F473466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 307 | 662 | 83 |
Family's Representative Sequence
| Representative Sequence | 3300007076|Ga0075435_100638216|Ga0075435_1006382162 |
| Length | 96 |
| Sequence | MFSRKARACAKTSKGRSDVAIVVKLDDMLHDRRMTLTELADQIGMALANVSILKTGKARAIRFSTLEAICEALACQPGDILKFEPEEPRRKRSPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 112 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 218 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 224 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 225 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 226 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 227 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 279 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 287 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 303 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 304 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.42 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 92.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10871835 | 3300005289 | Bacteria | 503 |
| 2 | Ga0065712_10598818 | 3300005290 | Bacteria | 586 |
| 3 | Ga0065715_10573733 | 3300005293 | Bacteria | 721 |
| 4 | Ga0065707_10474698 | 3300005295 | Bacteria | 779 |
| 5 | Ga0070676_10015484 | 3300005328 | Bacteria | 4207 |
| 6 | Ga0070676_11269675 | 3300005328 | Bacteria | 561 |
| 7 | Ga0070683_100590095 | 3300005329 | Bacteria | 1063 |
| 8 | Ga0070690_100052401 | 3300005330 | Bacteria | 2608 |
| 9 | Ga0070690_100247170 | 3300005330 | Unclassified | 1260 |
| 10 | Ga0070690_100408255 | 3300005330 | Bacteria | 999 |
| 11 | Ga0070690_100964223 | 3300005330 | Bacteria | 670 |
| 12 | Ga0070670_100166827 | 3300005331 | Unclassified | 1909 |
| 13 | Ga0070670_100893584 | 3300005331 | Bacteria | 805 |
| 14 | Ga0070670_101122447 | 3300005331 | Bacteria | 717 |
| 15 | Ga0070677_10288935 | 3300005333 | Bacteria | 829 |
| 16 | Ga0068869_100008173 | 3300005334 | Bacteria | 6732 |
| 17 | Ga0068869_100374296 | 3300005334 | Bacteria | 1166 |
| 18 | Ga0068869_100748003 | 3300005334 | Bacteria | 837 |
| 19 | Ga0068869_100813563 | 3300005334 | Bacteria | 804 |
| 20 | Ga0068869_100900618 | 3300005334 | Bacteria | 765 |
| 21 | Ga0070666_10009507 | 3300005335 | Bacteria | 6063 |
| 22 | Ga0070680_100103767 | 3300005336 | Bacteria | 2362 |
| 23 | Ga0070680_101860112 | 3300005336 | Bacteria | 522 |
| 24 | Ga0070682_100054927 | 3300005337 | Bacteria | 2500 |
| 25 | Ga0068868_100110556 | 3300005338 | Bacteria | 2232 |
| 26 | Ga0068868_100206559 | 3300005338 | Bacteria | 1640 |
| 27 | Ga0068868_102401313 | 3300005338 | Bacteria | 503 |
| 28 | Ga0070660_100002703 | 3300005339 | Bacteria | 12174 |
| 29 | Ga0070660_100018398 | 3300005339 | Bacteria | 5106 |
| 30 | Ga0070689_100245192 | 3300005340 | Bacteria | 1477 |
| 31 | Ga0070689_101504876 | 3300005340 | Bacteria | 610 |
| 32 | Ga0070687_100049727 | 3300005343 | Bacteria | 2162 |
| 33 | Ga0070661_100016797 | 3300005344 | Bacteria | 5181 |
| 34 | Ga0070661_100088652 | 3300005344 | Bacteria | 2290 |
| 35 | Ga0070661_100389580 | 3300005344 | Bacteria | 1100 |
| 36 | Ga0070668_100035245 | 3300005347 | Bacteria | 3815 |
| 37 | Ga0070668_100392397 | 3300005347 | Bacteria | 1183 |
| 38 | Ga0070668_100606239 | 3300005347 | Bacteria | 958 |
| 39 | Ga0070668_100929735 | 3300005347 | Bacteria | 778 |
| 40 | Ga0070669_100129828 | 3300005353 | Bacteria | 1932 |
| 41 | Ga0070669_100171691 | 3300005353 | Bacteria | 1691 |
| 42 | Ga0070669_100553875 | 3300005353 | Bacteria | 959 |
| 43 | Ga0070669_100568233 | 3300005353 | Bacteria | 947 |
| 44 | Ga0070669_100609158 | 3300005353 | Bacteria | 915 |
