F473466

General Info

Members Datasets Scaffolds Average Seq Length
662 307 662 83

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100638216|Ga0075435_1006382162
Length 96
Sequence MFSRKARACAKTSKGRSDVAIVVKLDDMLHDRRMTLTELADQIGMALANVSILKTGKARAIRFSTLEAICEALACQPGDILKFEPEEPRRKRSPGR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
112 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
219 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
224 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
225 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
279 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 3.93
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10871835 3300005289 Bacteria 503
2 Ga0065712_10598818 3300005290 Bacteria 586
3 Ga0065715_10573733 3300005293 Bacteria 721
4 Ga0065707_10474698 3300005295 Bacteria 779
5 Ga0070676_10015484 3300005328 Bacteria 4207
6 Ga0070676_11269675 3300005328 Bacteria 561
7 Ga0070683_100590095 3300005329 Bacteria 1063
8 Ga0070690_100052401 3300005330 Bacteria 2608
9 Ga0070690_100247170 3300005330 Unclassified 1260
10 Ga0070690_100408255 3300005330 Bacteria 999
11 Ga0070690_100964223 3300005330 Bacteria 670
12 Ga0070670_100166827 3300005331 Unclassified 1909
13 Ga0070670_100893584 3300005331 Bacteria 805
14 Ga0070670_101122447 3300005331 Bacteria 717
15 Ga0070677_10288935 3300005333 Bacteria 829
16 Ga0068869_100008173 3300005334 Bacteria 6732
17 Ga0068869_100374296 3300005334 Bacteria 1166
18 Ga0068869_100748003 3300005334 Bacteria 837
19 Ga0068869_100813563 3300005334 Bacteria 804
20 Ga0068869_100900618 3300005334 Bacteria 765
21 Ga0070666_10009507 3300005335 Bacteria 6063
22 Ga0070680_100103767 3300005336 Bacteria 2362
23 Ga0070680_101860112 3300005336 Bacteria 522
24 Ga0070682_100054927 3300005337 Bacteria 2500
25 Ga0068868_100110556 3300005338 Bacteria 2232
26 Ga0068868_100206559 3300005338 Bacteria 1640
27 Ga0068868_102401313 3300005338 Bacteria 503
28 Ga0070660_100002703 3300005339 Bacteria 12174
29 Ga0070660_100018398 3300005339 Bacteria 5106
30 Ga0070689_100245192 3300005340 Bacteria 1477
31 Ga0070689_101504876 3300005340 Bacteria 610
32 Ga0070687_100049727 3300005343 Bacteria 2162
33 Ga0070661_100016797 3300005344 Bacteria 5181
34 Ga0070661_100088652 3300005344 Bacteria 2290
35 Ga0070661_100389580 3300005344 Bacteria 1100
36 Ga0070668_100035245 3300005347 Bacteria 3815
37 Ga0070668_100392397 3300005347 Bacteria 1183
38 Ga0070668_100606239 3300005347 Bacteria 958
39 Ga0070668_100929735 3300005347 Bacteria 778
40 Ga0070669_100129828 3300005353 Bacteria 1932
41 Ga0070669_100171691 3300005353 Bacteria 1691
42 Ga0070669_100553875 3300005353 Bacteria 959
43 Ga0070669_100568233 3300005353 Bacteria 947
44 Ga0070669_100609158 3300005353 Bacteria 915
45 Ga0070669_101506892 3300005353 Bacteria 585
46 Ga0070675_100073690 3300005354 Unclassified 2835
47 Ga0070675_100287657 3300005354 Bacteria 1446
48 Ga0070675_100421343 3300005354 Bacteria 1194
49 Ga0070671_100078705 3300005355 Bacteria 2755
50 Ga0070671_100297152 3300005355 Bacteria 1375
51 Ga0070674_100500692 3300005356 Bacteria 1012
52 Ga0070674_101278304 3300005356 Bacteria 654
53 Ga0070673_100836065 3300005364 Bacteria 851
54 Ga0070673_101140176 3300005364 Bacteria 729
55 Ga0070688_100045488 3300005365 Bacteria 2713
56 Ga0070688_100250426 3300005365 Bacteria 1261
57 Ga0070688_100287198 3300005365 Bacteria 1184
58 Ga0070688_100450057 3300005365 Unclassified 962
59 Ga0070688_100764341 3300005365 Unclassified 753
60 Ga0070659_100000025 3300005366 Bacteria 144955
61 Ga0070659_100150623 3300005366 Bacteria 1898
62 Ga0070659_100948193 3300005366 Bacteria 754
63 Ga0070667_100100777 3300005367 Bacteria 2494
64 Ga0070667_100206629 3300005367 Bacteria 1744
65 Ga0070667_100214880 3300005367 Bacteria 1710
66 Ga0070667_101126440 3300005367 Bacteria 734
67 Ga0070703_10428441 3300005406 Bacteria 582
68 Ga0070709_11280593 3300005434 Bacteria 591
69 Ga0070714_100992950 3300005435 Bacteria 817
70 Ga0070713_100109093 3300005436 Unclassified 2411
71 Ga0070713_100715282 3300005436 Bacteria 957
72 Ga0070713_101753068 3300005436 Bacteria 603
73 Ga0070701_10034373 3300005438 Bacteria 2538
74 Ga0070701_10059661 3300005438 Bacteria 2007
75 Ga0070711_100242985 3300005439 Bacteria 1408
76 Ga0070711_100308434 3300005439 Bacteria 1261
77 Ga0070711_100388931 3300005439 Bacteria 1129
78 Ga0070711_100398900 3300005439 Bacteria 1116
79 Ga0070705_100055663 3300005440 Bacteria 2326
80 Ga0070700_100008534 3300005441 Bacteria 5578
81 Ga0070694_100105286 3300005444 Bacteria 2002
82 Ga0070694_100285475 3300005444 Bacteria 1260
83 Ga0070694_101510724 3300005444 Bacteria 569
84 Ga0070708_100934750 3300005445 Bacteria 814
85 Ga0070708_101313129 3300005445 Bacteria 676
86 Ga0070663_100026770 3300005455 Bacteria 3909
87 Ga0070663_100054918 3300005455 Bacteria 2849
88 Ga0070663_100737880 3300005455 Bacteria 840
89 Ga0070663_101813234 3300005455 Bacteria 547
90 Ga0070678_100003819 3300005456 Bacteria 8450
91 Ga0070678_100033857 3300005456 Bacteria 3552
92 Ga0070678_100070177 3300005456 Bacteria 2618
93 Ga0070678_100703457 3300005456 Bacteria 911
94 Ga0070678_101749686 3300005456 Bacteria 585
95 Ga0070662_100004056 3300005457 Bacteria 9197
96 Ga0070662_100110201 3300005457 Bacteria 2096
97 Ga0070662_100205716 3300005457 Bacteria 1564
98 Ga0068867_100040962 3300005459 Bacteria 3384
99 Ga0068867_100332776 3300005459 Unclassified 1262
100 Ga0068867_100409323 3300005459 Unclassified 1146
101 Ga0068867_100486835 3300005459 Bacteria 1058
102 Ga0068867_101047560 3300005459 Unclassified 742
103 Ga0070685_10030146 3300005466 Bacteria 3020
104 Ga0070685_10175876 3300005466 Bacteria 1374
105 Ga0070706_100083549 3300005467 Bacteria 2958
106 Ga0070707_100700503 3300005468 Bacteria 976
107 Ga0070699_100593386 3300005518 Bacteria 1010
108 Ga0070679_100161558 3300005530 Bacteria 2214
109 Ga0070679_100964999 3300005530 Bacteria 796
110 Ga0070679_101587368 3300005530 Bacteria 602
111 Ga0070684_100166858 3300005535 Bacteria 1999
112 Ga0070684_101203367 3300005535 Bacteria 713
113 Ga0070697_100043471 3300005536 Bacteria 3638
114 Ga0070697_100332587 3300005536 Bacteria 1310
115 Ga0068853_100009185 3300005539 Bacteria 7963
116 Ga0068853_100098417 3300005539 Bacteria 2583
117 Ga0068853_101472436 3300005539 Bacteria 659
118 Ga0070672_100005316 3300005543 Bacteria 8526
119 Ga0070672_100819295 3300005543 Bacteria 820
120 Ga0070672_100879987 3300005543 Bacteria 791
121 Ga0070686_100121643 3300005544 Bacteria 1793
122 Ga0070686_100334876 3300005544 Bacteria 1132
123 Ga0070686_100500525 3300005544 Bacteria 943
124 Ga0070696_100737869 3300005546 Bacteria 806
125 Ga0070693_100128393 3300005547 Unclassified 1581
126 Ga0070665_100027600 3300005548 Bacteria 5718
127 Ga0070665_100046925 3300005548 Bacteria 4336
128 Ga0070665_100123161 3300005548 Bacteria 2595
129 Ga0070665_100616461 3300005548 Unclassified 1098
130 Ga0070704_100021145 3300005549 Bacteria 4212
131 Ga0070704_100585697 3300005549 Bacteria 979
132 Ga0070704_101778654 3300005549 Bacteria 570
133 Ga0068855_100003776 3300005563 Bacteria 18523
134 Ga0068855_102350156 3300005563 Bacteria 533
135 Ga0070664_100085694 3300005564 Bacteria 2721
136 Ga0070664_100110802 3300005564 Bacteria 2395
137 Ga0070664_100576987 3300005564 Bacteria 1042
138 Ga0070664_100748285 3300005564 Bacteria 912
139 Ga0068857_100469186 3300005577 Bacteria 1179
140 Ga0068857_101179710 3300005577 Bacteria 741
141 Ga0068857_101323589 3300005577 Bacteria 699
142 Ga0068857_101433961 3300005577 Bacteria 672
143 Ga0068854_100002823 3300005578 Bacteria 10795
144 Ga0068854_100215134 3300005578 Bacteria 1518
145 Ga0068854_100259132 3300005578 Bacteria 1392
146 Ga0068854_101205467 3300005578 Bacteria 678
147 Ga0068856_100002343 3300005614 Bacteria 19497
148 Ga0068856_102460236 3300005614 Bacteria 528
149 Ga0070702_100093233 3300005615 Bacteria 1831
150 Ga0070702_100482708 3300005615 Bacteria 906
151 Ga0070702_100813741 3300005615 Bacteria 724
152 Ga0068852_100091821 3300005616 Bacteria 2718
153 Ga0068859_100012763 3300005617 Bacteria 8443
154 Ga0068859_100020921 3300005617 Bacteria 6567
155 Ga0068859_100026780 3300005617 Bacteria 5784
156 Ga0068859_100047572 3300005617 Bacteria 4310
157 Ga0068859_100129037 3300005617 Unclassified 2599
158 Ga0068859_100929039 3300005617 Bacteria 954
159 Ga0068859_102920775 3300005617 Bacteria 523
160 Ga0068859_103122151 3300005617 Bacteria 505
161 Ga0068864_100363654 3300005618 Bacteria 1368
162 Ga0068864_100404644 3300005618 Unclassified 1297
163 Ga0068864_100423987 3300005618 Bacteria 1268
164 Ga0068866_10008527 3300005718 Bacteria 4324
165 Ga0068866_10035055 3300005718 Bacteria 2448
166 Ga0068861_100010852 3300005719 Bacteria 6332
167 Ga0068861_100682049 3300005719 Bacteria 953
168 Ga0068851_10009450 3300005834 Bacteria 4535
169 Ga0068851_10768220 3300005834 Bacteria 597
170 Ga0068870_10168921 3300005840 Bacteria 1304
171 Ga0068870_10633191 3300005840 Bacteria 731
172 Ga0068863_100139097 3300005841 Bacteria 2320
173 Ga0068858_100049034 3300005842 Bacteria 3911
174 Ga0068858_100116594 3300005842 Bacteria 2496
175 Ga0068858_100225282 3300005842 Bacteria 1777
176 Ga0068860_100045175 3300005843 Bacteria 4199
