046454 Bacteria 4630
460 Ga0495629_0001184 3300046459 Bacteria 20566
461 Ga0495641_0246406 3300046461 Bacteria 803
462 Ga0495580_0034211 3300046472 Bacteria 3659
463 Ga0495594_0349169 3300046499 Bacteria 842
464 Ga0495587_0093390 3300046536 Bacteria 1737
465 Ga0495587_0162895 3300046536 Bacteria 1269
466 Ga0495587_0244622 3300046536 Bacteria 1009
467 Ga0495645_0125835 3300046543 Archaea 1800
468 Ga0495667_0338253 3300046559 Bacteria 952
469 Ga0495634_0341889 3300046642 Bacteria 897
470 Ga0495635_0727692 3300046663 Bacteria 642
471 Ga0495659_0363195 3300046664 Unclassified 620
472 Ga0495658_0025952 3300046683 Bacteria 3136
473 Ga0495658_0068786 3300046683 Bacteria 2051
474 Ga0495658_0075974 3300046683 Bacteria 1962
475 Ga0495658_0209297 3300046683 Bacteria 1218
476 Ga0495658_0234332 3300046683 Bacteria 1152
477 Ga0495581_0260580 3300047315 Unclassified 1014
478 Ga0495604_0066523 3300047317 Bacteria 2741
479 Ga0495676_0116464 3300047321 Bacteria 1951
480 Ga0495680_0261171 3300047322 Bacteria 1225
481 Ga0495680_0366169 3300047322 Bacteria 1001
482 Ga0495675_0060115 3300047444 Bacteria 2409
483 Ga0496101_0868254 3300048904 Bacteria 711
484 Ga0496102_0290178 3300048905 Bacteria 1542
485 Ga0496104_0473750 3300048907 Bacteria 1163
486 Ga0496107_0838277 3300048910 Unclassified 672
487 Ga0496108_0006008 3300048911 Bacteria 9832
488 Ga0496109_0485132 3300048912 Bacteria 1167
489 Ga0496109_0600631 3300048912 Bacteria 1036
490 Ga0496109_0836453 3300048912 Bacteria 858
491 Ga0496110_0017261 3300048913 Bacteria 6037
492 Ga0496110_0628623 3300048913 Bacteria 973
493 Ga0496112_0025422 3300048915 Bacteria 5686
494 Ga0496112_0388768 3300048915 Bacteria 1335
495 Ga0496114_0091922 3300048917 Bacteria 2578
496 Ga0496114_0572404 3300048917 Bacteria 997
497 Ga0496115_0174175 3300048918 Archaea 1779
498 Ga0501295_040642 3300049518 Bacteria 963
499 Ga0501299_011515 3300049522 Bacteria 1495
500 Ga0501034_0021191 3300049571 Bacteria 6628
501 Ga0501034_0050539 3300049571 Bacteria 4193
502 Ga0501036_0030493 3300049572 Bacteria 4554
503 Ga0501037_0266588 3300049573 Archaea 1196
504 Ga0501038_0030371 3300049574 Bacteria 4783
505 Ga0501038_0300575 3300049574 Bacteria 1260
506 Ga0501038_0979588 3300049574 Bacteria 621
507 Ga0501039_0770136 3300049575 Bacteria 751
508 Ga0501040_0122365 3300049576 Bacteria 1826
509 Ga0501040_0122816 3300049576 Unclassified 1823
510 Ga0501040_0219114 3300049576 Bacteria 1354
511 Ga0501040_0402110 3300049576 Bacteria 983
512 Ga0501041_0018310 3300049577 Bacteria 4172
513 Ga0501041_0068535 3300049577 Bacteria 2175
514 Ga0501041_0872813 3300049577 Bacteria 578
515 Ga0501042_0186354 3300049578 Bacteria 1497
516 Ga0501042_0438034 3300049578 Unclassified 948
517 Ga0501043_0029968 3300049579 Archaea 4275
518 Ga0501046_0003304 3300049580 Bacteria 14814
519 Ga0501046_0227662 3300049580 Bacteria 1379
520 Ga0501046_1059831 3300049580 Bacteria 561
521 Ga0501048_0087609 3300049582 Bacteria 2196
522 Ga0501048_0345932 3300049582 Bacteria 1060
523 Ga0501048_0874896 3300049582 Unclassified 646
524 Ga0501048_0936592 3300049582 Bacteria 623
525 Ga0501071_0194996 3300049587 Unclassified 1520
526 Ga0501071_0331362 3300049587 Bacteria 1157
527 Ga0501071_0528793 3300049587 Unclassified 905
528 Ga0501072_0026932 3300049588 Bacteria 4486
529 Ga0501072_0047495 3300049588 Bacteria 3380
530 Ga0501072_0286496 3300049588 Bacteria 1310
531 Ga0501072_0490270 3300049588 Bacteria 972