| 45 | Ga0070669_101506892 | 3300005353 | Bacteria | 585 |
| 46 | Ga0070675_100073690 | 3300005354 | Unclassified | 2835 |
| 47 | Ga0070675_100287657 | 3300005354 | Bacteria | 1446 |
| 48 | Ga0070675_100421343 | 3300005354 | Bacteria | 1194 |
| 49 | Ga0070671_100078705 | 3300005355 | Bacteria | 2755 |
| 50 | Ga0070671_100297152 | 3300005355 | Bacteria | 1375 |
| 51 | Ga0070674_100500692 | 3300005356 | Bacteria | 1012 |
| 52 | Ga0070674_101278304 | 3300005356 | Bacteria | 654 |
| 53 | Ga0070673_100836065 | 3300005364 | Bacteria | 851 |
| 54 | Ga0070673_101140176 | 3300005364 | Bacteria | 729 |
| 55 | Ga0070688_100045488 | 3300005365 | Bacteria | 2713 |
| 56 | Ga0070688_100250426 | 3300005365 | Bacteria | 1261 |
| 57 | Ga0070688_100287198 | 3300005365 | Bacteria | 1184 |
| 58 | Ga0070688_100450057 | 3300005365 | Unclassified | 962 |
| 59 | Ga0070688_100764341 | 3300005365 | Unclassified | 753 |
| 60 | Ga0070659_100000025 | 3300005366 | Bacteria | 144955 |
| 61 | Ga0070659_100150623 | 3300005366 | Bacteria | 1898 |
| 62 | Ga0070659_100948193 | 3300005366 | Bacteria | 754 |
| 63 | Ga0070667_100100777 | 3300005367 | Bacteria | 2494 |
| 64 | Ga0070667_100206629 | 3300005367 | Bacteria | 1744 |
| 65 | Ga0070667_100214880 | 3300005367 | Bacteria | 1710 |
| 66 | Ga0070667_101126440 | 3300005367 | Bacteria | 734 |
| 67 | Ga0070703_10428441 | 3300005406 | Bacteria | 582 |
| 68 | Ga0070709_11280593 | 3300005434 | Bacteria | 591 |
| 69 | Ga0070714_100992950 | 3300005435 | Bacteria | 817 |
| 70 | Ga0070713_100109093 | 3300005436 | Unclassified | 2411 |
| 71 | Ga0070713_100715282 | 3300005436 | Bacteria | 957 |
| 72 | Ga0070713_101753068 | 3300005436 | Bacteria | 603 |
| 73 | Ga0070701_10034373 | 3300005438 | Bacteria | 2538 |
| 74 | Ga0070701_10059661 | 3300005438 | Bacteria | 2007 |
| 75 | Ga0070711_100242985 | 3300005439 | Bacteria | 1408 |
| 76 | Ga0070711_100308434 | 3300005439 | Bacteria | 1261 |
| 77 | Ga0070711_100388931 | 3300005439 | Bacteria | 1129 |
| 78 | Ga0070711_100398900 | 3300005439 | Bacteria | 1116 |
| 79 | Ga0070705_100055663 | 3300005440 | Bacteria | 2326 |
| 80 | Ga0070700_100008534 | 3300005441 | Bacteria | 5578 |
| 81 | Ga0070694_100105286 | 3300005444 | Bacteria | 2002 |
| 82 | Ga0070694_100285475 | 3300005444 | Bacteria | 1260 |
| 83 | Ga0070694_101510724 | 3300005444 | Bacteria | 569 |
| 84 | Ga0070708_100934750 | 3300005445 | Bacteria | 814 |
| 85 | Ga0070708_101313129 | 3300005445 | Bacteria | 676 |
| 86 | Ga0070663_100026770 | 3300005455 | Bacteria | 3909 |
| 87 | Ga0070663_100054918 | 3300005455 | Bacteria | 2849 |
| 88 | Ga0070663_100737880 | 3300005455 | Bacteria | 840 |
| 89 | Ga0070663_101813234 | 3300005455 | Bacteria | 547 |
| 90 | Ga0070678_100003819 | 3300005456 | Bacteria | 8450 |
| 91 | Ga0070678_100033857 | 3300005456 | Bacteria | 3552 |
| 92 | Ga0070678_100070177 | 3300005456 | Bacteria | 2618 |
| 93 | Ga0070678_100703457 | 3300005456 | Bacteria | 911 |
| 94 | Ga0070678_101749686 | 3300005456 | Bacteria | 585 |
| 95 | Ga0070662_100004056 | 3300005457 | Bacteria | 9197 |
| 96 | Ga0070662_100110201 | 3300005457 | Bacteria | 2096 |
| 97 | Ga0070662_100205716 | 3300005457 | Bacteria | 1564 |
| 98 | Ga0068867_100040962 | 3300005459 | Bacteria | 3384 |
| 99 | Ga0068867_100332776 | 3300005459 | Unclassified | 1262 |
| 100 | Ga0068867_100409323 | 3300005459 | Unclassified | 1146 |
| 101 | Ga0068867_100486835 | 3300005459 | Bacteria | 1058 |
| 102 | Ga0068867_101047560 | 3300005459 | Unclassified | 742 |
| 103 | Ga0070685_10030146 | 3300005466 | Bacteria | 3020 |
| 104 | Ga0070685_10175876 | 3300005466 | Bacteria | 1374 |
| 105 | Ga0070706_100083549 | 3300005467 | Bacteria | 2958 |