177 Ga0068860_100202033 3300005843 Bacteria 1926
178 Ga0068860_101313013 3300005843 Bacteria 744
179 Ga0068862_100027922 3300005844 Bacteria 4753
180 Ga0068862_100035305 3300005844 Bacteria 4233
181 Ga0068862_100087723 3300005844 Bacteria 2706
182 Ga0068862_100089446 3300005844 Bacteria 2680
183 Ga0068862_100889089 3300005844 Bacteria 875
184 Ga0068862_101557490 3300005844 Bacteria 667
185 Ga0081455_11031900 3300005937 Bacteria 508
186 Ga0081539_10184947 3300005985 Bacteria 974
187 Ga0081539_10287889 3300005985 Bacteria 712
188 Ga0070717_10148522 3300006028 Bacteria 2026
189 Ga0070717_10185757 3300006028 Unclassified 1814
190 Ga0075368_10280356 3300006042 Bacteria 716
191 Ga0075364_10018032 3300006051 Bacteria 4415
192 Ga0075364_10574104 3300006051 Bacteria 771
193 Ga0070715_10077934 3300006163 Bacteria 1497
194 Ga0070716_100038817 3300006173 Bacteria 2639
195 Ga0070716_100245391 3300006173 Bacteria 1217
196 Ga0070712_100010067 3300006175 Bacteria 5960
197 Ga0070712_100048432 3300006175 Bacteria 2946
198 Ga0070712_100124529 3300006175 Bacteria 1944
199 Ga0075362_10410277 3300006177 Bacteria 684
200 Ga0075367_10005952 3300006178 Bacteria 6121
201 Ga0075366_10054892 3300006195 Bacteria 2366
202 Ga0097621_100078235 3300006237 Bacteria 2747
203 Ga0097621_100110850 3300006237 Bacteria 2318
204 Ga0097621_100161589 3300006237 Bacteria 1926
205 Ga0097621_100295338 3300006237 Bacteria 1430
206 Ga0097621_100717242 3300006237 Bacteria 922
207 Ga0097621_100872331 3300006237 Bacteria 837
208 Ga0068871_100035073 3300006358 Bacteria 3984
209 Ga0068871_100086142 3300006358 Bacteria 2610
210 Ga0068871_100515751 3300006358 Bacteria 1079
211 Ga0068871_101024464 3300006358 Bacteria 770
212 Ga0075428_100116951 3300006844 Bacteria 2904
213 Ga0075428_100141981 3300006844 Bacteria 2611
214 Ga0075430_100051217 3300006846 Bacteria 3480
215 Ga0075430_100136238 3300006846 Bacteria 2046
216 Ga0075430_100596921 3300006846 Bacteria 911
217 Ga0075431_100900130 3300006847 Bacteria 854
218 Ga0075431_101194047 3300006847 Bacteria 724
219 Ga0075431_101656941 3300006847 Bacteria 597
220 Ga0075433_10983795 3300006852 Bacteria 735
221 Ga0075434_100693573 3300006871 Bacteria 1036
222 Ga0075429_100002103 3300006880 Bacteria 16621
223 Ga0075429_100008855 3300006880 Bacteria 8748
224 Ga0075429_100399543 3300006880 Bacteria 1204
225 Ga0068865_100011201 3300006881 Bacteria 5606
226 Ga0068865_100045007 3300006881 Bacteria 3023
227 Ga0075436_100016028 3300006914 Bacteria 5130
228 Ga0075436_100805320 3300006914 Bacteria 700
229 Ga0075436_101001989 3300006914 Bacteria 627
230 Ga0097620_100012764 3300006931 Bacteria 8443
231 Ga0097620_100020922 3300006931 Bacteria 6567
232 Ga0097620_100026781 3300006931 Bacteria 5784
233 Ga0097620_100047572 3300006931 Bacteria 4310
234 Ga0097620_100129031 3300006931 Unclassified 2599
235 Ga0097620_100928817 3300006931 Bacteria 954
236 Ga0097620_102918038 3300006931 Bacteria 523
237 Ga0097620_103121840 3300006931 Bacteria 505
238 Ga0075435_100009967 3300007076 Bacteria 6923
239 Ga0075435_100638216 3300007076 Bacteria 924
240 Ga0075435_100779755 3300007076 Bacteria 832
241 Ga0105240_10032471 3300009093 Bacteria 6759
242 Ga0111539_10025171 3300009094 Bacteria 7295
243 Ga0111539_10032952 3300009094 Bacteria 6291
244 Ga0111539_10943993 3300009094 Bacteria 1003
245 Ga0111539_11591105 3300009094 Bacteria 758
246 Ga0111539_12276034 3300009094 Bacteria 629
247 Ga0105245_10000268 3300009098 Bacteria 49610
248 Ga0105245_10011633 3300009098 Bacteria 7661
249 Ga0105245_10053825 3300009098 Bacteria 3614
250 Ga0105247_10009261 3300009101 Bacteria 5983
251 Ga0114129_10000783 3300009147 Bacteria 40711
252 Ga0114129_10187978 3300009147 Bacteria 2806
253 Ga0114129_10190039 3300009147 Bacteria 2789
254 Ga0114129_10378776 3300009147 Bacteria 1869
255 Ga0114129_10665844 3300009147 Bacteria 1342
256 Ga0114129_11129983 3300009147 Bacteria 979
257 Ga0114129_11217166 3300009147 Bacteria 937
258 Ga0114129_11351415 3300009147 Bacteria 881
259 Ga0105243_10034676 3300009148 Bacteria 3909
260 Ga0105243_10066242 3300009148 Bacteria 2904
261 Ga0105243_11041403 3300009148 Unclassified 823
262 Ga0105241_10010190 3300009174 Bacteria 6904
263 Ga0105241_10343372 3300009174 Bacteria 1294
264 Ga0105242_10015729 3300009176 Bacteria 5879
265 Ga0105242_10019367 3300009176 Bacteria 5332
266 Ga0105242_11418000 3300009176 Bacteria 723
267 Ga0105242_11874617 3300009176 Bacteria 639
268 Ga0105248_10036335 3300009177 Bacteria 5508
269 Ga0105248_10233078 3300009177 Bacteria 2072
270 Ga0105248_10954037 3300009177 Bacteria 969
271 Ga0105248_11044497 3300009177 Bacteria 923
272 Ga0105248_12012541 3300009177 Bacteria 656
273 Ga0105237_10018241 3300009545 Bacteria 7260
274 Ga0105237_10060251 3300009545 Bacteria 3798
275 Ga0105238_10017878 3300009551 Bacteria 7209
276 Ga0105238_12428353 3300009551 Bacteria 560
277 Ga0105238_12464525 3300009551 Bacteria 556
278 Ga0105249_10014251 3300009553 Bacteria 7028
279 Ga0105249_10019172 3300009553 Bacteria 6100
280 Ga0105249_10395588 3300009553 Bacteria 1411
281 Ga0105249_11288774 3300009553 Bacteria 802
282 Ga0105249_12070230 3300009553 Unclassified 642
283 Ga0099796_10002357 3300010159 Bacteria 4131
284 Ga0105239_10033308 3300010375 Bacteria 5659
285 Ga0105239_10875919 3300010375 Bacteria 1030
286 Ga0105239_11597132 3300010375 Bacteria 754
287 Ga0105246_10125001 3300011119 Bacteria 1912
288 Ga0105246_10211534 3300011119 Bacteria 1514
289 Ga0105246_10285838 3300011119 Bacteria 1325
290 Ga0105246_10402080 3300011119 Bacteria 1138
291 Ga0157328_1009701 3300012478 Bacteria 653
292 Ga0157347_1063638 3300012502 Bacteria 532
293 Ga0157373_10009270 3300013100 Bacteria 7276
294 Ga0157371_10014824 3300013102 Bacteria 5868
295 Ga0157369_10013449 3300013105 Bacteria 9249
296 Ga0157374_10013346 3300013296 Bacteria 7172
297 Ga0157374_10477786 3300013296 Unclassified 1249
298 Ga0157374_11085610 3300013296 Bacteria 821
299 Ga0157374_12917044 3300013296 Unclassified 505
300 Ga0157378_10007755 3300013297 Bacteria 9367
301 Ga0157378_10795335 3300013297 Bacteria 971
302 Ga0157378_11449364 3300013297 Bacteria 730
303 Ga0163162_10002231 3300013306 Bacteria 18202
304 Ga0163162_10019287 3300013306 Bacteria 6686
305 Ga0163162_10023926 3300013306 Bacteria 6028
306 Ga0163162_10403288 3300013306 Bacteria 1500
307 Ga0163162_10643430 3300013306 Bacteria 1184
308 Ga0163162_10889181 3300013306 Bacteria 1004
309 Ga0163162_11054635 3300013306 Bacteria 920
310 Ga0163162_12940104 3300013306 Bacteria 548
311 Ga0157372_10002096 3300013307 Bacteria 21691
312 Ga0157372_10034000 3300013307 Bacteria 5601
313 Ga0157375_10293235 3300013308 Bacteria 1790
314 Ga0157375_10311349 3300013308 Bacteria 1739
315 Ga0157375_10955252 3300013308 Bacteria 999
316 Ga0157375_11842166 3300013308 Bacteria 718
317 Ga0157375_13659332 3300013308 Bacteria 511
318 Ga0163163_10061806 3300014325 Bacteria 3711
319 Ga0163163_10114721 3300014325 Bacteria 2725
320 Ga0157380_10048964 3300014326 Bacteria 3331
321 Ga0157380_10107548 3300014326 Bacteria 2336
322 Ga0157380_10563520 3300014326 Unclassified 1120
323 Ga0157377_10332258 3300014745 Unclassified 1014
324 Ga0157379_10138036 3300014968 Unclassified 2197
325 Ga0157379_10264639 3300014968 Bacteria 1563
326 Ga0157379_10296384 3300014968 Bacteria 1473
327 Ga0157379_11524082 3300014968 Bacteria 651
328 Ga0157379_12598346 3300014968 Bacteria 507
329 Ga0157376_10219809 3300014969 Bacteria 1759
330 Ga0157376_10259937 3300014969 Bacteria 1626
331 Ga0157376_11083859 3300014969 Bacteria 826
332 Ga0206354_11602318 3300020081 Bacteria 3294
333 Ga0206353_12008140 3300020082 Bacteria 6615
334 Ga0207656_10045692 3300025321 Bacteria 1875
335 Ga0207682_10040397 3300025893 Bacteria 1900
336 Ga0207692_10937337 3300025898 Bacteria 570
337 Ga0207642_10099562 3300025899 Bacteria 1456
338 Ga0207710_10130436 3300025900 Bacteria 1207
339 Ga0207680_10008419 3300025903 Bacteria 5063
340 Ga0207680_10069783 3300025903 Bacteria 2173
341 Ga0207685_10586448 3300025905 Bacteria 597
342 Ga0207645_10023980 3300025907 Bacteria 3960
343 Ga0207643_10170914 3300025908 Bacteria 1312
344 Ga0207654_10001435 3300025911 Bacteria 12643
345 Ga0207707_10076097 3300025912 Bacteria 2929
346 Ga0207695_10018842 3300025913 Bacteria 7965
347 Ga0207671_10008003 3300025914 Bacteria 9054
348 Ga0207693_10015899 3300025915 Bacteria 6024
349 Ga0207693_10075667 3300025915 Bacteria 2636
350 Ga0207693_10121064 3300025915 Bacteria 2055
351 Ga0207693_10713081 3300025915 Bacteria 776
352 Ga0207663_10220488 3300025916 Bacteria 1380
353 Ga0207663_10377719 3300025916 Bacteria 1079
354 Ga0207663_10887495 3300025916 Bacteria 712
355 Ga0207660_10082744 3300025917 Bacteria 2362
356 Ga0207662_10018481 3300025918 Bacteria 3956
357 Ga0207657_10007702 3300025919 Bacteria 11004
358 Ga0207657_10159627 3300025919 Bacteria 1832
359 Ga0207649_10031848 3300025920 Bacteria 3138
360 Ga0207649_10693526 3300025920 Bacteria 789
361 Ga0207652_10080569 3300025921 Bacteria 2846
362 Ga0207646_10369970 3300025922 Bacteria 1295
363 Ga0207681_10180089 3300025923 Bacteria 1609
364 Ga0207681_10180793 3300025923 Bacteria 1606
365 Ga0207681_10367019 3300025923 Bacteria 1156