532 Ga0501073_0242551 3300049589 Bacteria 1244
533 Ga0501073_0584038 3300049589 Bacteria 772
534 Ga0501074_0239593 3300049590 Bacteria 1290
535 Ga0501074_0315688 3300049590 Bacteria 1110
536 Ga0501074_0425720 3300049590 Archaea 941
537 Ga0501075_0024285 3300049591 Archaea 4442
538 Ga0501075_0070100 3300049591 Bacteria 2650
539 Ga0501075_0252224 3300049591 Bacteria 1345
540 Ga0501075_0306820 3300049591 Unclassified 1209
541 Ga0501075_0371461 3300049591 Bacteria 1090
542 Ga0501075_0516799 3300049591 Unclassified 911
543 Ga0501076_0000425 3300049592 Bacteria 26599
544 Ga0501076_0045449 3300049592 Bacteria 3467
545 Ga0501076_0060701 3300049592 Bacteria 3008
546 Ga0501076_0682804 3300049592 Bacteria 848
547 Ga0501076_0686828 3300049592 Bacteria 845
548 Ga0501076_0861684 3300049592 Bacteria 747
549 Ga0501077_0103795 3300049593 Archaea 1801
550 Ga0501077_0201947 3300049593 Bacteria 1263
551 Ga0501208_028134 3300049655 Bacteria 974
552 Ga0501216_058874 3300049660 Bacteria 771
553 Ga0501249_088173 3300049679 Bacteria 734
554 Ga0501225_0016305 3300049705 Bacteria 2066
555 Ga0501079_0004540 3300049741 Bacteria 10297
556 Ga0501079_0208643 3300049741 Bacteria 1526
557 Ga0501079_0799575 3300049741 Bacteria 742
558 Ga0501080_0098794 3300049742 Unclassified 2709
559 Ga0501080_0165926 3300049742 Bacteria 2038
560 Ga0501080_1238729 3300049742 Bacteria 640
561 Ga0501081_0024515 3300049743 Bacteria 4050
562 Ga0501081_0032012 3300049743 Bacteria 3566
563 Ga0501081_0385774 3300049743 Unclassified 1036
564 Ga0501081_0606632 3300049743 Unclassified 819
565 Ga0501081_1063411 3300049743 Unclassified 612
566 Ga0501283_032961 3300049779 Bacteria 875
567 Ga0501045_0003707 3300049824 Bacteria 10510
568 Ga0501045_0052555 3300049824 Bacteria 2975
569 Ga0501045_0082480 3300049824 Unclassified 2371
570 Ga0501045_0220220 3300049824 Unclassified 1413
571 Ga0501045_0430362 3300049824 Unclassified 981
572 nmdc:mga03683_224540_c1 3300050489 Bacteria 867
573 nmdc:mga03683_2596_c1 3300050489 Bacteria 5641
574 nmdc:mga00v17_51555_c1 3300050491 Bacteria 2502
575 nmdc:mga00v17_758_c1 3300050491 Bacteria 17527
576 nmdc:mga00v17_92817_c1 3300050491 Bacteria 1898
577 nmdc:mga0k408_32959_c1 3300050493 Bacteria 2960
578 nmdc:mga0k408_42693_c1 3300050493 Bacteria 2612
579 nmdc:mga0k408_49549_c1 3300050493 Bacteria 2431
580 nmdc:mga06z11_64239_c1 3300050494 Bacteria 1923
581 nmdc:mga04h51_69343_c1 3300050495 Unclassified 1227
582 nmdc:mga07m45_571482_c1 3300050496 Bacteria 653
583 nmdc:mga05p37_106069_c1 3300050507 Bacteria 3456
584 nmdc:mga05p37_1236879_c1 3300050507 Bacteria 768
585 nmdc:mga05p37_1408_c1 3300050507 Bacteria 27981
586 nmdc:mga05p37_1963145_c1 3300050507 Unclassified 556
587 nmdc:mga05p37_1978430_c1 3300050507 Unclassified 552
588 nmdc:mga05p37_269106_c1 3300050507 Bacteria 2037
589 nmdc:mga05p37_30715_c1 3300050507 Bacteria 6556
590 nmdc:mga05p37_42020_c1 3300050507 Bacteria 3170
591 nmdc:mga05p37_6517_c1 3300050507 Bacteria 13770
592 nmdc:mga05p37_733811_c1 3300050507 Unclassified 1092
593 nmdc:mga05p37_850881_c1 3300050507 Bacteria 990
594 nmdc:mga09592_13460_c1 3300050508 Bacteria 6678
595 nmdc:mga09592_26523_c1 3300050508 Bacteria 4801
596 nmdc:mga09592_273731_c1 3300050508 Bacteria 1464
597 nmdc:mga09592_647_c1 3300050508 Bacteria 26527
598 nmdc:mga09592_88236_c1 3300050508 Bacteria 2649
599 nmdc:mga0qj67_17875_c1 3300050509 Bacteria 5397
600 nmdc:mga0qj67_300971_c1 3300050509 Bacteria 1299