| 106 | Ga0070707_100700503 | 3300005468 | Bacteria | 976 |
| 107 | Ga0070699_100593386 | 3300005518 | Bacteria | 1010 |
| 108 | Ga0070679_100161558 | 3300005530 | Bacteria | 2214 |
| 109 | Ga0070679_100964999 | 3300005530 | Bacteria | 796 |
| 110 | Ga0070679_101587368 | 3300005530 | Bacteria | 602 |
| 111 | Ga0070684_100166858 | 3300005535 | Bacteria | 1999 |
| 112 | Ga0070684_101203367 | 3300005535 | Bacteria | 713 |
| 113 | Ga0070697_100043471 | 3300005536 | Bacteria | 3638 |
| 114 | Ga0070697_100332587 | 3300005536 | Bacteria | 1310 |
| 115 | Ga0068853_100009185 | 3300005539 | Bacteria | 7963 |
| 116 | Ga0068853_100098417 | 3300005539 | Bacteria | 2583 |
| 117 | Ga0068853_101472436 | 3300005539 | Bacteria | 659 |
| 118 | Ga0070672_100005316 | 3300005543 | Bacteria | 8526 |
| 119 | Ga0070672_100819295 | 3300005543 | Bacteria | 820 |
| 120 | Ga0070672_100879987 | 3300005543 | Bacteria | 791 |
| 121 | Ga0070686_100121643 | 3300005544 | Bacteria | 1793 |
| 122 | Ga0070686_100334876 | 3300005544 | Bacteria | 1132 |
| 123 | Ga0070686_100500525 | 3300005544 | Bacteria | 943 |
| 124 | Ga0070696_100737869 | 3300005546 | Bacteria | 806 |
| 125 | Ga0070693_100128393 | 3300005547 | Unclassified | 1581 |
| 126 | Ga0070665_100027600 | 3300005548 | Bacteria | 5718 |
| 127 | Ga0070665_100046925 | 3300005548 | Bacteria | 4336 |
| 128 | Ga0070665_100123161 | 3300005548 | Bacteria | 2595 |
| 129 | Ga0070665_100616461 | 3300005548 | Unclassified | 1098 |
| 130 | Ga0070704_100021145 | 3300005549 | Bacteria | 4212 |
| 131 | Ga0070704_100585697 | 3300005549 | Bacteria | 979 |
| 132 | Ga0070704_101778654 | 3300005549 | Bacteria | 570 |
| 133 | Ga0068855_100003776 | 3300005563 | Bacteria | 18523 |
| 134 | Ga0068855_102350156 | 3300005563 | Bacteria | 533 |
| 135 | Ga0070664_100085694 | 3300005564 | Bacteria | 2721 |
| 136 | Ga0070664_100110802 | 3300005564 | Bacteria | 2395 |
| 137 | Ga0070664_100576987 | 3300005564 | Bacteria | 1042 |
| 138 | Ga0070664_100748285 | 3300005564 | Bacteria | 912 |
| 139 | Ga0068857_100469186 | 3300005577 | Bacteria | 1179 |
| 140 | Ga0068857_101179710 | 3300005577 | Bacteria | 741 |
| 141 | Ga0068857_101323589 | 3300005577 | Bacteria | 699 |
| 142 | Ga0068857_101433961 | 3300005577 | Bacteria | 672 |
| 143 | Ga0068854_100002823 | 3300005578 | Bacteria | 10795 |
| 144 | Ga0068854_100215134 | 3300005578 | Bacteria | 1518 |
| 145 | Ga0068854_100259132 | 3300005578 | Bacteria | 1392 |
| 146 | Ga0068854_101205467 | 3300005578 | Bacteria | 678 |
| 147 | Ga0068856_100002343 | 3300005614 | Bacteria | 19497 |
| 148 | Ga0068856_102460236 | 3300005614 | Bacteria | 528 |
| 149 | Ga0070702_100093233 | 3300005615 | Bacteria | 1831 |
| 150 | Ga0070702_100482708 | 3300005615 | Bacteria | 906 |
| 151 | Ga0070702_100813741 | 3300005615 | Bacteria | 724 |
| 152 | Ga0068852_100091821 | 3300005616 | Bacteria | 2718 |
| 153 | Ga0068859_100012763 | 3300005617 | Bacteria | 8443 |
| 154 | Ga0068859_100020921 | 3300005617 | Bacteria | 6567 |
| 155 | Ga0068859_100026780 | 3300005617 | Bacteria | 5784 |
| 156 | Ga0068859_100047572 | 3300005617 | Bacteria | 4310 |
| 157 | Ga0068859_100129037 | 3300005617 | Unclassified | 2599 |
| 158 | Ga0068859_100929039 | 3300005617 | Bacteria | 954 |
| 159 | Ga0068859_102920775 | 3300005617 | Bacteria | 523 |
| 160 | Ga0068859_103122151 | 3300005617 | Bacteria | 505 |
| 161 | Ga0068864_100363654 | 3300005618 | Bacteria | 1368 |
| 162 | Ga0068864_100404644 | 3300005618 | Unclassified | 1297 |
| 163 | Ga0068864_100423987 | 3300005618 | Bacteria | 1268 |
| 164 | Ga0068866_10008527 | 3300005718 | Bacteria | 4324 |
| 165 | Ga0068866_10035055 | 3300005718 | Bacteria | 2448 |
| 166 | Ga0068861_100010852 | 3300005719 | Bacteria | 6332 |