366 Ga0207681_10522993 3300025923 Bacteria 974
367 Ga0207694_10012240 3300025924 Bacteria 6466
368 Ga0207650_10406633 3300025925 Unclassified 1127
369 Ga0207659_11124840 3300025926 Bacteria 676
370 Ga0207659_11322392 3300025926 Bacteria 619
371 Ga0207659_11409771 3300025926 Bacteria 597
372 Ga0207687_10000168 3300025927 Bacteria 43449
373 Ga0207687_10000742 3300025927 Bacteria 22127
374 Ga0207687_10676875 3300025927 Bacteria 874
375 Ga0207687_11291754 3300025927 Bacteria 627
376 Ga0207700_10030414 3300025928 Bacteria 3825
377 Ga0207700_10130114 3300025928 Bacteria 2054
378 Ga0207700_10646964 3300025928 Bacteria 942
379 Ga0207664_10267759 3300025929 Bacteria 1496
380 Ga0207664_10987128 3300025929 Bacteria 755
381 Ga0207690_10000005 3300025932 Bacteria 581199
382 Ga0207690_10059208 3300025932 Bacteria 2594
383 Ga0207690_10663083 3300025932 Bacteria 856
384 Ga0207706_10009801 3300025933 Bacteria 8790
385 Ga0207706_10161752 3300025933 Bacteria 1968
386 Ga0207686_10027137 3300025934 Bacteria 3350
387 Ga0207709_10079690 3300025935 Bacteria 2106
388 Ga0207709_10198561 3300025935 Bacteria 1431
389 Ga0207670_10123098 3300025936 Bacteria 1889
390 Ga0207670_10164987 3300025936 Bacteria 1657
391 Ga0207669_10466771 3300025937 Bacteria 1003
392 Ga0207669_11311368 3300025937 Bacteria 615
393 Ga0207704_10059813 3300025938 Bacteria 2354
394 Ga0207704_10375709 3300025938 Bacteria 1114
395 Ga0207665_10033310 3300025939 Bacteria 3414
396 Ga0207665_10076933 3300025939 Bacteria 2290
397 Ga0207665_10282845 3300025939 Bacteria 1235
398 Ga0207665_11634621 3300025939 Bacteria 510
399 Ga0207691_10020945 3300025940 Bacteria 6180
400 Ga0207691_10081864 3300025940 Bacteria 2901
401 Ga0207711_10001257 3300025941 Bacteria 24053
402 Ga0207711_10037882 3300025941 Bacteria 4099
403 Ga0207711_10393498 3300025941 Bacteria 1287
404 Ga0207711_10861799 3300025941 Bacteria 843
405 Ga0207689_10105168 3300025942 Bacteria 2319
406 Ga0207689_11049759 3300025942 Bacteria 687
407 Ga0207661_10090641 3300025944 Bacteria 2546
408 Ga0207661_10750289 3300025944 Bacteria 898
409 Ga0207661_11685960 3300025944 Bacteria 579
410 Ga0207679_10015219 3300025945 Bacteria 5076
411 Ga0207679_11306713 3300025945 Bacteria 666
412 Ga0207679_11436773 3300025945 Bacteria 633
413 Ga0207667_10002588 3300025949 Bacteria 22465
414 Ga0207667_12016676 3300025949 Bacteria 537
415 Ga0207651_10520127 3300025960 Bacteria 1031
416 Ga0207712_10128926 3300025961 Bacteria 1924
417 Ga0207712_10218363 3300025961 Bacteria 1523
418 Ga0207712_10685682 3300025961 Bacteria 893
419 Ga0207712_10997669 3300025961 Bacteria 743
420 Ga0207712_11392208 3300025961 Bacteria 627
421 Ga0207668_10033140 3300025972 Bacteria 3420
422 Ga0207668_10076673 3300025972 Bacteria 2408
423 Ga0207668_10393500 3300025972 Bacteria 1170
424 Ga0207668_10426933 3300025972 Bacteria 1126
425 Ga0207668_10551841 3300025972 Bacteria 998
426 Ga0207668_10603813 3300025972 Bacteria 956
427 Ga0207668_10668391 3300025972 Bacteria 911
428 Ga0207640_10004697 3300025981 Bacteria 7417
429 Ga0207658_10098020 3300025986 Bacteria 2290
430 Ga0207658_10177827 3300025986 Bacteria 1758
431 Ga0207658_10234693 3300025986 Bacteria 1550
432 Ga0207677_10014671 3300026023 Bacteria 4584
433 Ga0207677_10145792 3300026023 Bacteria 1819
434 Ga0207677_10334399 3300026023 Bacteria 1263
435 Ga0207677_11253730 3300026023 Unclassified 680
436 Ga0207639_10046272 3300026041 Bacteria 3282
437 Ga0207639_10135680 3300026041 Bacteria 2043
438 Ga0207639_10801285 3300026041 Bacteria 878
439 Ga0207678_10006653 3300026067 Bacteria 10246
440 Ga0207678_10035427 3300026067 Bacteria 4345
441 Ga0207678_10491767 3300026067 Bacteria 1069
442 Ga0207708_10008408 3300026075 Bacteria 7637
443 Ga0207708_10381443 3300026075 Bacteria 1162
444 Ga0207708_11654442 3300026075 Bacteria 562
445 Ga0207702_10004756 3300026078 Bacteria 11984
446 Ga0207641_10730999 3300026088 Bacteria 976
447 Ga0207648_10018901 3300026089 Bacteria 6224
448 Ga0207648_10145377 3300026089 Bacteria 2091
449 Ga0207648_10183314 3300026089 Bacteria 1853
450 Ga0207648_10191828 3300026089 Bacteria 1811
451 Ga0207648_11373351 3300026089 Unclassified 664
452 Ga0207676_10167509 3300026095 Bacteria 1911
453 Ga0207674_10293120 3300026116 Bacteria 1575
454 Ga0207674_12095610 3300026116 Bacteria 530
455 Ga0207675_100040662 3300026118 Bacteria 4342
456 Ga0207675_100272934 3300026118 Bacteria 1641
457 Ga0207675_100354508 3300026118 Bacteria 1438
458 Ga0207683_10071259 3300026121 Bacteria 3072
459 Ga0207683_10088008 3300026121 Bacteria 2763
460 Ga0207698_10043438 3300026142 Bacteria 3367
461 Ga0207698_11179814 3300026142 Bacteria 779
462 Ga0209998_10099870 3300027717 Bacteria 718
463 Ga0209974_10065293 3300027876 Bacteria 1236
464 Ga0207428_10281690 3300027907 Bacteria 1234
465 Ga0268266_10008824 3300028379 Bacteria 8925
466 Ga0268266_10022609 3300028379 Bacteria 5354
467 Ga0268266_10869845 3300028379 Bacteria 871
468 Ga0268265_10111047 3300028380 Bacteria 2238
469 Ga0268265_10196894 3300028380 Bacteria 1744
470 Ga0268265_10744664 3300028380 Bacteria 951
471 Ga0268265_12280548 3300028380 Bacteria 548
472 Ga0268264_10098798 3300028381 Bacteria 2532
473 Ga0268264_10232840 3300028381 Bacteria 1702
474 Ga0268264_10700814 3300028381 Bacteria 1006
475 Ga0307515_10049149 3300028794 Bacteria 6356
476 Ga0265338_10142549 3300028800 Bacteria 1875
477 Ga0316180_1040358 3300030736 Bacteria 1003
478 Ga0307513_10176714 3300031456 Bacteria 2004
479 Ga0307513_10305976 3300031456 Bacteria 1354
480 Ga0307509_10062257 3300031507 Bacteria 3935
481 Ga0307408_100707801 3300031548 Bacteria 906
482 Ga0307410_10833520 3300031852 Bacteria 786
483 Ga0307407_10208620 3300031903 Unclassified 1314
484 Ga0307409_100456376 3300031995 Bacteria 1235
485 Ga0307416_103130897 3300032002 Bacteria 553
486 Ga0307416_103759930 3300032002 Bacteria 508
487 Ga0307411_10119946 3300032005 Bacteria 1901
488 Ga0307411_10761932 3300032005 Bacteria 849
489 Ga0307411_11632240 3300032005 Bacteria 595
490 Ga0307415_100959448 3300032126 Bacteria 792
491 Ga0373938_0138619 3300034957 Bacteria 640
492 Ga0373928_0060616 3300035084 Bacteria 914
493 Ga0373939_0033440 3300035114 Bacteria 1502
494 Ga0373939_0042498 3300035114 Bacteria 1375
495 Ga0373939_0065700 3300035114 Bacteria 1168
496 Ga0373960_0350048 3300035121 Bacteria 560
497 Ga0373943_0243435 3300035170 Bacteria 1008
498 Ga0373962_0027965 3300035242 Bacteria 1528
499 Ga0373931_0009374 3300035691 Bacteria 4679
500 Ga0373931_0123657 3300035691 Bacteria 1481
501 Ga0373931_0925439 3300035691 Bacteria 587
502 Ga0373931_1124231 3300035691 Bacteria 535
503 Ga0395899_0117457 3300037312 Bacteria 1908
504 Ga0395900_0045787 3300037418 Bacteria 4506
505 Ga0395898_0320856 3300037466 Bacteria 1478
506 Ga0395905_0140386 3300037471 Bacteria 2273
507 Ga0395905_0309012 3300037471 Bacteria 1469
508 Ga0395905_0410187 3300037471 Bacteria 1250
509 Ga0395901_0474171 3300038443 Bacteria 1277
510 Ga0395901_0488994 3300038443 Bacteria 1254
511 Ga0439439_0251544 3300041406 Bacteria 524
512 Ga0451787_458879 3300041441 Bacteria 546
513 Ga0451795_0251339 3300041456 Bacteria 508
514 Ga0451807_1691547 3300041486 Bacteria 726
515 Ga0451853_3244223 3300041512 Bacteria 533
516 Ga0439431_0169998 3300041997 Bacteria 626
517 Ga0439443_001792 3300042003 Bacteria 2457
518 Ga0439454_116660 3300042011 Bacteria 514
519 Ga0439462_0060647 3300042015 Bacteria 1024
520 Ga0439435_0079856 3300042436 Bacteria 980
521 Ga0439460_0007551 3300042461 Bacteria 2724
522 Ga0439460_0116060 3300042461 Bacteria 872
523 Ga0439460_0260369 3300042461 Bacteria 601
524 Ga0451577_0202244 3300042876 Bacteria 1793
525 Ga0451577_1187704 3300042876 Bacteria 681
526 Ga0453684_0396338 3300044712 Bacteria 1547
527 Ga0453684_1887590 3300044712 Bacteria 605
528 Ga0451576_0333798 3300045051 Bacteria 1587
529 Ga0451576_1055325 3300045051 Bacteria 851
530 Ga0495638_0492088 3300046460 Bacteria 619
531 Ga0495651_0988581 3300046462 Bacteria 511
532 Ga0495580_0024894 3300046472 Bacteria 4375
533 Ga0495580_0565244 3300046472 Bacteria 754
534 Ga0495582_0001944 3300046473 Bacteria 11607
535 Ga0495630_0499460 3300046517 Bacteria 933
536 Ga0495640_0851130 3300046533 Bacteria 542
537 Ga0495586_0192221 3300046535 Bacteria 1156
538 Ga0495598_0148316 3300046537 Bacteria 817
539 Ga0495621_0063065 3300046539 Bacteria 1350
540 Ga0495645_0042589 3300046543 Bacteria 3311
541 Ga0495668_0286936 3300046616 Bacteria 902
542 Ga0495635_0590080 3300046663 Bacteria 726
543 Ga0495657_0770357 3300046675 Bacteria 551
544 Ga0495658_0108988 3300046683 Bacteria 1663
545 Ga0495658_0608921 3300046683 Bacteria 700
546 Ga0495669_0138492 3300046684 Bacteria 1148
547 Ga0495669_0288127 3300046684 Bacteria 791
548 Ga0495613_0094379 3300046689 Bacteria 2165
549 Ga0495624_0612952 3300046690 Bacteria 648
550 Ga0495604_0545759 3300047317 Bacteria 748
551 Ga0495677_0122827 3300047445 Bacteria 991
552 Ga0495593_0338352 3300047673 Bacteria 752
553 Ga0495614_0113366 3300048089 Bacteria 1191
554 Ga0496100_0107369 3300048903 Unclassified 1934
555 Ga0496100_0975133 3300048903 Unclassified 667
556 Ga0496100_1652565 3300048903 Bacteria 506
557 Ga0496101_0215965 3300048904 Bacteria 1487
558 Ga0496101_1253290 3300048904 Bacteria 580