601 nmdc:mga0qj67_797605_c1 3300050509 Bacteria 748
602 nmdc:mga06r32_165029_c1 3300050510 Bacteria 2198
603 nmdc:mga06r32_3019_c1 3300050510 Bacteria 15084
604 nmdc:mga06r32_36494_c1 3300050510 Bacteria 4645
605 nmdc:mga06r32_374062_c1 3300050510 Bacteria 1408
606 nmdc:mga06r32_50538_c1 3300050510 Bacteria 3977
607 nmdc:mga06r32_577026_c1 3300050510 Bacteria 1097
608 nmdc:mga06r32_96709_c1 3300050510 Bacteria 2892
609 nmdc:mga08y16_112418_c1 3300050511 Bacteria 2835
610 nmdc:mga08y16_177343_c1 3300050511 Bacteria 2213
611 nmdc:mga08y16_287199_c1 3300050511 Bacteria 1696
612 nmdc:mga08y16_299534_c1 3300050511 Bacteria 1658
613 nmdc:mga08y16_40958_c1 3300050511 Bacteria 4853
614 nmdc:mga08y16_54389_c1 3300050511 Bacteria 4183
615 nmdc:mga08y16_71354_c1 3300050511 Bacteria 3620
616 nmdc:mga08y16_799031_c1 3300050511 Bacteria 936
617 nmdc:mga08y16_839588_c1 3300050511 Bacteria 909
618 nmdc:mga08y16_852898_c1 3300050511 Bacteria 900
619 nmdc:mga08y16_945996_c1 3300050511 Bacteria 845
620 nmdc:mga0n895_15270_c1 3300050512 Bacteria 6997
621 nmdc:mga0n895_153906_c1 3300050512 Bacteria 2330
622 nmdc:mga0n895_163060_c1 3300050512 Bacteria 2261
623 nmdc:mga0n895_163471_c1 3300050512 Bacteria 2258
624 nmdc:mga0n895_252455_c1 3300050512 Archaea 1790
625 nmdc:mga0n895_593039_c1 3300050512 Unclassified 1111
626 nmdc:mga0n895_831743_c1 3300050512 Unclassified 912
627 nmdc:mga0rr50_14729_c1 3300050513 Bacteria 5141
628 nmdc:mga0rr50_3149_c1 3300050513 Bacteria 9426
629 nmdc:mga0rr50_398525_c1 3300050513 Unclassified 1162
630 nmdc:mga0rr50_4217_c1 3300050513 Bacteria 8405
631 nmdc:mga0rr50_5227_c1 3300050513 Bacteria 7723
632 nmdc:mga0rr50_65184_c1 3300050513 Bacteria 2758
633 nmdc:mga08x19_5500_c1 3300050514 Bacteria 7494
634 nmdc:mga0a205_109100_c1 3300050515 Bacteria 2666
635 nmdc:mga0a205_159985_c1 3300050515 Bacteria 2149
636 nmdc:mga0a205_174407_c1 3300050515 Bacteria 2046
637 nmdc:mga0a205_490820_c1 3300050515 Unclassified 1086
638 Ga0495601_0600550 3300053077 Bacteria 706
639 Ga0495595_0104527 3300053084 Bacteria 1369
640 Ga0495619_0100950 3300053085 Bacteria 1964
641 Ga0495619_0103710 3300053085 Bacteria 1938
642 Ga0495619_0368773 3300053085 Bacteria 993
643 Ga0500616_0000498 3300053153 Bacteria 50376
644 Ga0500645_001972 3300053730 Bacteria 9693
645 Ga0501084_0004141 3300054114 Bacteria 11821
646 Ga0501084_0182146 3300054114 Bacteria 1773
647 Ga0501084_0289961 3300054114 Bacteria 1382
648 Ga0501084_0290760 3300054114 Bacteria 1380
649 Ga0590071_005534 3300059421 Bacteria 3035
650 Ga0590074_002850 3300059423 Bacteria 2845
651 Ga0590075_002902 3300059424 Bacteria 4082
652 Ga0590075_006815 3300059424 Bacteria 2703
653 Ga0590077_000112 3300059426 Bacteria 21872
654 Ga0590077_010783 3300059426 Bacteria 1882
655 Ga0590077_031177 3300059426 Bacteria 1164
656 Ga0501082_0005220 3300060353 Bacteria 11294
657 Ga0501082_1035718 3300060353 Unclassified 718
658 Ga0501082_1310950 3300060353 Unclassified 632
659 Ga0530510_0000658 3300061734 Bacteria 22319
660 Ga0530510_0074166 3300061734 Bacteria 2470
661 Ga0530510_0313715 3300061734 Unclassified 1175
662 Ga0530510_0876171 3300061734 Bacteria 686
663 Ga0114129_10227923
664 JGI25405J52794_10003876
665 Ga0065704_10367406
666 Ga0065712_10080734
667 Ga0065712_10248216
668 Ga0065712_10669721
669 Ga0065715_10136338
670 Ga0065715_10485302
671 Ga0065707_10003097
672 Ga0065707_10012929
673 Ga0065707_10095779
674 Ga0065707_10162245
675 Ga0065707_10204508