| 167 | Ga0068861_100682049 | 3300005719 | Bacteria | 953 |
| 168 | Ga0068851_10009450 | 3300005834 | Bacteria | 4535 |
| 169 | Ga0068851_10768220 | 3300005834 | Bacteria | 597 |
| 170 | Ga0068870_10168921 | 3300005840 | Bacteria | 1304 |
| 171 | Ga0068870_10633191 | 3300005840 | Bacteria | 731 |
| 172 | Ga0068863_100139097 | 3300005841 | Bacteria | 2320 |
| 173 | Ga0068858_100049034 | 3300005842 | Bacteria | 3911 |
| 174 | Ga0068858_100116594 | 3300005842 | Bacteria | 2496 |
| 175 | Ga0068858_100225282 | 3300005842 | Bacteria | 1777 |
| 176 | Ga0068860_100045175 | 3300005843 | Bacteria | 4199 |
| 177 | Ga0068860_100202033 | 3300005843 | Bacteria | 1926 |
| 178 | Ga0068860_101313013 | 3300005843 | Bacteria | 744 |
| 179 | Ga0068862_100027922 | 3300005844 | Bacteria | 4753 |
| 180 | Ga0068862_100035305 | 3300005844 | Bacteria | 4233 |
| 181 | Ga0068862_100087723 | 3300005844 | Bacteria | 2706 |
| 182 | Ga0068862_100089446 | 3300005844 | Bacteria | 2680 |
| 183 | Ga0068862_100889089 | 3300005844 | Bacteria | 875 |
| 184 | Ga0068862_101557490 | 3300005844 | Bacteria | 667 |
| 185 | Ga0081455_11031900 | 3300005937 | Bacteria | 508 |
| 186 | Ga0081539_10184947 | 3300005985 | Bacteria | 974 |
| 187 | Ga0081539_10287889 | 3300005985 | Bacteria | 712 |
| 188 | Ga0070717_10148522 | 3300006028 | Bacteria | 2026 |
| 189 | Ga0070717_10185757 | 3300006028 | Unclassified | 1814 |
| 190 | Ga0075368_10280356 | 3300006042 | Bacteria | 716 |
| 191 | Ga0075364_10018032 | 3300006051 | Bacteria | 4415 |
| 192 | Ga0075364_10574104 | 3300006051 | Bacteria | 771 |
| 193 | Ga0070715_10077934 | 3300006163 | Bacteria | 1497 |
| 194 | Ga0070716_100038817 | 3300006173 | Bacteria | 2639 |
| 195 | Ga0070716_100245391 | 3300006173 | Bacteria | 1217 |
| 196 | Ga0070712_100010067 | 3300006175 | Bacteria | 5960 |
| 197 | Ga0070712_100048432 | 3300006175 | Bacteria | 2946 |
| 198 | Ga0070712_100124529 | 3300006175 | Bacteria | 1944 |
| 199 | Ga0075362_10410277 | 3300006177 | Bacteria | 684 |
| 200 | Ga0075367_10005952 | 3300006178 | Bacteria | 6121 |
| 201 | Ga0075366_10054892 | 3300006195 | Bacteria | 2366 |
| 202 | Ga0097621_100078235 | 3300006237 | Bacteria | 2747 |
| 203 | Ga0097621_100110850 | 3300006237 | Bacteria | 2318 |
| 204 | Ga0097621_100161589 | 3300006237 | Bacteria | 1926 |
| 205 | Ga0097621_100295338 | 3300006237 | Bacteria | 1430 |
| 206 | Ga0097621_100717242 | 3300006237 | Bacteria | 922 |
| 207 | Ga0097621_100872331 | 3300006237 | Bacteria | 837 |
| 208 | Ga0068871_100035073 | 3300006358 | Bacteria | 3984 |
| 209 | Ga0068871_100086142 | 3300006358 | Bacteria | 2610 |
| 210 | Ga0068871_100515751 | 3300006358 | Bacteria | 1079 |
| 211 | Ga0068871_101024464 | 3300006358 | Bacteria | 770 |
| 212 | Ga0075428_100116951 | 3300006844 | Bacteria | 2904 |
| 213 | Ga0075428_100141981 | 3300006844 | Bacteria | 2611 |
| 214 | Ga0075430_100051217 | 3300006846 | Bacteria | 3480 |
| 215 | Ga0075430_100136238 | 3300006846 | Bacteria | 2046 |
| 216 | Ga0075430_100596921 | 3300006846 | Bacteria | 911 |
| 217 | Ga0075431_100900130 | 3300006847 | Bacteria | 854 |
| 218 | Ga0075431_101194047 | 3300006847 | Bacteria | 724 |
| 219 | Ga0075431_101656941 | 3300006847 | Bacteria | 597 |
| 220 | Ga0075433_10983795 | 3300006852 | Bacteria | 735 |
| 221 | Ga0075434_100693573 | 3300006871 | Bacteria | 1036 |
| 222 | Ga0075429_100002103 | 3300006880 | Bacteria | 16621 |
| 223 | Ga0075429_100008855 | 3300006880 | Bacteria | 8748 |
| 224 | Ga0075429_100399543 | 3300006880 | Bacteria | 1204 |
| 225 | Ga0068865_100011201 | 3300006881 | Bacteria | 5606 |
| 226 | Ga0068865_100045007 | 3300006881 | Bacteria | 3023 |