559 Ga0496102_0015891 3300048905 Bacteria 6566
560 Ga0496102_0479055 3300048905 Bacteria 1166
561 Ga0496104_0342404 3300048907 Bacteria 1408
562 Ga0496104_0563086 3300048907 Unclassified 1050
563 Ga0496105_0190919 3300048908 Bacteria 1675
564 Ga0496106_0225428 3300048909 Bacteria 1495
565 Ga0496107_0260843 3300048910 Bacteria 1289
566 Ga0496107_0409641 3300048910 Bacteria 1008
567 Ga0496107_0777893 3300048910 Bacteria 701
568 Ga0496108_0651874 3300048911 Bacteria 915
569 Ga0496109_0135440 3300048912 Bacteria 2301
570 Ga0496110_0160686 3300048913 Bacteria 2037
571 Ga0496111_0243873 3300048914 Bacteria 1334
572 Ga0496112_0153262 3300048915 Bacteria 2272
573 Ga0496112_0392301 3300048915 Bacteria 1328
574 Ga0496112_1219165 3300048915 Bacteria 669
575 Ga0496112_1272869 3300048915 Bacteria 651
576 Ga0496115_1343690 3300048918 Bacteria 530
577 Ga0501036_1056407 3300049572 Unclassified 664
578 Ga0501039_0401811 3300049575 Bacteria 1076
579 Ga0501039_1096366 3300049575 Bacteria 617
580 Ga0501040_0070401 3300049576 Bacteria 2414
581 Ga0501040_0110603 3300049576 Bacteria 1921
582 Ga0501040_0706401 3300049576 Bacteria 729
583 Ga0501041_0068690 3300049577 Bacteria 2172
584 Ga0501041_0148563 3300049577 Bacteria 1463
585 Ga0501041_0423069 3300049577 Bacteria 845
586 Ga0501041_0782910 3300049577 Bacteria 611
587 Ga0501042_0153517 3300049578 Bacteria 1660
588 Ga0501067_0205483 3300049583 Bacteria 1097
589 Ga0501071_0142652 3300049587 Bacteria 1784
590 Ga0501072_0581547 3300049588 Bacteria 883
591 Ga0501072_0584643 3300049588 Bacteria 881
592 Ga0501072_0823164 3300049588 Bacteria 727
593 Ga0501072_0943134 3300049588 Bacteria 673
594 Ga0501073_0335452 3300049589 Bacteria 1044
595 Ga0501073_0462469 3300049589 Unclassified 877
596 Ga0501074_0462361 3300049590 Unclassified 899
597 Ga0501074_0950502 3300049590 Bacteria 604
598 Ga0501075_0056332 3300049591 Bacteria 2959
599 Ga0501075_0112628 3300049591 Bacteria 2069
600 Ga0501075_0677192 3300049591 Bacteria 786
601 Ga0501075_1239855 3300049591 Bacteria 565
602 Ga0501075_1326843 3300049591 Bacteria 545
603 Ga0501076_0001133 3300049592 Bacteria 17618
604 Ga0501076_0730518 3300049592 Unclassified 817
605 Ga0501076_0968334 3300049592 Bacteria 701
606 Ga0501077_0366530 3300049593 Bacteria 920
607 Ga0501253_104196 3300049683 Bacteria 669
608 Ga0501221_076226 3300049704 Bacteria 800
609 Ga0501079_0056500 3300049741 Bacteria 3028
610 Ga0501080_0221377 3300049742 Bacteria 1732
611 Ga0501080_0226394 3300049742 Unclassified 1710
612 Ga0501080_0352811 3300049742 Bacteria 1328
613 Ga0501081_0034966 3300049743 Bacteria 3420
614 Ga0501081_0424697 3300049743 Bacteria 986
615 Ga0501035_0576089 3300049822 Bacteria 920
616 Ga0501045_0217188 3300049824 Bacteria 1424
617 Ga0501045_0283199 3300049824 Unclassified 1234
618 nmdc:mga00v17_414675_c1 3300050491 Bacteria 875
619 nmdc:mga0k408_289720_c1 3300050493 Bacteria 977
620 nmdc:mga04h51_77010_c1 3300050495 Bacteria 1176
621 nmdc:mga05p37_116_c1 3300050507 Bacteria 48738
622 nmdc:mga05p37_168844_c1 3300050507 Bacteria 2669
623 nmdc:mga05p37_2061015_c1 3300050507 Bacteria 537
624 nmdc:mga05p37_493650_c1 3300050507 Bacteria 1407
625 nmdc:mga05p37_803347_c1 3300050507 Bacteria 1029
626 nmdc:mga09592_110936_c1 3300050508 Bacteria 2353
627 nmdc:mga09592_272832_c1 3300050508 Bacteria 1467
628 nmdc:mga09592_601686_c1 3300050508 Bacteria 942
629 nmdc:mga09592_8310_c1 3300050508 Bacteria 8442
630 nmdc:mga0qj67_121164_c1 3300050509 Bacteria 2116
631 nmdc:mga0qj67_14492_c1 3300050509 Bacteria 5961
632 nmdc:mga0qj67_315686_c1 3300050509 Bacteria 1265
633 nmdc:mga06r32_1038089_c1 3300050510 Bacteria 771
634 nmdc:mga06r32_115706_c1 3300050510 Bacteria 2641
635 nmdc:mga06r32_1372953_c1 3300050510 Bacteria 649
636 nmdc:mga08y16_1084476_c1 3300050511 Bacteria 777
637 nmdc:mga08y16_1127399_c1 3300050511 Bacteria 758
638 nmdc:mga08y16_34858_c1 3300050511 Bacteria 5288
639 nmdc:mga08y16_533604_c1 3300050511 Bacteria 1189
640 nmdc:mga0n895_1545112_c1 3300050512 Unclassified 629
641 nmdc:mga0rr50_103162_c1 3300050513 Bacteria 2244
642 nmdc:mga0rr50_1364747_c1 3300050513 Bacteria 600
643 nmdc:mga0rr50_26_c1 3300050513 Bacteria 110468
644 nmdc:mga0rr50_490177_c1 3300050513 Bacteria 1044
645 nmdc:mga08x19_2284_c2 3300050514 Bacteria 9815
646 nmdc:mga0a205_39183_c2 3300050515 Bacteria 2596
647 nmdc:mga0a205_828267_c1 3300050515 Unclassified 773
648 nmdc:mga0sz30_175961_c1 3300050516 Bacteria 949
649 Ga0500583_0115710 3300053092 Bacteria 1324
650 Ga0500641_0001084 3300053096 Bacteria 9692
651 Ga0500555_020942 3300053103 Bacteria 1884
652 Ga0500608_021037 3300053122 Bacteria 3009
653 Ga0500573_0091400 3300053140 Bacteria 1719
654 Ga0500590_085935 3300053148 Bacteria 1536
655 Ga0501084_0077260 3300054114 Bacteria 2791
656 Ga0501084_1683786 3300054114 Bacteria 530
657 Ga0590077_080692 3300059426 Bacteria 749
658 Ga0501082_0081207 3300060353 Unclassified 2798
659 Ga0501082_0851521 3300060353 Bacteria 797
660 Ga0501082_1202177 3300060353 Bacteria 662
661 Ga0530510_0654066 3300061734 Bacteria 800
662 Ga0530510_0860298 3300061734 Bacteria 692

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100606239 Ga0070668_1006062392 69
2 3300005456 Ga0070678_100070177 Ga0070678_1000701773 69
3 3300006237 Ga0097621_100717242 Ga0097621_1007172422 69
4 3300009177 Ga0105248_11044497 Ga0105248_110444972 69
5 3300009551 Ga0105238_12428353 Ga0105238_124283531 69
6 3300013306 Ga0163162_10023926 Ga0163162_100239264 69
7 3300025972 Ga0207668_10603813 Ga0207668_106038132 69
8 3300026089 Ga0207648_10183314 Ga0207648_101833142 69
9 3300009147 Ga0114129_10665844 Ga0114129_106658442 70
10 3300012502 Ga0157347_1063638 Ga0157347_10636382 70
11 3300050516 nmdc:mga0sz30_175961_c1 nmdc:mga0sz30_175961_c1_672_917 70
12 3300053122 Ga0500608_021037 Ga0500608_021037_2703_2948 70
13 3300053140 Ga0500573_0091400 Ga0500573_0091400_1140_1385 70
14 3300010159 Ga0099796_10002357 Ga0099796_100023576 71
15 3300005339 Ga0070660_100002703 Ga0070660_1000027036 72
16 3300005340 Ga0070689_101504876 Ga0070689_1015048761 72
17 3300005344 Ga0070661_100016797 Ga0070661_1000167973 72
18 3300005353 Ga0070669_101506892 Ga0070669_1015068922 72
19 3300005365 Ga0070688_100450057 Ga0070688_1004500572 72
20 3300005366 Ga0070659_100000025 Ga0070659_10000002592 72
21 3300005406 Ga0070703_10428441 Ga0070703_104284412 72
22 3300005444 Ga0070694_100105286 Ga0070694_1001052862 72
23 3300005444 Ga0070694_101510724 Ga0070694_1015107242 72
24 3300005459 Ga0068867_100332776 Ga0068867_1003327762 72
25 3300005530 Ga0070679_100964999 Ga0070679_1009649992 72
26 3300005549 Ga0070704_100021145 Ga0070704_1000211457 72
27 3300005549 Ga0070704_100585697 Ga0070704_1005856972 72
28 3300005577 Ga0068857_100469186 Ga0068857_1004691862 72
29 3300005617 Ga0068859_100129037 Ga0068859_1001290373 72
30 3300005618 Ga0068864_100423987 Ga0068864_1004239872 72
31 3300005844 Ga0068862_100087723 Ga0068862_1000877233 72
32 3300005985 Ga0081539_10184947 Ga0081539_101849472 72
33 3300006914 Ga0075436_100016028 Ga0075436_1000160282 72
34 3300006931 Ga0097620_100129031 Ga0097620_1001290313 72
35 3300007076 Ga0075435_100009967 Ga0075435_1000099676 72
36 3300009094 Ga0111539_11591105 Ga0111539_115911052 72
37 3300009148 Ga0105243_11041403 Ga0105243_110414032 72
38 3300013297 Ga0157378_10795335 Ga0157378_107953352 72
39 3300013307 Ga0157372_10034000 Ga0157372_100340005 72
40 3300014326 Ga0157380_10563520 Ga0157380_105635202 72
41 3300014745 Ga0157377_10332258 Ga0157377_103322582 72
42 3300025919 Ga0207657_10007702 Ga0207657_100077025 72
43 3300025927 Ga0207687_11291754 Ga0207687_112917542 72
44 3300025928 Ga0207700_10646964 Ga0207700_106469642 72
45 3300025932 Ga0207690_10000005 Ga0207690_10000005384 72
46 3300025932 Ga0207690_10663083 Ga0207690_106630832 72
47 3300025945 Ga0207679_11306713 Ga0207679_113067131 72
48 3300026041 Ga0207639_10801285 Ga0207639_108012851 72
49 3300028794 Ga0307515_10049149 Ga0307515_100491492 72
50 3300030736 Ga0316180_1040358 Ga0316180_10403583 72
51 3300037471 Ga0395905_0140386 Ga0395905_0140386_420_656 72
52 3300037471 Ga0395905_0410187 Ga0395905_0410187_487_723 72
53 3300038443 Ga0395901_0488994 Ga0395901_0488994_644_880 72
54 3300041441 Ga0451787_458879 Ga0451787_458879_117_359 72
55 3300042003 Ga0439443_001792 Ga0439443_001792_10_246 72
56 3300042011 Ga0439454_116660 Ga0439454_116660_95_331 72
57 3300042461 Ga0439460_0116060 Ga0439460_0116060_383_619 72
58 3300042461 Ga0439460_0260369 Ga0439460_0260369_126_362 72
59 3300042876 Ga0451577_0202244 Ga0451577_0202244_634_912 72
60 3300048903 Ga0496100_0975133 Ga0496100_0975133_129_365 72
61 3300048910 Ga0496107_0260843 Ga0496107_0260843_103_339 72
62 3300049577 Ga0501041_0423069 Ga0501041_0423069_511_747 72
63 3300049588 Ga0501072_0943134 Ga0501072_0943134_192_428 72
64 3300049591 Ga0501075_1326843 Ga0501075_1326843_99_335 72
65 3300050513 nmdc:mga0rr50_26_c1 nmdc:mga0rr50_26_c1_96659_96895 72
66 3300050514 nmdc:mga08x19_2284_c2 nmdc:mga08x19_2284_c2_9338_9574 72
67 3300053092 Ga0500583_0115710 Ga0500583_0115710_687_923 72
68 3300005328 Ga0070676_11269675 Ga0070676_112696751 73
69 3300005338 Ga0068868_102401313 Ga0068868_1024013132 73