676 Ga0070676_10053968
677 Ga0070690_100061335
678 Ga0070670_100151079
679 Ga0070670_100312409
680 Ga0070666_10192794
681 Ga0070680_100125337
682 Ga0070682_100511040
683 Ga0070660_100035719
684 Ga0070689_100217026
685 Ga0070689_100621325
686 Ga0070689_101044730
687 Ga0070687_100851360
688 Ga0070661_100048620
689 Ga0070661_100067498
690 Ga0070661_100679949
691 Ga0070692_10011870
692 Ga0070692_10068093
693 Ga0070692_10411969
694 Ga0070669_100007109
695 Ga0070669_100009945
696 Ga0070669_100024754
697 Ga0070669_100271726
698 Ga0070675_100000781
699 Ga0070675_100694573
700 Ga0070675_100805922
701 Ga0070675_101119383
702 Ga0070671_100060629
703 Ga0070674_100181429
704 Ga0070674_101077035
705 Ga0070673_100002008
706 Ga0070673_100125840
707 Ga0070673_100213711
708 Ga0070673_100263632
709 Ga0070688_100125159
710 Ga0070688_100303850
711 Ga0070659_100046529
712 Ga0070659_100664806
713 Ga0070667_100111494
714 Ga0070667_100718639
715 Ga0070703_10026057
716 Ga0070714_100022510
717 Ga0070701_10026588
718 Ga0070701_10389120
719 Ga0070701_10590768
720 Ga0070711_100168159
721 Ga0070705_100087806
722 Ga0070705_100158158
723 Ga0070705_101009227
724 Ga0070700_100079928
725 Ga0070700_100101761
726 Ga0070694_100000309
727 Ga0070694_100647578
728 Ga0070694_100841287
729 Ga0070694_100894379
730 Ga0070708_100111872
731 Ga0070708_100169717
732 Ga0070678_100067704
733 Ga0070678_101382683
734 Ga0070662_100103567
735 Ga0070662_100740451
736 Ga0068867_100126289
737 Ga0068867_100261262
738 Ga0070706_100168985
739 Ga0070706_100522003
740 Ga0070707_100129978
741 Ga0070698_100127266
742 Ga0070698_100383076
743 Ga0070699_100198252
744 Ga0070699_100210476
745 Ga0070699_100222351
746 Ga0070679_100377228
747 Ga0070684_100001322
748 Ga0070697_101696791
749 Ga0068853_100202415
750 Ga0068853_100620408
751 Ga0070672_100000975
752 Ga0070672_100181940
753 Ga0070686_100060487
754 Ga0070686_100116802
755 Ga0070686_100348055
756 Ga0070686_100413274
757 Ga0070695_100056174
758 Ga0070695_100102616
759 Ga0070695_100192206
760 Ga0070695_100622080
761 Ga0070696_100053636
762 Ga0070696_100082859
763 Ga0070696_100139645
764 Ga0070696_100248651
765 Ga0070693_100073251
766 Ga0070693_100151364
767 Ga0070704_100053245
768 Ga0070704_100071052
769 Ga0070704_100305317
770 Ga0070704_101155392
771 Ga0068855_100243776
772 Ga0070664_100003797
773 Ga0070664_100368578
774 Ga0068857_100307303
775 Ga0068857_101218371
776 Ga0068857_101349494
777 Ga0068854_100154611
778 Ga0070702_100258950
779 Ga0068859_100012967
780 Ga0068859_100582451
781 Ga0068859_101100904
782 Ga0068864_100118295
783 Ga0068864_100837637
784 Ga0068861_100084366
785 Ga0068861_100197849
786 Ga0068861_101221600
787 Ga0068861_101340621
788 Ga0068863_100048453
789 Ga0068863_100208570
790 Ga0068863_100483577
791 Ga0068858_100009344
792 Ga0068858_100074731
793 Ga0068858_100347482
794 Ga0068858_100894936
795 Ga0068860_100033966
796 Ga0068860_100467684
797 Ga0068862_100017921
798 Ga0068862_101221555
799 Ga0068862_101693639
800 Ga0081455_10000468
801 Ga0081455_10186886
802 Ga0081540_1003419
803 Ga0075365_10046282
804 Ga0075365_10276285
805 Ga0075368_10007092
806 Ga0075364_10006402
807 Ga0075364_10035040
808 Ga0075364_10117120
809 Ga0070716_100273058
810 Ga0075362_10002551
811 Ga0075362_10307384
812 Ga0075367_10007720
813 Ga0075367_10025548
814 Ga0075367_10364994
815 Ga0075369_10122379
816 Ga0075366_10028823
817 Ga0075366_10039216
818 Ga0075366_10077022
819 Ga0075366_10133149