| 227 | Ga0075436_100016028 | 3300006914 | Bacteria | 5130 |
| 228 | Ga0075436_100805320 | 3300006914 | Bacteria | 700 |
| 229 | Ga0075436_101001989 | 3300006914 | Bacteria | 627 |
| 230 | Ga0097620_100012764 | 3300006931 | Bacteria | 8443 |
| 231 | Ga0097620_100020922 | 3300006931 | Bacteria | 6567 |
| 232 | Ga0097620_100026781 | 3300006931 | Bacteria | 5784 |
| 233 | Ga0097620_100047572 | 3300006931 | Bacteria | 4310 |
| 234 | Ga0097620_100129031 | 3300006931 | Unclassified | 2599 |
| 235 | Ga0097620_100928817 | 3300006931 | Bacteria | 954 |
| 236 | Ga0097620_102918038 | 3300006931 | Bacteria | 523 |
| 237 | Ga0097620_103121840 | 3300006931 | Bacteria | 505 |
| 238 | Ga0075435_100009967 | 3300007076 | Bacteria | 6923 |
| 239 | Ga0075435_100638216 | 3300007076 | Bacteria | 924 |
| 240 | Ga0075435_100779755 | 3300007076 | Bacteria | 832 |
| 241 | Ga0105240_10032471 | 3300009093 | Bacteria | 6759 |
| 242 | Ga0111539_10025171 | 3300009094 | Bacteria | 7295 |
| 243 | Ga0111539_10032952 | 3300009094 | Bacteria | 6291 |
| 244 | Ga0111539_10943993 | 3300009094 | Bacteria | 1003 |
| 245 | Ga0111539_11591105 | 3300009094 | Bacteria | 758 |
| 246 | Ga0111539_12276034 | 3300009094 | Bacteria | 629 |
| 247 | Ga0105245_10000268 | 3300009098 | Bacteria | 49610 |
| 248 | Ga0105245_10011633 | 3300009098 | Bacteria | 7661 |
| 249 | Ga0105245_10053825 | 3300009098 | Bacteria | 3614 |
| 250 | Ga0105247_10009261 | 3300009101 | Bacteria | 5983 |
| 251 | Ga0114129_10000783 | 3300009147 | Bacteria | 40711 |
| 252 | Ga0114129_10187978 | 3300009147 | Bacteria | 2806 |
| 253 | Ga0114129_10190039 | 3300009147 | Bacteria | 2789 |
| 254 | Ga0114129_10378776 | 3300009147 | Bacteria | 1869 |
| 255 | Ga0114129_10665844 | 3300009147 | Bacteria | 1342 |
| 256 | Ga0114129_11129983 | 3300009147 | Bacteria | 979 |
| 257 | Ga0114129_11217166 | 3300009147 | Bacteria | 937 |
| 258 | Ga0114129_11351415 | 3300009147 | Bacteria | 881 |
| 259 | Ga0105243_10034676 | 3300009148 | Bacteria | 3909 |
| 260 | Ga0105243_10066242 | 3300009148 | Bacteria | 2904 |
| 261 | Ga0105243_11041403 | 3300009148 | Unclassified | 823 |
| 262 | Ga0105241_10010190 | 3300009174 | Bacteria | 6904 |
| 263 | Ga0105241_10343372 | 3300009174 | Bacteria | 1294 |
| 264 | Ga0105242_10015729 | 3300009176 | Bacteria | 5879 |
| 265 | Ga0105242_10019367 | 3300009176 | Bacteria | 5332 |
| 266 | Ga0105242_11418000 | 3300009176 | Bacteria | 723 |
| 267 | Ga0105242_11874617 | 3300009176 | Bacteria | 639 |
| 268 | Ga0105248_10036335 | 3300009177 | Bacteria | 5508 |
| 269 | Ga0105248_10233078 | 3300009177 | Bacteria | 2072 |
| 270 | Ga0105248_10954037 | 3300009177 | Bacteria | 969 |
| 271 | Ga0105248_11044497 | 3300009177 | Bacteria | 923 |
| 272 | Ga0105248_12012541 | 3300009177 | Bacteria | 656 |
| 273 | Ga0105237_10018241 | 3300009545 | Bacteria | 7260 |
| 274 | Ga0105237_10060251 | 3300009545 | Bacteria | 3798 |
| 275 | Ga0105238_10017878 | 3300009551 | Bacteria | 7209 |
| 276 | Ga0105238_12428353 | 3300009551 | Bacteria | 560 |
| 277 | Ga0105238_12464525 | 3300009551 | Bacteria | 556 |
| 278 | Ga0105249_10014251 | 3300009553 | Bacteria | 7028 |
| 279 | Ga0105249_10019172 | 3300009553 | Bacteria | 6100 |
| 280 | Ga0105249_10395588 | 3300009553 | Bacteria | 1411 |
| 281 | Ga0105249_11288774 | 3300009553 | Bacteria | 802 |
| 282 | Ga0105249_12070230 | 3300009553 | Unclassified | 642 |
| 283 | Ga0099796_10002357 | 3300010159 | Bacteria | 4131 |
| 284 | Ga0105239_10033308 | 3300010375 | Bacteria | 5659 |
| 285 | Ga0105239_10875919 | 3300010375 | Bacteria | 1030 |
| 286 | Ga0105239_11597132 | 3300010375 | Bacteria | 754 |
| 287 | Ga0105246_10125001 | 3300011119 | Bacteria | 1912 |