70 3300005347 Ga0070668_100929735 Ga0070668_1009297351 73
71 3300005355 Ga0070671_100078705 Ga0070671_1000787052 73
72 3300005355 Ga0070671_100297152 Ga0070671_1002971521 73
73 3300005366 Ga0070659_100948193 Ga0070659_1009481932 73
74 3300005367 Ga0070667_100100777 Ga0070667_1001007772 73
75 3300005367 Ga0070667_100206629 Ga0070667_1002066292 73
76 3300005455 Ga0070663_100737880 Ga0070663_1007378801 73
77 3300005456 Ga0070678_100003819 Ga0070678_1000038198 73
78 3300005456 Ga0070678_100033857 Ga0070678_1000338572 73
79 3300005456 Ga0070678_101749686 Ga0070678_1017496861 73
80 3300005535 Ga0070684_101203367 Ga0070684_1012033671 73
81 3300005539 Ga0068853_100098417 Ga0068853_1000984173 73
82 3300005548 Ga0070665_100027600 Ga0070665_1000276003 73
83 3300005615 Ga0070702_100813741 Ga0070702_1008137412 73
84 3300005617 Ga0068859_103122151 Ga0068859_1031221511 73
85 3300005719 Ga0068861_100682049 Ga0068861_1006820492 73
86 3300005844 Ga0068862_100889089 Ga0068862_1008890892 73
87 3300006237 Ga0097621_100110850 Ga0097621_1001108502 73
88 3300006237 Ga0097621_100161589 Ga0097621_1001615892 73
89 3300006237 Ga0097621_100872331 Ga0097621_1008723312 73
90 3300006358 Ga0068871_100515751 Ga0068871_1005157512 73
91 3300006358 Ga0068871_101024464 Ga0068871_1010244641 73
92 3300006914 Ga0075436_101001989 Ga0075436_1010019892 73
93 3300006931 Ga0097620_103121840 Ga0097620_1031218401 73
94 3300009176 Ga0105242_11874617 Ga0105242_118746172 73
95 3300009177 Ga0105248_10233078 Ga0105248_102330782 73
96 3300013296 Ga0157374_10477786 Ga0157374_104777861 73
97 3300013296 Ga0157374_11085610 Ga0157374_110856101 73
98 3300013297 Ga0157378_11449364 Ga0157378_114493642 73
99 3300013306 Ga0163162_11054635 Ga0163162_110546351 73
100 3300013306 Ga0163162_12940104 Ga0163162_129401041 73
101 3300013308 Ga0157375_10311349 Ga0157375_103113493 73
102 3300014968 Ga0157379_10138036 Ga0157379_101380363 73
103 3300014968 Ga0157379_11524082 Ga0157379_115240821 73
104 3300014969 Ga0157376_10219809 Ga0157376_102198092 73
105 3300014969 Ga0157376_11083859 Ga0157376_110838592 73
106 3300020081 Ga0206354_11602318 Ga0206354_116023184 73
107 3300020082 Ga0206353_12008140 Ga0206353_120081403 73
108 3300025972 Ga0207668_10426933 Ga0207668_104269332 73
109 3300025986 Ga0207658_10234693 Ga0207658_102346932 73
110 3300026041 Ga0207639_10135680 Ga0207639_101356803 73
111 3300026067 Ga0207678_10491767 Ga0207678_104917672 73
112 3300026118 Ga0207675_100354508 Ga0207675_1003545082 73
113 3300026121 Ga0207683_10071259 Ga0207683_100712593 73
114 3300028379 Ga0268266_10008824 Ga0268266_100088244 73
115 3300028380 Ga0268265_10744664 Ga0268265_107446642 73
116 3300028381 Ga0268264_10700814 Ga0268264_107008142 73
117 3300031507 Ga0307509_10062257 Ga0307509_100622574 73
118 3300041486 Ga0451807_1691547 Ga0451807_1691547_168_410 73
119 3300046517 Ga0495630_0499460 Ga0495630_0499460_150_392 73
120 3300046539 Ga0495621_0063065 Ga0495621_0063065_399_641 73
121 3300046616 Ga0495668_0286936 Ga0495668_0286936_279_518 73
122 3300047445 Ga0495677_0122827 Ga0495677_0122827_208_450 73
123 3300048903 Ga0496100_0107369 Ga0496100_0107369_103_345 73
124 3300048904 Ga0496101_0215965 Ga0496101_0215965_117_359 73
125 3300048907 Ga0496104_0563086 Ga0496104_0563086_724_966 73
126 3300048910 Ga0496107_0409641 Ga0496107_0409641_352_594 73
127 3300048918 Ga0496115_1343690 Ga0496115_1343690_132_383 73
128 3300049572 Ga0501036_1056407 Ga0501036_1056407_249_491 73
129 3300049576 Ga0501040_0706401 Ga0501040_0706401_72_314 73
130 3300049577 Ga0501041_0782910 Ga0501041_0782910_111_353 73
131 3300049589 Ga0501073_0462469 Ga0501073_0462469_248_490 73
132 3300049590 Ga0501074_0462361 Ga0501074_0462361_544_786 73
133 3300049591 Ga0501075_0677192 Ga0501075_0677192_346_588 73
134 3300049592 Ga0501076_0730518 Ga0501076_0730518_264_506 73
135 3300049742 Ga0501080_0226394 Ga0501080_0226394_346_588 73
136 3300049824 Ga0501045_0283199 Ga0501045_0283199_352_594 73
137 3300050493 nmdc:mga0k408_289720_c1 nmdc:mga0k408_289720_c1_664_915 73
138 3300053096 Ga0500641_0001084 Ga0500641_0001084_6642_6884 73
139 3300060353 Ga0501082_0081207 Ga0501082_0081207_727_969 73
140 3300005578 Ga0068854_101205467 Ga0068854_1012054672 74
141 3300025944 Ga0207661_11685960 Ga0207661_116859601 74
142 3300032126 Ga0307415_100959448 Ga0307415_1009594481 74
143 3300048915 Ga0496112_1272869 Ga0496112_1272869_272_523 74
144 3300005330 Ga0070690_100408255 Ga0070690_1004082552 75
145 3300005331 Ga0070670_100166827 Ga0070670_1001668272 75
146 3300005347 Ga0070668_100392397 Ga0070668_1003923973 75
147 3300005353 Ga0070669_100609158 Ga0070669_1006091583 75
148 3300005354 Ga0070675_100421343 Ga0070675_1004213431 75
149 3300005356 Ga0070674_100500692 Ga0070674_1005006922 75
150 3300005364 Ga0070673_100836065 Ga0070673_1008360651 75
151 3300005459 Ga0068867_100486835 Ga0068867_1004868352 75
152 3300005543 Ga0070672_100819295 Ga0070672_1008192951 75
153 3300005543 Ga0070672_100879987 Ga0070672_1008799872 75
154 3300005577 Ga0068857_101433961 Ga0068857_1014339612 75
155 3300006042 Ga0075368_10280356 Ga0075368_102803562 75
156 3300006177 Ga0075362_10410277 Ga0075362_104102772 75
157 3300007076 Ga0075435_100779755 Ga0075435_1007797552 75
158 3300009098 Ga0105245_10000268 Ga0105245_1000026814 75
159 3300012478 Ga0157328_1009701 Ga0157328_10097012 75
160 3300013306 Ga0163162_10019287 Ga0163162_100192873 75
161 3300013306 Ga0163162_10889181 Ga0163162_108891812 75
162 3300013308 Ga0157375_10955252 Ga0157375_109552521 75
163 3300014968 Ga0157379_12598346 Ga0157379_125983461 75
164 3300025925 Ga0207650_10406633 Ga0207650_104066332 75
165 3300025927 Ga0207687_10000168 Ga0207687_1000016819 75
166 3300025940 Ga0207691_10081864 Ga0207691_100818643 75
167 3300025972 Ga0207668_10668391 Ga0207668_106683911 75
168 3300026075 Ga0207708_11654442 Ga0207708_116544422 75
169 3300026116 Ga0207674_12095610 Ga0207674_120956102 75
170 3300026142 Ga0207698_11179814 Ga0207698_111798142 75
171 3300028379 Ga0268266_10869845 Ga0268266_108698452 75
172 3300035691 Ga0373931_1124231 Ga0373931_1124231_205_447 75
173 3300050495 nmdc:mga04h51_77010_c1 nmdc:mga04h51_77010_c1_572_820 75
174 3300050513 nmdc:mga0rr50_1364747_c1 nmdc:mga0rr50_1364747_c1_147_395 75
175 3300050515 nmdc:mga0a205_828267_c1 nmdc:mga0a205_828267_c1_85_333 75
176 3300053103 Ga0500555_020942 Ga0500555_020942_1378_1614 75
177 3300005353 Ga0070669_100553875 Ga0070669_1005538752 76
178 3300005438 Ga0070701_10059661 Ga0070701_100596612 76
179 3300005439 Ga0070711_100242985 Ga0070711_1002429853 76
180 3300005441 Ga0070700_100008534 Ga0070700_1000085343 76
181 3300005467 Ga0070706_100083549 Ga0070706_1000835495 76
182 3300005536 Ga0070697_100043471 Ga0070697_1000434712 76
183 3300005577 Ga0068857_101179710 Ga0068857_1011797102 76
184 3300005617 Ga0068859_100020921 Ga0068859_1000209214 76
185 3300005844 Ga0068862_100089446 Ga0068862_1000894463 76
186 3300005985 Ga0081539_10287889 Ga0081539_102878893 76
187 3300006028 Ga0070717_10148522 Ga0070717_101485223 76
188 3300006175 Ga0070712_100124529 Ga0070712_1001245291 76
189 3300006237 Ga0097621_100078235 Ga0097621_1000782354 76
190 3300006931 Ga0097620_100020922 Ga0097620_1000209224 76
191 3300007076 Ga0075435_100638216 Ga0075435_1006382162 76
192 3300009094 Ga0111539_10032952 Ga0111539_100329526 76
193 3300009147 Ga0114129_11217166 Ga0114129_112171662 76
194 3300009553 Ga0105249_10395588 Ga0105249_103955882 76
195 3300025898 Ga0207692_10937337 Ga0207692_109373372 76
196 3300025915 Ga0207693_10075667 Ga0207693_100756673 76
197 3300025916 Ga0207663_10887495 Ga0207663_108874952 76
198 3300025923 Ga0207681_10367019 Ga0207681_103670192 76
199 3300025939 Ga0207665_11634621 Ga0207665_116346212 76
200 3300025942 Ga0207689_11049759 Ga0207689_110497591 76
201 3300026023 Ga0207677_10145792 Ga0207677_101457921 76
202 3300026075 Ga0207708_10008408 Ga0207708_100084085 76
203 3300026088 Ga0207641_10730999 Ga0207641_107309993 76
204 3300026089 Ga0207648_10145377 Ga0207648_101453772 76
205 3300026116 Ga0207674_10293120 Ga0207674_102931202 76
206 3300028381 Ga0268264_10232840 Ga0268264_102328402 76
207 3300031456 Ga0307513_10176714 Ga0307513_101767143 76
208 3300031903 Ga0307407_10208620 Ga0307407_102086203 76
209 3300031995 Ga0307409_100456376 Ga0307409_1004563762 76
210 3300032002 Ga0307416_103130897 Ga0307416_1031308972 76
211 3300037312 Ga0395899_0117457 Ga0395899_0117457_1311_1547 76
212 3300037418 Ga0395900_0045787 Ga0395900_0045787_2808_3044 76
213 3300037466 Ga0395898_0320856 Ga0395898_0320856_474_710 76
214 3300037471 Ga0395905_0309012 Ga0395905_0309012_314_550 76
215 3300038443 Ga0395901_0474171 Ga0395901_0474171_706_942 76
216 3300041406 Ga0439439_0251544 Ga0439439_0251544_262_513 76
217 3300041997 Ga0439431_0169998 Ga0439431_0169998_168_419 76
218 3300042015 Ga0439462_0060647 Ga0439462_0060647_705_956 76
219 3300042436 Ga0439435_0079856 Ga0439435_0079856_694_945 76
220 3300046462 Ga0495651_0988581 Ga0495651_0988581_147_395 76
221 3300046537 Ga0495598_0148316 Ga0495598_0148316_83_337 76
222 3300046543 Ga0495645_0042589 Ga0495645_0042589_2604_2852 76
223 3300046675 Ga0495657_0770357 Ga0495657_0770357_62_310 76
224 3300046683 Ga0495658_0108988 Ga0495658_0108988_530_775 76