820 Ga0097621_100876589
821 Ga0075370_10006370
822 Ga0075428_100033177
823 Ga0075428_100038016
824 Ga0075428_100402113
825 Ga0075428_101116186
826 Ga0075430_100005106
827 Ga0075430_100044620
828 Ga0075430_100170221
829 Ga0075431_100038544
830 Ga0075431_100040127
831 Ga0075431_100173125
832 Ga0075431_100195543
833 Ga0075433_10008060
834 Ga0075433_10027392
835 Ga0075433_10103807
836 Ga0075433_10622873
837 Ga0075433_10660420
838 Ga0075434_100189444
839 Ga0075434_100275519
840 Ga0075434_100642262
841 Ga0075429_100003439
842 Ga0075429_100008576
843 Ga0075429_100064682
844 Ga0075429_100096531
845 Ga0068865_100100240
846 Ga0068865_100325432
847 Ga0068865_100861007
848 Ga0075436_100041569
849 Ga0075436_100041665
850 Ga0097620_100012967
851 Ga0097620_100582434
852 Ga0097620_101101012
853 Ga0097620_101242537
854 Ga0097620_101458582
855 Ga0075435_100005011
856 Ga0075435_100022575
857 Ga0075435_100127266
858 Ga0075435_100173030
859 Ga0105240_10217787
860 Ga0105240_11557804
861 Ga0111539_10004273
862 Ga0111539_10009869
863 Ga0111539_10009968
864 Ga0111539_10079007
865 Ga0111539_10150707
866 Ga0111539_10171996
867 Ga0111539_10248007
868 Ga0111539_10280111
869 Ga0111539_11377817
870 Ga0111539_11510739
871 Ga0111539_11540199
872 Ga0105245_10087393
873 Ga0105245_10169351
874 Ga0105245_10304171
875 Ga0105245_11207876
876 Ga0105247_10057237
877 Ga0105247_10326035
878 Ga0114129_10000986
879 Ga0114129_10005024
880 Ga0114129_10009698
881 Ga0114129_10035570
882 Ga0114129_10282004
883 Ga0114129_10723588
884 Ga0114129_10817458
885 Ga0114129_11109095
886 Ga0105243_10011250
887 Ga0105243_10180890
888 Ga0105243_10388136
889 Ga0105243_11542495
890 Ga0105242_10033972
891 Ga0105242_10054602
892 Ga0105242_10166039
893 Ga0105248_10041333
894 Ga0105248_10054401
895 Ga0105248_10609746
896 Ga0105248_10945814
897 Ga0105237_12001898
898 Ga0105249_10002401
899 Ga0105249_10115780
900 Ga0105249_10119231
901 Ga0105249_10214081
902 Ga0105249_10336982
903 Ga0105249_10356603
904 Ga0105249_11374935
905 Ga0105249_11398286
906 Ga0105249_11805612
907 Ga0105239_10183125
908 Ga0105239_12065424
909 Ga0105246_11051221
910 Ga0157370_10661856
911 Ga0157369_10259756
912 Ga0157374_10029354
913 Ga0157374_10136353
914 Ga0157378_10611502
915 Ga0163162_10043720
916 Ga0163162_10061570
917 Ga0163162_10087923
918 Ga0163162_10939614
919 Ga0157372_10224507
920 Ga0157372_10605340
921 Ga0157375_10142652
922 Ga0157375_10196667
923 Ga0157375_10713963
924 Ga0163163_10000206
925 Ga0157380_10013573
926 Ga0157380_10022763
927 Ga0157380_10044560
928 Ga0157380_10059140
929 Ga0157380_10569244
930 Ga0157380_10733791
931 Ga0157380_10997424
932 Ga0157380_11071180
933 Ga0157380_11282861
934 Ga0157377_10191580
935 Ga0157377_10299748
936 Ga0157379_10061269
937 Ga0157379_10076115
938 Ga0157379_10578045
939 Ga0157376_10073967
940 Ga0157376_10246629
941 Ga0157376_10616925
942 Ga0206353_10782449
943 Ga0207697_10033273
944 Ga0207697_10041434
945 Ga0207653_10042123
946 Ga0207682_10121905
947 Ga0207682_10300993
948 Ga0207682_10332275
949 Ga0207688_10065989
950 Ga0207680_10205755
951 Ga0207680_10476220
952 Ga0207645_10007481
953 Ga0207643_10228535
954 Ga0207684_10428482
955 Ga0207684_10433584
956 Ga0207654_10890813
957 Ga0207663_10563761
958 Ga0207660_10089407
959 Ga0207662_10002282
960 Ga0207662_10590270
961 Ga0207657_10170165
962 Ga0207657_10684988
963 Ga0207649_10120941
964 Ga0207649_10782585
965 Ga0207652_10207561
966 Ga0207652_10691448
967 Ga0207646_10261132