| 288 | Ga0105246_10211534 | 3300011119 | Bacteria | 1514 |
| 289 | Ga0105246_10285838 | 3300011119 | Bacteria | 1325 |
| 290 | Ga0105246_10402080 | 3300011119 | Bacteria | 1138 |
| 291 | Ga0157328_1009701 | 3300012478 | Bacteria | 653 |
| 292 | Ga0157347_1063638 | 3300012502 | Bacteria | 532 |
| 293 | Ga0157373_10009270 | 3300013100 | Bacteria | 7276 |
| 294 | Ga0157371_10014824 | 3300013102 | Bacteria | 5868 |
| 295 | Ga0157369_10013449 | 3300013105 | Bacteria | 9249 |
| 296 | Ga0157374_10013346 | 3300013296 | Bacteria | 7172 |
| 297 | Ga0157374_10477786 | 3300013296 | Unclassified | 1249 |
| 298 | Ga0157374_11085610 | 3300013296 | Bacteria | 821 |
| 299 | Ga0157374_12917044 | 3300013296 | Unclassified | 505 |
| 300 | Ga0157378_10007755 | 3300013297 | Bacteria | 9367 |
| 301 | Ga0157378_10795335 | 3300013297 | Bacteria | 971 |
| 302 | Ga0157378_11449364 | 3300013297 | Bacteria | 730 |
| 303 | Ga0163162_10002231 | 3300013306 | Bacteria | 18202 |
| 304 | Ga0163162_10019287 | 3300013306 | Bacteria | 6686 |
| 305 | Ga0163162_10023926 | 3300013306 | Bacteria | 6028 |
| 306 | Ga0163162_10403288 | 3300013306 | Bacteria | 1500 |
| 307 | Ga0163162_10643430 | 3300013306 | Bacteria | 1184 |
| 308 | Ga0163162_10889181 | 3300013306 | Bacteria | 1004 |
| 309 | Ga0163162_11054635 | 3300013306 | Bacteria | 920 |
| 310 | Ga0163162_12940104 | 3300013306 | Bacteria | 548 |
| 311 | Ga0157372_10002096 | 3300013307 | Bacteria | 21691 |
| 312 | Ga0157372_10034000 | 3300013307 | Bacteria | 5601 |
| 313 | Ga0157375_10293235 | 3300013308 | Bacteria | 1790 |
| 314 | Ga0157375_10311349 | 3300013308 | Bacteria | 1739 |
| 315 | Ga0157375_10955252 | 3300013308 | Bacteria | 999 |
| 316 | Ga0157375_11842166 | 3300013308 | Bacteria | 718 |
| 317 | Ga0157375_13659332 | 3300013308 | Bacteria | 511 |
| 318 | Ga0163163_10061806 | 3300014325 | Bacteria | 3711 |
| 319 | Ga0163163_10114721 | 3300014325 | Bacteria | 2725 |
| 320 | Ga0157380_10048964 | 3300014326 | Bacteria | 3331 |
| 321 | Ga0157380_10107548 | 3300014326 | Bacteria | 2336 |
| 322 | Ga0157380_10563520 | 3300014326 | Unclassified | 1120 |
| 323 | Ga0157377_10332258 | 3300014745 | Unclassified | 1014 |
| 324 | Ga0157379_10138036 | 3300014968 | Unclassified | 2197 |
| 325 | Ga0157379_10264639 | 3300014968 | Bacteria | 1563 |
| 326 | Ga0157379_10296384 | 3300014968 | Bacteria | 1473 |
| 327 | Ga0157379_11524082 | 3300014968 | Bacteria | 651 |
| 328 | Ga0157379_12598346 | 3300014968 | Bacteria | 507 |
| 329 | Ga0157376_10219809 | 3300014969 | Bacteria | 1759 |
| 330 | Ga0157376_10259937 | 3300014969 | Bacteria | 1626 |
| 331 | Ga0157376_11083859 | 3300014969 | Bacteria | 826 |
| 332 | Ga0206354_11602318 | 3300020081 | Bacteria | 3294 |
| 333 | Ga0206353_12008140 | 3300020082 | Bacteria | 6615 |
| 334 | Ga0207656_10045692 | 3300025321 | Bacteria | 1875 |
| 335 | Ga0207682_10040397 | 3300025893 | Bacteria | 1900 |
| 336 | Ga0207692_10937337 | 3300025898 | Bacteria | 570 |
| 337 | Ga0207642_10099562 | 3300025899 | Bacteria | 1456 |
| 338 | Ga0207710_10130436 | 3300025900 | Bacteria | 1207 |
| 339 | Ga0207680_10008419 | 3300025903 | Bacteria | 5063 |
| 340 | Ga0207680_10069783 | 3300025903 | Bacteria | 2173 |
| 341 | Ga0207685_10586448 | 3300025905 | Bacteria | 597 |
| 342 | Ga0207645_10023980 | 3300025907 | Bacteria | 3960 |
| 343 | Ga0207643_10170914 | 3300025908 | Bacteria | 1312 |
| 344 | Ga0207654_10001435 | 3300025911 | Bacteria | 12643 |
| 345 | Ga0207707_10076097 | 3300025912 | Bacteria | 2929 |
| 346 | Ga0207695_10018842 | 3300025913 | Bacteria | 7965 |
| 347 | Ga0207671_10008003 | 3300025914 | Bacteria | 9054 |
| 348 | Ga0207693_10015899 | 3300025915 | Bacteria | 6024 |