225 3300046684 Ga0495669_0288127 Ga0495669_0288127_514_759 76
226 3300048905 Ga0496102_0479055 Ga0496102_0479055_749_1000 76
227 3300048915 Ga0496112_0153262 Ga0496112_0153262_1439_1690 76
228 3300049589 Ga0501073_0335452 Ga0501073_0335452_301_549 76
229 3300050507 nmdc:mga05p37_803347_c1 nmdc:mga05p37_803347_c1_427_675 76
230 3300050511 nmdc:mga08y16_34858_c1 nmdc:mga08y16_34858_c1_1400_1648 76
231 3300050512 nmdc:mga0n895_1545112_c1 nmdc:mga0n895_1545112_c1_85_330 76
232 3300050513 nmdc:mga0rr50_103162_c1 nmdc:mga0rr50_103162_c1_676_912 76
233 3300054114 Ga0501084_1683786 Ga0501084_1683786_38_289 76
234 3300005290 Ga0065712_10598818 Ga0065712_105988181 77
235 3300005293 Ga0065715_10573733 Ga0065715_105737332 77
236 3300005330 Ga0070690_100247170 Ga0070690_1002471702 77
237 3300005330 Ga0070690_100964223 Ga0070690_1009642232 77
238 3300005331 Ga0070670_101122447 Ga0070670_1011224472 77
239 3300005353 Ga0070669_100171691 Ga0070669_1001716912 77
240 3300005354 Ga0070675_100073690 Ga0070675_1000736903 77
241 3300005364 Ga0070673_101140176 Ga0070673_1011401762 77
242 3300005365 Ga0070688_100250426 Ga0070688_1002504262 77
243 3300005365 Ga0070688_100287198 Ga0070688_1002871982 77
244 3300005365 Ga0070688_100764341 Ga0070688_1007643412 77
245 3300005367 Ga0070667_101126440 Ga0070667_1011264402 77
246 3300005459 Ga0068867_101047560 Ga0068867_1010475602 77
247 3300005466 Ga0070685_10030146 Ga0070685_100301461 77
248 3300005466 Ga0070685_10175876 Ga0070685_101758762 77
249 3300005544 Ga0070686_100334876 Ga0070686_1003348763 77
250 3300005548 Ga0070665_100616461 Ga0070665_1006164612 77
251 3300005564 Ga0070664_100748285 Ga0070664_1007482852 77
252 3300005578 Ga0068854_100215134 Ga0068854_1002151342 77
253 3300005615 Ga0070702_100482708 Ga0070702_1004827083 77
254 3300005617 Ga0068859_100047572 Ga0068859_1000475723 77
255 3300005617 Ga0068859_102920775 Ga0068859_1029207752 77
256 3300005618 Ga0068864_100404644 Ga0068864_1004046442 77
257 3300005842 Ga0068858_100225282 Ga0068858_1002252823 77
258 3300005844 Ga0068862_101557490 Ga0068862_1015574902 77
259 3300006844 Ga0075428_100116951 Ga0075428_1001169512 77
260 3300006844 Ga0075428_100141981 Ga0075428_1001419811 77
261 3300006846 Ga0075430_100051217 Ga0075430_1000512173 77
262 3300006846 Ga0075430_100136238 Ga0075430_1001362383 77
263 3300006846 Ga0075430_100596921 Ga0075430_1005969212 77
264 3300006847 Ga0075431_100900130 Ga0075431_1009001302 77
265 3300006847 Ga0075431_101194047 Ga0075431_1011940472 77
266 3300006880 Ga0075429_100002103 Ga0075429_1000021035 77
267 3300006880 Ga0075429_100008855 Ga0075429_1000088556 77
268 3300006931 Ga0097620_100047572 Ga0097620_1000475723 77
269 3300006931 Ga0097620_102918038 Ga0097620_1029180382 77
270 3300009094 Ga0111539_12276034 Ga0111539_122760342 77
271 3300009147 Ga0114129_10187978 Ga0114129_101879785 77
272 3300009147 Ga0114129_10378776 Ga0114129_103787762 77
273 3300009147 Ga0114129_11351415 Ga0114129_113514152 77
274 3300009177 Ga0105248_10954037 Ga0105248_109540372 77
275 3300009177 Ga0105248_12012541 Ga0105248_120125412 77
276 3300009553 Ga0105249_11288774 Ga0105249_112887742 77
277 3300009553 Ga0105249_12070230 Ga0105249_120702302 77
278 3300011119 Ga0105246_10402080 Ga0105246_104020802 77
279 3300013296 Ga0157374_12917044 Ga0157374_129170442 77
280 3300013306 Ga0163162_10643430 Ga0163162_106434302 77
281 3300013308 Ga0157375_11842166 Ga0157375_118421662 77
282 3300014325 Ga0163163_10114721 Ga0163163_101147213 77
283 3300025893 Ga0207682_10040397 Ga0207682_100403972 77
284 3300025923 Ga0207681_10522993 Ga0207681_105229932 77
285 3300025941 Ga0207711_10393498 Ga0207711_103934982 77
286 3300025941 Ga0207711_10861799 Ga0207711_108617991 77
287 3300025945 Ga0207679_11436773 Ga0207679_114367732 77
288 3300025961 Ga0207712_10997669 Ga0207712_109976692 77
289 3300025961 Ga0207712_11392208 Ga0207712_113922082 77
290 3300026023 Ga0207677_11253730 Ga0207677_112537302 77
291 3300026089 Ga0207648_11373351 Ga0207648_113733512 77
292 3300026095 Ga0207676_10167509 Ga0207676_101675092 77
293 3300028380 Ga0268265_12280548 Ga0268265_122805482 77
294 3300031548 Ga0307408_100707801 Ga0307408_1007078011 77
295 3300032005 Ga0307411_10761932 Ga0307411_107619322 77
296 3300035114 Ga0373939_0065700 Ga0373939_0065700_207_446 77
297 3300041512 Ga0451853_3244223 Ga0451853_3244223_154_405 77
298 3300042876 Ga0451577_1187704 Ga0451577_1187704_151_390 77
299 3300044712 Ga0453684_0396338 Ga0453684_0396338_551_790 77
300 3300045051 Ga0451576_0333798 Ga0451576_0333798_1010_1249 77
301 3300046460 Ga0495638_0492088 Ga0495638_0492088_19_297 77
302 3300046533 Ga0495640_0851130 Ga0495640_0851130_21_260 77
303 3300046663 Ga0495635_0590080 Ga0495635_0590080_71_310 77
304 3300046683 Ga0495658_0608921 Ga0495658_0608921_301_540 77
305 3300046690 Ga0495624_0612952 Ga0495624_0612952_339_578 77
306 3300049588 Ga0501072_0584643 Ga0501072_0584643_48_302 77
307 3300049683 Ga0501253_104196 Ga0501253_104196_65_319 77
308 3300049704 Ga0501221_076226 Ga0501221_076226_195_449 77
309 3300050507 nmdc:mga05p37_168844_c1 nmdc:mga05p37_168844_c1_2210_2452 77
310 3300050507 nmdc:mga05p37_2061015_c1 nmdc:mga05p37_2061015_c1_247_501 77
311 3300050508 nmdc:mga09592_110936_c1 nmdc:mga09592_110936_c1_2045_2299 77
312 3300050508 nmdc:mga09592_272832_c1 nmdc:mga09592_272832_c1_21_269 77
313 3300050508 nmdc:mga09592_8310_c1 nmdc:mga09592_8310_c1_3704_3946 77
314 3300050509 nmdc:mga0qj67_121164_c1 nmdc:mga0qj67_121164_c1_712_966 77
315 3300050509 nmdc:mga0qj67_14492_c1 nmdc:mga0qj67_14492_c1_4708_4953 77
316 3300050509 nmdc:mga0qj67_315686_c1 nmdc:mga0qj67_315686_c1_814_1056 77
317 3300050510 nmdc:mga06r32_1038089_c1 nmdc:mga06r32_1038089_c1_460_702 77
318 3300050510 nmdc:mga06r32_115706_c1 nmdc:mga06r32_115706_c1_1108_1362 77
319 3300005289 Ga0065704_10871835 Ga0065704_108718352 78
320 3300005295 Ga0065707_10474698 Ga0065707_104746982 78
321 3300005328 Ga0070676_10015484 Ga0070676_100154846 78
322 3300005329 Ga0070683_100590095 Ga0070683_1005900951 78
323 3300005330 Ga0070690_100052401 Ga0070690_1000524013 78
324 3300005331 Ga0070670_100893584 Ga0070670_1008935842 78
325 3300005333 Ga0070677_10288935 Ga0070677_102889351 78
326 3300005334 Ga0068869_100008173 Ga0068869_1000081734 78
327 3300005334 Ga0068869_100374296 Ga0068869_1003742961 78
328 3300005334 Ga0068869_100748003 Ga0068869_1007480032 78
329 3300005334 Ga0068869_100813563 Ga0068869_1008135632 78
330 3300005334 Ga0068869_100900618 Ga0068869_1009006182 78
331 3300005335 Ga0070666_10009507 Ga0070666_100095077 78
332 3300005336 Ga0070680_100103767 Ga0070680_1001037673 78
333 3300005336 Ga0070680_101860112 Ga0070680_1018601121 78
334 3300005337 Ga0070682_100054927 Ga0070682_1000549274 78
335 3300005338 Ga0068868_100110556 Ga0068868_1001105563 78
336 3300005338 Ga0068868_100206559 Ga0068868_1002065593 78
337 3300005339 Ga0070660_100018398 Ga0070660_1000183986 78
338 3300005340 Ga0070689_100245192 Ga0070689_1002451922 78
339 3300005343 Ga0070687_100049727 Ga0070687_1000497273 78
340 3300005344 Ga0070661_100088652 Ga0070661_1000886525 78
341 3300005344 Ga0070661_100389580 Ga0070661_1003895802 78
342 3300005347 Ga0070668_100035245 Ga0070668_1000352452 78
343 3300005353 Ga0070669_100129828 Ga0070669_1001298283 78
344 3300005353 Ga0070669_100568233 Ga0070669_1005682333 78
345 3300005354 Ga0070675_100287657 Ga0070675_1002876573 78
346 3300005356 Ga0070674_101278304 Ga0070674_1012783042 78
347 3300005365 Ga0070688_100045488 Ga0070688_1000454883 78
348 3300005366 Ga0070659_100150623 Ga0070659_1001506233 78
349 3300005367 Ga0070667_100214880 Ga0070667_1002148802 78
350 3300005434 Ga0070709_11280593 Ga0070709_112805932 78
351 3300005435 Ga0070714_100992950 Ga0070714_1009929502 78
352 3300005436 Ga0070713_100109093 Ga0070713_1001090932 78
353 3300005436 Ga0070713_100715282 Ga0070713_1007152821 78
354 3300005436 Ga0070713_101753068 Ga0070713_1017530681 78
355 3300005438 Ga0070701_10034373 Ga0070701_100343733 78
356 3300005439 Ga0070711_100308434 Ga0070711_1003084342 78
357 3300005439 Ga0070711_100388931 Ga0070711_1003889312 78
358 3300005439 Ga0070711_100398900 Ga0070711_1003989002 78
359 3300005440 Ga0070705_100055663 Ga0070705_1000556632 78
360 3300005444 Ga0070694_100285475 Ga0070694_1002854752 78
361 3300005445 Ga0070708_100934750 Ga0070708_1009347501 78
362 3300005445 Ga0070708_101313129 Ga0070708_1013131292 78
363 3300005455 Ga0070663_100026770 Ga0070663_1000267706 78
364 3300005455 Ga0070663_100054918 Ga0070663_1000549183 78
365 3300005455 Ga0070663_101813234 Ga0070663_1018132341 78
366 3300005456 Ga0070678_100703457 Ga0070678_1007034572 78
367 3300005457 Ga0070662_100004056 Ga0070662_1000040567 78
368 3300005457 Ga0070662_100110201 Ga0070662_1001102012 78
369 3300005457 Ga0070662_100205716 Ga0070662_1002057163 78
370 3300005459 Ga0068867_100040962 Ga0068867_1000409623 78
371 3300005459 Ga0068867_100409323 Ga0068867_1004093232 78
372 3300005468 Ga0070707_100700503 Ga0070707_1007005032 78
373 3300005518 Ga0070699_100593386 Ga0070699_1005933862 78
374 3300005530 Ga0070679_100161558 Ga0070679_1001615584 78
375 3300005530 Ga0070679_101587368 Ga0070679_1015873681 78