968 Ga0207681_10006746
969 Ga0207681_10014690
970 Ga0207681_10113348
971 Ga0207650_10356465
972 Ga0207659_10539570
973 Ga0207659_10560303
974 Ga0207687_10087206
975 Ga0207687_10548442
976 Ga0207644_10288626
977 Ga0207690_10119993
978 Ga0207690_10162280
979 Ga0207690_10471026
980 Ga0207706_10123649
981 Ga0207706_10163520
982 Ga0207706_10292257
983 Ga0207706_10534029
984 Ga0207686_10195072
985 Ga0207670_10010479
986 Ga0207670_10614342
987 Ga0207670_11442055
988 Ga0207669_10178325
989 Ga0207669_10230812
990 Ga0207669_10293328
991 Ga0207669_10717735
992 Ga0207669_10980453
993 Ga0207665_10168652
994 Ga0207691_10046769
995 Ga0207691_10562817
996 Ga0207711_10009176
997 Ga0207711_10595727
998 Ga0207689_10375989
999 Ga0207661_10003532
1000 Ga0207679_10093044
1001 Ga0207679_10365241
1002 Ga0207679_10493906
1003 Ga0207651_10003115
1004 Ga0207651_10062419
1005 Ga0207651_10261504
1006 Ga0207651_10781744
1007 Ga0207712_10735092
1008 Ga0207640_10014062
1009 Ga0207658_10140060
1010 Ga0207677_10073747
1011 Ga0207677_10323273
1012 Ga0207703_10108449
1013 Ga0207703_10124510
1014 Ga0207703_10384352
1015 Ga0207703_10412559
1016 Ga0207703_10883653
1017 Ga0207639_10246559
1018 Ga0207678_11031294
1019 Ga0207708_10114387
1020 Ga0207708_10279719
1021 Ga0207708_10351460
1022 Ga0207708_10708576
1023 Ga0207702_11415584
1024 Ga0207641_10027144
1025 Ga0207641_10091770
1026 Ga0207641_10145038
1027 Ga0207641_10232842
1028 Ga0207648_10161450
1029 Ga0207676_10439270
1030 Ga0207676_10529081
1031 Ga0207676_10934122
1032 Ga0207675_100059045
1033 Ga0207675_100203952
1034 Ga0207675_100311503
1035 Ga0207675_100349408
1036 Ga0207675_100580812
1037 Ga0207683_10040941
1038 Ga0207683_10216595
1039 Ga0207683_10368101
1040 Ga0207683_10397443
1041 Ga0207698_10046576
1042 Ga0209813_10091046
1043 Ga0209974_10041346
1044 Ga0207428_10008395
1045 Ga0207428_10021520
1046 Ga0207428_10028395
1047 Ga0207428_10108839
1048 Ga0207428_10150018
1049 Ga0268266_10033597
1050 Ga0268265_10006736
1051 Ga0268265_10041536
1052 Ga0268265_10401011
1053 Ga0268265_10645270
1054 Ga0268265_10989894
1055 Ga0268264_11028300
1056 Ga0307408_100009320
1057 Ga0307408_100012248
1058 Ga0316576_10312661
1059 Ga0307405_10052337
1060 Ga0307413_10144868
1061 Ga0307413_11836469
1062 Ga0307410_10337053
1063 Ga0307410_10886151
1064 Ga0307406_10998999
1065 Ga0307407_10295112
1066 Ga0307407_10311900
1067 Ga0307409_100185022
1068 Ga0307409_100435299
1069 Ga0307409_100485322
1070 Ga0307409_100943563
1071 Ga0307409_101359795
1072 Ga0307416_100021269
1073 Ga0307416_100223142
1074 Ga0307416_100271414
1075 Ga0307416_100413009
1076 Ga0307416_100446361
1077 Ga0307416_101130681
1078 Ga0307416_101238474
1079 Ga0307416_102362512
1080 Ga0307414_10091122
1081 Ga0307411_10262973
1082 Ga0307411_10682170
1083 Ga0307415_100065420
1084 Ga0373944_0122634
1085 Ga0373932_0105112
1086 Ga0373936_0227583
1087 Ga0373945_0269483
1088 Ga0373953_0085287
1089 Ga0373954_0127875
1090 Ga0373954_0137744
1091 Ga0373956_0168515
1092 Ga0373957_0044112
1093 Ga0373957_0277334
1094 Ga0373957_0451993
1095 Ga0373943_0065245
1096 Ga0373946_0046607
1097 Ga0373955_0009453
1098 Ga0373955_0216939
1099 Ga0373924_0002552
1100 Ga0373931_0114212
1101 Ga0373935_0007700
1102 Ga0373927_0226543
1103 Ga0373933_0037962
1104 Ga0373947_0029148
1105 Ga0373937_0000136
1106 Ga0373937_0252336
1107 Ga0373925_0160671
1108 Ga0395900_0076846
1109 Ga0395898_0005528
1110 Ga0439453_0010647
1111 Ga0451851_0695081