| 349 | Ga0207693_10075667 | 3300025915 | Bacteria | 2636 |
| 350 | Ga0207693_10121064 | 3300025915 | Bacteria | 2055 |
| 351 | Ga0207693_10713081 | 3300025915 | Bacteria | 776 |
| 352 | Ga0207663_10220488 | 3300025916 | Bacteria | 1380 |
| 353 | Ga0207663_10377719 | 3300025916 | Bacteria | 1079 |
| 354 | Ga0207663_10887495 | 3300025916 | Bacteria | 712 |
| 355 | Ga0207660_10082744 | 3300025917 | Bacteria | 2362 |
| 356 | Ga0207662_10018481 | 3300025918 | Bacteria | 3956 |
| 357 | Ga0207657_10007702 | 3300025919 | Bacteria | 11004 |
| 358 | Ga0207657_10159627 | 3300025919 | Bacteria | 1832 |
| 359 | Ga0207649_10031848 | 3300025920 | Bacteria | 3138 |
| 360 | Ga0207649_10693526 | 3300025920 | Bacteria | 789 |
| 361 | Ga0207652_10080569 | 3300025921 | Bacteria | 2846 |
| 362 | Ga0207646_10369970 | 3300025922 | Bacteria | 1295 |
| 363 | Ga0207681_10180089 | 3300025923 | Bacteria | 1609 |
| 364 | Ga0207681_10180793 | 3300025923 | Bacteria | 1606 |
| 365 | Ga0207681_10367019 | 3300025923 | Bacteria | 1156 |
| 366 | Ga0207681_10522993 | 3300025923 | Bacteria | 974 |
| 367 | Ga0207694_10012240 | 3300025924 | Bacteria | 6466 |
| 368 | Ga0207650_10406633 | 3300025925 | Unclassified | 1127 |
| 369 | Ga0207659_11124840 | 3300025926 | Bacteria | 676 |
| 370 | Ga0207659_11322392 | 3300025926 | Bacteria | 619 |
| 371 | Ga0207659_11409771 | 3300025926 | Bacteria | 597 |
| 372 | Ga0207687_10000168 | 3300025927 | Bacteria | 43449 |
| 373 | Ga0207687_10000742 | 3300025927 | Bacteria | 22127 |
| 374 | Ga0207687_10676875 | 3300025927 | Bacteria | 874 |
| 375 | Ga0207687_11291754 | 3300025927 | Bacteria | 627 |
| 376 | Ga0207700_10030414 | 3300025928 | Bacteria | 3825 |
| 377 | Ga0207700_10130114 | 3300025928 | Bacteria | 2054 |
| 378 | Ga0207700_10646964 | 3300025928 | Bacteria | 942 |
| 379 | Ga0207664_10267759 | 3300025929 | Bacteria | 1496 |
| 380 | Ga0207664_10987128 | 3300025929 | Bacteria | 755 |
| 381 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 382 | Ga0207690_10059208 | 3300025932 | Bacteria | 2594 |
| 383 | Ga0207690_10663083 | 3300025932 | Bacteria | 856 |
| 384 | Ga0207706_10009801 | 3300025933 | Bacteria | 8790 |
| 385 | Ga0207706_10161752 | 3300025933 | Bacteria | 1968 |
| 386 | Ga0207686_10027137 | 3300025934 | Bacteria | 3350 |
| 387 | Ga0207709_10079690 | 3300025935 | Bacteria | 2106 |
| 388 | Ga0207709_10198561 | 3300025935 | Bacteria | 1431 |
| 389 | Ga0207670_10123098 | 3300025936 | Bacteria | 1889 |
| 390 | Ga0207670_10164987 | 3300025936 | Bacteria | 1657 |
| 391 | Ga0207669_10466771 | 3300025937 | Bacteria | 1003 |
| 392 | Ga0207669_11311368 | 3300025937 | Bacteria | 615 |
| 393 | Ga0207704_10059813 | 3300025938 | Bacteria | 2354 |
| 394 | Ga0207704_10375709 | 3300025938 | Bacteria | 1114 |
| 395 | Ga0207665_10033310 | 3300025939 | Bacteria | 3414 |
| 396 | Ga0207665_10076933 | 3300025939 | Bacteria | 2290 |
| 397 | Ga0207665_10282845 | 3300025939 | Bacteria | 1235 |
| 398 | Ga0207665_11634621 | 3300025939 | Bacteria | 510 |
| 399 | Ga0207691_10020945 | 3300025940 | Bacteria | 6180 |
| 400 | Ga0207691_10081864 | 3300025940 | Bacteria | 2901 |
| 401 | Ga0207711_10001257 | 3300025941 | Bacteria | 24053 |
| 402 | Ga0207711_10037882 | 3300025941 | Bacteria | 4099 |
| 403 | Ga0207711_10393498 | 3300025941 | Bacteria | 1287 |
| 404 | Ga0207711_10861799 | 3300025941 | Bacteria | 843 |
| 405 | Ga0207689_10105168 | 3300025942 | Bacteria | 2319 |
| 406 | Ga0207689_11049759 | 3300025942 | Bacteria | 687 |
| 407 | Ga0207661_10090641 | 3300025944 | Bacteria | 2546 |
| 408 | Ga0207661_10750289 | 3300025944 | Bacteria | 898 |
| 409 | Ga0207661_11685960 | 3300025944 | Bacteria | 579 |
| 410 | Ga0207679_10015219 | 3300025945 | Bacteria | 5076 |