376 3300005535 Ga0070684_100166858 Ga0070684_1001668583 78
377 3300005536 Ga0070697_100332587 Ga0070697_1003325873 78
378 3300005539 Ga0068853_100009185 Ga0068853_1000091857 78
379 3300005539 Ga0068853_101472436 Ga0068853_1014724362 78
380 3300005543 Ga0070672_100005316 Ga0070672_1000053163 78
381 3300005544 Ga0070686_100121643 Ga0070686_1001216432 78
382 3300005544 Ga0070686_100500525 Ga0070686_1005005252 78
383 3300005546 Ga0070696_100737869 Ga0070696_1007378692 78
384 3300005547 Ga0070693_100128393 Ga0070693_1001283932 78
385 3300005548 Ga0070665_100046925 Ga0070665_1000469256 78
386 3300005548 Ga0070665_100123161 Ga0070665_1001231613 78
387 3300005549 Ga0070704_101778654 Ga0070704_1017786541 78
388 3300005563 Ga0068855_100003776 Ga0068855_10000377615 78
389 3300005563 Ga0068855_102350156 Ga0068855_1023501561 78
390 3300005564 Ga0070664_100085694 Ga0070664_1000856945 78
391 3300005564 Ga0070664_100110802 Ga0070664_1001108024 78
392 3300005564 Ga0070664_100576987 Ga0070664_1005769873 78
393 3300005577 Ga0068857_101323589 Ga0068857_1013235892 78
394 3300005578 Ga0068854_100002823 Ga0068854_1000028239 78
395 3300005578 Ga0068854_100259132 Ga0068854_1002591323 78
396 3300005614 Ga0068856_100002343 Ga0068856_10000234318 78
397 3300005614 Ga0068856_102460236 Ga0068856_1024602362 78
398 3300005615 Ga0070702_100093233 Ga0070702_1000932332 78
399 3300005616 Ga0068852_100091821 Ga0068852_1000918213 78
400 3300005617 Ga0068859_100012763 Ga0068859_1000127635 78
401 3300005617 Ga0068859_100026780 Ga0068859_1000267808 78
402 3300005617 Ga0068859_100929039 Ga0068859_1009290392 78
403 3300005618 Ga0068864_100363654 Ga0068864_1003636542 78
404 3300005718 Ga0068866_10008527 Ga0068866_100085277 78
405 3300005718 Ga0068866_10035055 Ga0068866_100350553 78
406 3300005719 Ga0068861_100010852 Ga0068861_1000108522 78
407 3300005834 Ga0068851_10009450 Ga0068851_100094502 78
408 3300005834 Ga0068851_10768220 Ga0068851_107682202 78
409 3300005840 Ga0068870_10168921 Ga0068870_101689212 78
410 3300005840 Ga0068870_10633191 Ga0068870_106331911 78
411 3300005841 Ga0068863_100139097 Ga0068863_1001390973 78
412 3300005842 Ga0068858_100049034 Ga0068858_1000490344 78
413 3300005842 Ga0068858_100116594 Ga0068858_1001165943 78
414 3300005843 Ga0068860_100045175 Ga0068860_1000451753 78
415 3300005843 Ga0068860_100202033 Ga0068860_1002020332 78
416 3300005843 Ga0068860_101313013 Ga0068860_1013130132 78
417 3300005844 Ga0068862_100027922 Ga0068862_1000279226 78
418 3300005844 Ga0068862_100035305 Ga0068862_1000353052 78
419 3300005937 Ga0081455_11031900 Ga0081455_110319002 78
420 3300006028 Ga0070717_10185757 Ga0070717_101857572 78
421 3300006051 Ga0075364_10018032 Ga0075364_100180322 78
422 3300006051 Ga0075364_10574104 Ga0075364_105741042 78
423 3300006163 Ga0070715_10077934 Ga0070715_100779341 78
424 3300006173 Ga0070716_100038817 Ga0070716_1000388172 78
425 3300006173 Ga0070716_100245391 Ga0070716_1002453912 78
426 3300006175 Ga0070712_100010067 Ga0070712_1000100678 78
427 3300006175 Ga0070712_100048432 Ga0070712_1000484324 78
428 3300006178 Ga0075367_10005952 Ga0075367_100059523 78
429 3300006195 Ga0075366_10054892 Ga0075366_100548923 78
430 3300006237 Ga0097621_100295338 Ga0097621_1002953383 78
431 3300006358 Ga0068871_100035073 Ga0068871_1000350733 78
432 3300006358 Ga0068871_100086142 Ga0068871_1000861425 78
433 3300006847 Ga0075431_101656941 Ga0075431_1016569412 78
434 3300006852 Ga0075433_10983795 Ga0075433_109837952 78
435 3300006871 Ga0075434_100693573 Ga0075434_1006935733 78
436 3300006880 Ga0075429_100399543 Ga0075429_1003995433 78
437 3300006881 Ga0068865_100011201 Ga0068865_1000112014 78
438 3300006881 Ga0068865_100045007 Ga0068865_1000450075 78
439 3300006914 Ga0075436_100805320 Ga0075436_1008053202 78
440 3300006931 Ga0097620_100012764 Ga0097620_1000127644 78
441 3300006931 Ga0097620_100026781 Ga0097620_1000267818 78
442 3300006931 Ga0097620_100928817 Ga0097620_1009288172 78
443 3300009093 Ga0105240_10032471 Ga0105240_100324718 78
444 3300009094 Ga0111539_10025171 Ga0111539_100251714 78
445 3300009094 Ga0111539_10943993 Ga0111539_109439932 78
446 3300009098 Ga0105245_10011633 Ga0105245_100116333 78
447 3300009098 Ga0105245_10053825 Ga0105245_100538253 78
448 3300009101 Ga0105247_10009261 Ga0105247_100092616 78
449 3300009147 Ga0114129_10000783 Ga0114129_1000078318 78
450 3300009147 Ga0114129_10190039 Ga0114129_101900394 78
451 3300009147 Ga0114129_11129983 Ga0114129_111299832 78
452 3300009148 Ga0105243_10034676 Ga0105243_100346764 78
453 3300009148 Ga0105243_10066242 Ga0105243_100662423 78
454 3300009174 Ga0105241_10010190 Ga0105241_100101908 78
455 3300009174 Ga0105241_10343372 Ga0105241_103433722 78
456 3300009176 Ga0105242_10015729 Ga0105242_100157293 78
457 3300009176 Ga0105242_10019367 Ga0105242_100193676 78
458 3300009176 Ga0105242_11418000 Ga0105242_114180002 78
459 3300009177 Ga0105248_10036335 Ga0105248_100363356 78
460 3300009545 Ga0105237_10018241 Ga0105237_100182415 78
461 3300009545 Ga0105237_10060251 Ga0105237_100602515 78
462 3300009551 Ga0105238_10017878 Ga0105238_100178787 78
463 3300009551 Ga0105238_12464525 Ga0105238_124645252 78
464 3300009553 Ga0105249_10014251 Ga0105249_100142518 78
465 3300009553 Ga0105249_10019172 Ga0105249_100191722 78
466 3300010375 Ga0105239_10033308 Ga0105239_100333086 78
467 3300010375 Ga0105239_10875919 Ga0105239_108759193 78
468 3300010375 Ga0105239_11597132 Ga0105239_115971321 78
469 3300011119 Ga0105246_10125001 Ga0105246_101250012 78
470 3300011119 Ga0105246_10211534 Ga0105246_102115343 78
471 3300011119 Ga0105246_10285838 Ga0105246_102858382 78
472 3300013100 Ga0157373_10009270 Ga0157373_100092709 78
473 3300013102 Ga0157371_10014824 Ga0157371_100148246 78
474 3300013105 Ga0157369_10013449 Ga0157369_1001344910 78
475 3300013296 Ga0157374_10013346 Ga0157374_100133465 78
476 3300013297 Ga0157378_10007755 Ga0157378_100077557 78
477 3300013306 Ga0163162_10002231 Ga0163162_100022312 78
478 3300013306 Ga0163162_10403288 Ga0163162_104032882 78
479 3300013307 Ga0157372_10002096 Ga0157372_1000209613 78
480 3300013308 Ga0157375_10293235 Ga0157375_102932352 78
481 3300013308 Ga0157375_13659332 Ga0157375_136593322 78
482 3300014325 Ga0163163_10061806 Ga0163163_100618065 78
483 3300014326 Ga0157380_10048964 Ga0157380_100489642 78
484 3300014326 Ga0157380_10107548 Ga0157380_101075483 78
485 3300014968 Ga0157379_10264639 Ga0157379_102646392 78
486 3300014968 Ga0157379_10296384 Ga0157379_102963842 78
487 3300014969 Ga0157376_10259937 Ga0157376_102599372 78
488 3300025321 Ga0207656_10045692 Ga0207656_100456922 78
489 3300025899 Ga0207642_10099562 Ga0207642_100995622 78
490 3300025900 Ga0207710_10130436 Ga0207710_101304363 78
491 3300025903 Ga0207680_10008419 Ga0207680_100084197 78
492 3300025903 Ga0207680_10069783 Ga0207680_100697832 78
493 3300025905 Ga0207685_10586448 Ga0207685_105864481 78
494 3300025907 Ga0207645_10023980 Ga0207645_100239802 78
495 3300025908 Ga0207643_10170914 Ga0207643_101709142 78
496 3300025911 Ga0207654_10001435 Ga0207654_1000143510 78
497 3300025912 Ga0207707_10076097 Ga0207707_100760975 78
498 3300025913 Ga0207695_10018842 Ga0207695_100188426 78
499 3300025914 Ga0207671_10008003 Ga0207671_100080036 78
500 3300025915 Ga0207693_10015899 Ga0207693_100158998 78
501 3300025915 Ga0207693_10121064 Ga0207693_101210643 78
502 3300025915 Ga0207693_10713081 Ga0207693_107130812 78
503 3300025916 Ga0207663_10220488 Ga0207663_102204882 78
504 3300025916 Ga0207663_10377719 Ga0207663_103777192 78
505 3300025917 Ga0207660_10082744 Ga0207660_100827443 78
506 3300025918 Ga0207662_10018481 Ga0207662_100184815 78
507 3300025919 Ga0207657_10159627 Ga0207657_101596273 78
508 3300025920 Ga0207649_10031848 Ga0207649_100318482 78
509 3300025920 Ga0207649_10693526 Ga0207649_106935262 78
510 3300025921 Ga0207652_10080569 Ga0207652_100805695 78
511 3300025922 Ga0207646_10369970 Ga0207646_103699702 78
512 3300025923 Ga0207681_10180089 Ga0207681_101800893 78
513 3300025923 Ga0207681_10180793 Ga0207681_101807932 78
514 3300025924 Ga0207694_10012240 Ga0207694_100122407 78
515 3300025926 Ga0207659_11124840 Ga0207659_111248402 78
516 3300025926 Ga0207659_11322392 Ga0207659_113223922 78
517 3300025926 Ga0207659_11409771 Ga0207659_114097712 78
518 3300025927 Ga0207687_10000742 Ga0207687_1000074214 78
519 3300025927 Ga0207687_10676875 Ga0207687_106768752 78
520 3300025928 Ga0207700_10030414 Ga0207700_100304143 78
521 3300025928 Ga0207700_10130114 Ga0207700_101301142 78
522 3300025929 Ga0207664_10267759 Ga0207664_102677593 78
523 3300025929 Ga0207664_10987128 Ga0207664_109871282 78
524 3300025932 Ga0207690_10059208 Ga0207690_100592083 78
525 3300025933 Ga0207706_10009801 Ga0207706_100098017 78
526 3300025933 Ga0207706_10161752 Ga0207706_101617522 78
527 3300025934 Ga0207686_10027137 Ga0207686_100271373 78
528 3300025935 Ga0207709_10079690 Ga0207709_100796902 78
529 3300025935 Ga0207709_10198561 Ga0207709_101985613 78
530 3300025936 Ga0207670_10123098 Ga0207670_101230983 78
531 3300025936 Ga0207670_10164987 Ga0207670_101649872 78
532 3300025937 Ga0207669_10466771 Ga0207669_104667712 78
533 3300025937 Ga0207669_11311368 Ga0207669_113113682 78