1112 Ga0439463_092433
1113 Ga0439446_0312455
1114 Ga0439435_0005608
1115 Ga0439435_0025982
1116 Ga0439464_0009309
1117 Ga0439460_0256051
1118 Ga0451577_0620669
1119 Ga0453684_0697332
1120 Ga0451576_0163446
1121 Ga0495592_0024074
1122 Ga0495629_0001184
1123 Ga0495641_0246406
1124 Ga0495580_0034211
1125 Ga0495594_0349169
1126 Ga0495587_0093390
1127 Ga0495587_0162895
1128 Ga0495587_0244622
1129 Ga0495645_0125835
1130 Ga0495667_0338253
1131 Ga0495634_0341889
1132 Ga0495635_0727692
1133 Ga0495659_0363195
1134 Ga0495658_0025952
1135 Ga0495658_0068786
1136 Ga0495658_0075974
1137 Ga0495658_0209297
1138 Ga0495658_0234332
1139 Ga0495581_0260580
1140 Ga0495604_0066523
1141 Ga0495676_0116464
1142 Ga0495680_0261171
1143 Ga0495680_0366169
1144 Ga0495675_0060115
1145 Ga0496101_0868254
1146 Ga0496102_0290178
1147 Ga0496104_0473750
1148 Ga0496107_0838277
1149 Ga0496108_0006008
1150 Ga0496109_0485132
1151 Ga0496109_0600631
1152 Ga0496109_0836453
1153 Ga0496110_0017261
1154 Ga0496110_0628623
1155 Ga0496112_0025422
1156 Ga0496112_0388768
1157 Ga0496114_0091922
1158 Ga0496114_0572404
1159 Ga0496115_0174175
1160 Ga0501295_040642
1161 Ga0501299_011515
1162 Ga0501034_0021191
1163 Ga0501034_0050539
1164 Ga0501036_0030493
1165 Ga0501037_0266588
1166 Ga0501038_0030371
1167 Ga0501038_0300575
1168 Ga0501038_0979588
1169 Ga0501039_0770136
1170 Ga0501040_0122365
1171 Ga0501040_0122816
1172 Ga0501040_0219114
1173 Ga0501040_0402110
1174 Ga0501041_0018310
1175 Ga0501041_0068535
1176 Ga0501041_0872813
1177 Ga0501042_0186354
1178 Ga0501042_0438034
1179 Ga0501043_0029968
1180 Ga0501046_0003304
1181 Ga0501046_0227662
1182 Ga0501046_1059831
1183 Ga0501048_0087609
1184 Ga0501048_0345932
1185 Ga0501048_0874896
1186 Ga0501048_0936592
1187 Ga0501071_0194996
1188 Ga0501071_0331362
1189 Ga0501071_0528793
1190 Ga0501072_0026932
1191 Ga0501072_0047495
1192 Ga0501072_0286496
1193 Ga0501072_0490270
1194 Ga0501073_0242551
1195 Ga0501073_0584038
1196 Ga0501074_0239593
1197 Ga0501074_0315688
1198 Ga0501074_0425720
1199 Ga0501075_0024285
1200 Ga0501075_0070100
1201 Ga0501075_0252224
1202 Ga0501075_0306820
1203 Ga0501075_0371461
1204 Ga0501075_0516799
1205 Ga0501076_0000425
1206 Ga0501076_0045449
1207 Ga0501076_0060701
1208 Ga0501076_0682804
1209 Ga0501076_0686828
1210 Ga0501076_0861684
1211 Ga0501077_0103795
1212 Ga0501077_0201947
1213 Ga0501208_028134
1214 Ga0501216_058874
1215 Ga0501249_088173
1216 Ga0501225_0016305
1217 Ga0501079_0004540
1218 Ga0501079_0208643
1219 Ga0501079_0799575
1220 Ga0501080_0098794
1221 Ga0501080_0165926
1222 Ga0501080_1238729
1223 Ga0501081_0024515
1224 Ga0501081_0032012
1225 Ga0501081_0385774
1226 Ga0501081_0606632
1227 Ga0501081_1063411
1228 Ga0501283_032961
1229 Ga0501045_0003707
1230 Ga0501045_0052555
1231 Ga0501045_0082480
1232 Ga0501045_0220220
1233 Ga0501045_0430362
1234 nmdc:mga03683_224540_c1
1235 nmdc:mga03683_2596_c1
1236 nmdc:mga00v17_51555_c1
1237 nmdc:mga00v17_758_c1
1238 nmdc:mga00v17_92817_c1
1239 nmdc:mga0k408_32959_c1
1240 nmdc:mga0k408_42693_c1
1241 nmdc:mga0k408_49549_c1
1242 nmdc:mga06z11_64239_c1
1243 nmdc:mga04h51_69343_c1
1244 nmdc:mga07m45_571482_c1
1245 nmdc:mga05p37_106069_c1
1246 nmdc:mga05p37_1236879_c1
1247 nmdc:mga05p37_1408_c1
1248 nmdc:mga05p37_1963145_c1
1249 nmdc:mga05p37_1978430_c1
1250 nmdc:mga05p37_269106_c1
1251 nmdc:mga05p37_30715_c1
1252 nmdc:mga05p37_42020_c1
1253 nmdc:mga05p37_6517_c1
1254 nmdc:mga05p37_733811_c1
1255 nmdc:mga05p37_850881_c1
1256 nmdc:mga09592_13460_c1
1257 nmdc:mga09592_26523_c1
1258 nmdc:mga09592_273731_c1
1259 nmdc:mga09592_647_c1
1260 nmdc:mga09592_88236_c1
1261 nmdc:mga0qj67_17875_c1
1262 nmdc:mga0qj67_300971_c1
1263 nmdc:mga0qj67_797605_c1
1264 nmdc:mga06r32_165029_c1
1265 nmdc:mga06r32_3019_c1
1266 nmdc:mga06r32_36494_c1
1267 nmdc:mga06r32_374062_c1
1268 nmdc:mga06r32_50538_c1
1269 nmdc:mga06r32_577026_c1
1270 nmdc:mga06r32_96709_c1
1271 nmdc:mga08y16_112418_c1
1272 nmdc:mga08y16_177343_c1
1273 nmdc:mga08y16_287199_c1
1274 nmdc:mga08y16_299534_c1
1275 nmdc:mga08y16_40958_c1
1276 nmdc:mga08y16_54389_c1
1277 nmdc:mga08y16_71354_c1
1278 nmdc:mga08y16_799031_c1
1279 nmdc:mga08y16_839588_c1
1280 nmdc:mga08y16_852898_c1
1281 nmdc:mga08y16_945996_c1
1282 nmdc:mga0n895_15270_c1
1283 nmdc:mga0n895_153906_c1
1284 nmdc:mga0n895_163060_c1
1285 nmdc:mga0n895_163471_c1
1286 nmdc:mga0n895_252455_c1
1287 nmdc:mga0n895_593039_c1
1288 nmdc:mga0n895_831743_c1
1289 nmdc:mga0rr50_14729_c1
1290 nmdc:mga0rr50_3149_c1
1291 nmdc:mga0rr50_398525_c1
1292 nmdc:mga0rr50_4217_c1
1293 nmdc:mga0rr50_5227_c1
1294 nmdc:mga0rr50_65184_c1
1295 nmdc:mga08x19_5500_c1
1296 nmdc:mga0a205_109100_c1
1297 nmdc:mga0a205_159985_c1
1298 nmdc:mga0a205_174407_c1
1299 nmdc:mga0a205_490820_c1
1300 Ga0495601_0600550
1301 Ga0495595_0104527
1302 Ga0495619_0100950
1303 Ga0495619_0103710
1304 Ga0495619_0368773
1305 Ga0500616_0000498
1306 Ga0500645_001972
1307 Ga0501084_0004141
1308 Ga0501084_0182146
1309 Ga0501084_0289961
1310 Ga0501084_0290760
1311 Ga0590071_005534
1312 Ga0590074_002850
1313 Ga0590075_002902
1314 Ga0590075_006815
1315 Ga0590077_000112
1316 Ga0590077_010783
1317 Ga0590077_031177
1318 Ga0501082_0005220
1319 Ga0501082_1035718
1320 Ga0501082_1310950
1321 Ga0530510_0000658
1322 Ga0530510_0074166
1323 Ga0530510_0313715
1324 Ga0530510_0876171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

63

161

0.92

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

54

167

0.87

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

46

158

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cs2-assembly1.cif.gz_A-2 crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a 0.8778 38 100
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8648 37 100
6fit-assembly1.cif.gz_A-2 fhit-transition state analog 0.8562 37 99
7p8p-assembly2.cif.gz_B crystal structure of fhit covalently bound to a nucleotide 0.8539 37 100
7p8p-assembly2.cif.gz_C crystal structure of fhit covalently bound to a nucleotide 0.8528 37 100
ID Description Score Start End Superfamily
af_A0A0R0I6R9_3_117_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8854 37 63 3.40.50.300
af_A0A0R0GDS2_866_1064_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8637 38 63 3.40.50.300
af_Q8IL97_1_145_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8626 32 100 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8619 38 100 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8556 18 93 3.30.428.10
ID Description Score Start End GO Terms
AF-X1VTZ1-F1-model_v4 HIT domain-containing protein 0.8805 22 104 GO:0003824
AF-A0A2T5J3K9-F1-model_v4 Histidine triad (HIT) family protein 0.8753 22 97 GO:0003824
GO:0009117
AF-A0A3D2VBP1-F1-model_v4 HIT family protein 0.8706 22 94 GO:0003824
AF-A0A3Q0FGJ1-F1-model_v4 Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT isoform X2 0.865 35 100 GO:0047627
AF-A0A6B3EIR9-F1-model_v4 HIT domain-containing protein 0.8616 39 105 GO:0003824

Map