534 3300025938 Ga0207704_10059813 Ga0207704_100598135 78
535 3300025938 Ga0207704_10375709 Ga0207704_103757092 78
536 3300025939 Ga0207665_10033310 Ga0207665_100333103 78
537 3300025939 Ga0207665_10076933 Ga0207665_100769333 78
538 3300025939 Ga0207665_10282845 Ga0207665_102828452 78
539 3300025940 Ga0207691_10020945 Ga0207691_100209455 78
540 3300025941 Ga0207711_10001257 Ga0207711_100012578 78
541 3300025941 Ga0207711_10037882 Ga0207711_100378824 78
542 3300025942 Ga0207689_10105168 Ga0207689_101051682 78
543 3300025944 Ga0207661_10090641 Ga0207661_100906414 78
544 3300025944 Ga0207661_10750289 Ga0207661_107502892 78
545 3300025945 Ga0207679_10015219 Ga0207679_100152196 78
546 3300025949 Ga0207667_10002588 Ga0207667_1000258814 78
547 3300025949 Ga0207667_12016676 Ga0207667_120166762 78
548 3300025960 Ga0207651_10520127 Ga0207651_105201271 78
549 3300025961 Ga0207712_10128926 Ga0207712_101289262 78
550 3300025961 Ga0207712_10218363 Ga0207712_102183632 78
551 3300025961 Ga0207712_10685682 Ga0207712_106856821 78
552 3300025972 Ga0207668_10033140 Ga0207668_100331406 78
553 3300025972 Ga0207668_10076673 Ga0207668_100766733 78
554 3300025972 Ga0207668_10393500 Ga0207668_103935002 78
555 3300025972 Ga0207668_10551841 Ga0207668_105518411 78
556 3300025981 Ga0207640_10004697 Ga0207640_100046973 78
557 3300025986 Ga0207658_10098020 Ga0207658_100980202 78
558 3300025986 Ga0207658_10177827 Ga0207658_101778273 78
559 3300026023 Ga0207677_10014671 Ga0207677_100146717 78
560 3300026023 Ga0207677_10334399 Ga0207677_103343992 78
561 3300026041 Ga0207639_10046272 Ga0207639_100462725 78
562 3300026067 Ga0207678_10006653 Ga0207678_100066533 78
563 3300026067 Ga0207678_10035427 Ga0207678_100354274 78
564 3300026075 Ga0207708_10381443 Ga0207708_103814433 78
565 3300026078 Ga0207702_10004756 Ga0207702_1000475612 78
566 3300026089 Ga0207648_10018901 Ga0207648_100189014 78
567 3300026089 Ga0207648_10191828 Ga0207648_101918283 78
568 3300026118 Ga0207675_100040662 Ga0207675_1000406622 78
569 3300026118 Ga0207675_100272934 Ga0207675_1002729343 78
570 3300026121 Ga0207683_10088008 Ga0207683_100880083 78
571 3300026142 Ga0207698_10043438 Ga0207698_100434383 78
572 3300027717 Ga0209998_10099870 Ga0209998_100998701 78
573 3300027876 Ga0209974_10065293 Ga0209974_100652932 78
574 3300027907 Ga0207428_10281690 Ga0207428_102816902 78
575 3300028379 Ga0268266_10022609 Ga0268266_100226093 78
576 3300028380 Ga0268265_10111047 Ga0268265_101110474 78
577 3300028380 Ga0268265_10196894 Ga0268265_101968942 78
578 3300028381 Ga0268264_10098798 Ga0268264_100987984 78
579 3300028800 Ga0265338_10142549 Ga0265338_101425493 78
580 3300031456 Ga0307513_10305976 Ga0307513_103059762 78
581 3300031852 Ga0307410_10833520 Ga0307410_108335202 78
582 3300032002 Ga0307416_103759930 Ga0307416_1037599302 78
583 3300032005 Ga0307411_10119946 Ga0307411_101199462 78
584 3300032005 Ga0307411_11632240 Ga0307411_116322402 78
585 3300034957 Ga0373938_0138619 Ga0373938_0138619_65_325 78
586 3300035084 Ga0373928_0060616 Ga0373928_0060616_371_631 78
587 3300035114 Ga0373939_0033440 Ga0373939_0033440_695_943 78
588 3300035114 Ga0373939_0042498 Ga0373939_0042498_169_429 78
589 3300035121 Ga0373960_0350048 Ga0373960_0350048_259_507 78
590 3300035170 Ga0373943_0243435 Ga0373943_0243435_124_363 78
591 3300035242 Ga0373962_0027965 Ga0373962_0027965_594_854 78
592 3300035691 Ga0373931_0009374 Ga0373931_0009374_4405_4665 78
593 3300035691 Ga0373931_0123657 Ga0373931_0123657_1031_1291 78
594 3300035691 Ga0373931_0925439 Ga0373931_0925439_138_386 78
595 3300041456 Ga0451795_0251339 Ga0451795_0251339_187_459 78
596 3300042461 Ga0439460_0007551 Ga0439460_0007551_2114_2401 78
597 3300044712 Ga0453684_1887590 Ga0453684_1887590_12_269 78
598 3300045051 Ga0451576_1055325 Ga0451576_1055325_564_821 78
599 3300046472 Ga0495580_0024894 Ga0495580_0024894_220_480 78
600 3300046472 Ga0495580_0565244 Ga0495580_0565244_346_609 78
601 3300046473 Ga0495582_0001944 Ga0495582_0001944_8553_8792 78
602 3300046535 Ga0495586_0192221 Ga0495586_0192221_644_883 78
603 3300046684 Ga0495669_0138492 Ga0495669_0138492_268_528 78
604 3300046689 Ga0495613_0094379 Ga0495613_0094379_1458_1697 78
605 3300047317 Ga0495604_0545759 Ga0495604_0545759_172_432 78
606 3300047673 Ga0495593_0338352 Ga0495593_0338352_155_394 78
607 3300048089 Ga0495614_0113366 Ga0495614_0113366_595_834 78
608 3300048903 Ga0496100_1652565 Ga0496100_1652565_233_493 78
609 3300048904 Ga0496101_1253290 Ga0496101_1253290_250_510 78
610 3300048905 Ga0496102_0015891 Ga0496102_0015891_5228_5488 78
611 3300048907 Ga0496104_0342404 Ga0496104_0342404_728_988 78
612 3300048908 Ga0496105_0190919 Ga0496105_0190919_498_758 78
613 3300048909 Ga0496106_0225428 Ga0496106_0225428_77_337 78
614 3300048910 Ga0496107_0777893 Ga0496107_0777893_382_642 78
615 3300048911 Ga0496108_0651874 Ga0496108_0651874_402_662 78
616 3300048912 Ga0496109_0135440 Ga0496109_0135440_1365_1625 78
617 3300048913 Ga0496110_0160686 Ga0496110_0160686_162_422 78
618 3300048914 Ga0496111_0243873 Ga0496111_0243873_707_967 78
619 3300048915 Ga0496112_0392301 Ga0496112_0392301_192_452 78
620 3300048915 Ga0496112_1219165 Ga0496112_1219165_48_308 78
621 3300049575 Ga0501039_0401811 Ga0501039_0401811_96_353 78
622 3300049575 Ga0501039_1096366 Ga0501039_1096366_44_301 78
623 3300049576 Ga0501040_0070401 Ga0501040_0070401_1012_1269 78
624 3300049576 Ga0501040_0110603 Ga0501040_0110603_561_818 78
625 3300049577 Ga0501041_0068690 Ga0501041_0068690_958_1215 78
626 3300049577 Ga0501041_0148563 Ga0501041_0148563_23_280 78
627 3300049578 Ga0501042_0153517 Ga0501042_0153517_460_717 78
628 3300049583 Ga0501067_0205483 Ga0501067_0205483_376_633 78
629 3300049587 Ga0501071_0142652 Ga0501071_0142652_290_547 78
630 3300049588 Ga0501072_0581547 Ga0501072_0581547_381_638 78
631 3300049588 Ga0501072_0823164 Ga0501072_0823164_153_410 78
632 3300049590 Ga0501074_0950502 Ga0501074_0950502_311_568 78
633 3300049591 Ga0501075_0056332 Ga0501075_0056332_2006_2263 78
634 3300049591 Ga0501075_0112628 Ga0501075_0112628_1636_1893 78
635 3300049591 Ga0501075_1239855 Ga0501075_1239855_22_309 78
636 3300049592 Ga0501076_0001133 Ga0501076_0001133_14414_14671 78
637 3300049592 Ga0501076_0968334 Ga0501076_0968334_242_499 78
638 3300049593 Ga0501077_0366530 Ga0501077_0366530_439_696 78
639 3300049741 Ga0501079_0056500 Ga0501079_0056500_282_539 78
640 3300049742 Ga0501080_0221377 Ga0501080_0221377_359_616 78
641 3300049742 Ga0501080_0352811 Ga0501080_0352811_107_364 78
642 3300049743 Ga0501081_0034966 Ga0501081_0034966_1363_1620 78
643 3300049743 Ga0501081_0424697 Ga0501081_0424697_242_499 78
644 3300049822 Ga0501035_0576089 Ga0501035_0576089_501_758 78
645 3300049824 Ga0501045_0217188 Ga0501045_0217188_625_882 78
646 3300050491 nmdc:mga00v17_414675_c1 nmdc:mga00v17_414675_c1_93_347 78
647 3300050507 nmdc:mga05p37_116_c1 nmdc:mga05p37_116_c1_8224_8481 78
648 3300050507 nmdc:mga05p37_493650_c1 nmdc:mga05p37_493650_c1_1026_1283 78
649 3300050508 nmdc:mga09592_601686_c1 nmdc:mga09592_601686_c1_401_658 78
650 3300050510 nmdc:mga06r32_1372953_c1 nmdc:mga06r32_1372953_c1_117_374 78
651 3300050511 nmdc:mga08y16_1084476_c1 nmdc:mga08y16_1084476_c1_363_620 78
652 3300050511 nmdc:mga08y16_1127399_c1 nmdc:mga08y16_1127399_c1_483_734 78
653 3300050511 nmdc:mga08y16_533604_c1 nmdc:mga08y16_533604_c1_784_1035 78
654 3300050513 nmdc:mga0rr50_490177_c1 nmdc:mga0rr50_490177_c1_511_759 78
655 3300050515 nmdc:mga0a205_39183_c2 nmdc:mga0a205_39183_c2_2026_2283 78
656 3300053148 Ga0500590_085935 Ga0500590_085935_667_915 78
657 3300054114 Ga0501084_0077260 Ga0501084_0077260_978_1235 78
658 3300059426 Ga0590077_080692 Ga0590077_080692_287_538 78
659 3300060353 Ga0501082_0851521 Ga0501082_0851521_46_303 78
660 3300060353 Ga0501082_1202177 Ga0501082_1202177_388_645 78
661 3300061734 Ga0530510_0654066 Ga0530510_0654066_392_649 78
662 3300061734 Ga0530510_0860298 Ga0530510_0860298_391_648 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

24

86

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.929 6 58
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9243 6 58
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9141 6 58
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9115 7 61
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9098 2 64
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9348 6 58 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9295 6 58 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.929 6 58 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9243 6 58 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9223 6 58 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A414FTJ7-F1-model_v4 Helix-turn-helix domain-containing protein 0.9666 3 67 GO:0003677
AF-A0A6A2SL11-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9655 2 66 GO:0003677
AF-L5N6Y8-F1-model_v4 Transcriptional regulator 0.9647 2 68 GO:0003677
AF-A0A4Q5A9M0-F1-model_v4 Cro/Cl family transcriptional regulator 0.9636 2 67 GO:0003677
AF-C1FTK8-F1-model_v4 Transcription regulator, Cro/CI family-related protein 0.9629 3 66 GO:0003677

Feature Viewer

pLDDT pTM Quality
83.18 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map