| 411 | Ga0207679_11306713 | 3300025945 | Bacteria | 666 |
| 412 | Ga0207679_11436773 | 3300025945 | Bacteria | 633 |
| 413 | Ga0207667_10002588 | 3300025949 | Bacteria | 22465 |
| 414 | Ga0207667_12016676 | 3300025949 | Bacteria | 537 |
| 415 | Ga0207651_10520127 | 3300025960 | Bacteria | 1031 |
| 416 | Ga0207712_10128926 | 3300025961 | Bacteria | 1924 |
| 417 | Ga0207712_10218363 | 3300025961 | Bacteria | 1523 |
| 418 | Ga0207712_10685682 | 3300025961 | Bacteria | 893 |
| 419 | Ga0207712_10997669 | 3300025961 | Bacteria | 743 |
| 420 | Ga0207712_11392208 | 3300025961 | Bacteria | 627 |
| 421 | Ga0207668_10033140 | 3300025972 | Bacteria | 3420 |
| 422 | Ga0207668_10076673 | 3300025972 | Bacteria | 2408 |
| 423 | Ga0207668_10393500 | 3300025972 | Bacteria | 1170 |
| 424 | Ga0207668_10426933 | 3300025972 | Bacteria | 1126 |
| 425 | Ga0207668_10551841 | 3300025972 | Bacteria | 998 |
| 426 | Ga0207668_10603813 | 3300025972 | Bacteria | 956 |
| 427 | Ga0207668_10668391 | 3300025972 | Bacteria | 911 |
| 428 | Ga0207640_10004697 | 3300025981 | Bacteria | 7417 |
| 429 | Ga0207658_10098020 | 3300025986 | Bacteria | 2290 |
| 430 | Ga0207658_10177827 | 3300025986 | Bacteria | 1758 |
| 431 | Ga0207658_10234693 | 3300025986 | Bacteria | 1550 |
| 432 | Ga0207677_10014671 | 3300026023 | Bacteria | 4584 |
| 433 | Ga0207677_10145792 | 3300026023 | Bacteria | 1819 |
| 434 | Ga0207677_10334399 | 3300026023 | Bacteria | 1263 |
| 435 | Ga0207677_11253730 | 3300026023 | Unclassified | 680 |
| 436 | Ga0207639_10046272 | 3300026041 | Bacteria | 3282 |
| 437 | Ga0207639_10135680 | 3300026041 | Bacteria | 2043 |
| 438 | Ga0207639_10801285 | 3300026041 | Bacteria | 878 |
| 439 | Ga0207678_10006653 | 3300026067 | Bacteria | 10246 |
| 440 | Ga0207678_10035427 | 3300026067 | Bacteria | 4345 |
| 441 | Ga0207678_10491767 | 3300026067 | Bacteria | 1069 |
| 442 | Ga0207708_10008408 | 3300026075 | Bacteria | 7637 |
| 443 | Ga0207708_10381443 | 3300026075 | Bacteria | 1162 |
| 444 | Ga0207708_11654442 | 3300026075 | Bacteria | 562 |
| 445 | Ga0207702_10004756 | 3300026078 | Bacteria | 11984 |
| 446 | Ga0207641_10730999 | 3300026088 | Bacteria | 976 |
| 447 | Ga0207648_10018901 | 3300026089 | Bacteria | 6224 |
| 448 | Ga0207648_10145377 | 3300026089 | Bacteria | 2091 |
| 449 | Ga0207648_10183314 | 3300026089 | Bacteria | 1853 |
| 450 | Ga0207648_10191828 | 3300026089 | Bacteria | 1811 |
| 451 | Ga0207648_11373351 | 3300026089 | Unclassified | 664 |
| 452 | Ga0207676_10167509 | 3300026095 | Bacteria | 1911 |
| 453 | Ga0207674_10293120 | 3300026116 | Bacteria | 1575 |
| 454 | Ga0207674_12095610 | 3300026116 | Bacteria | 530 |
| 455 | Ga0207675_100040662 | 3300026118 | Bacteria | 4342 |
| 456 | Ga0207675_100272934 | 3300026118 | Bacteria | 1641 |
| 457 | Ga0207675_100354508 | 3300026118 | Bacteria | 1438 |
| 458 | Ga0207683_10071259 | 3300026121 | Bacteria | 3072 |
| 459 | Ga0207683_10088008 | 3300026121 | Bacteria | 2763 |
| 460 | Ga0207698_10043438 | 3300026142 | Bacteria | 3367 |
| 461 | Ga0207698_11179814 | 3300026142 | Bacteria | 779 |
| 462 | Ga0209998_10099870 | 3300027717 | Bacteria | 718 |
| 463 | Ga0209974_10065293 | 3300027876 | Bacteria | 1236 |
| 464 | Ga0207428_10281690 | 3300027907 | Bacteria | 1234 |
| 465 | Ga0268266_10008824 | 3300028379 | Bacteria | 8925 |
| 466 | Ga0268266_10022609 | 3300028379 | Bacteria | 5354 |
| 467 | Ga0268266_10869845 | 3300028379 | Bacteria | 871 |
| 468 | Ga0268265_10111047 | 3300028380 | Bacteria | 2238 |
| 469 | Ga0268265_10196894 | 3300028380 | Bacteria | 1744 |
| 470 | Ga0268265_10744664 | 3300028380 | Bacteria | 951 |
| 471 | Ga0268265_12280548 | 3300028380 | Bacteria | 548 |
| 472 | Ga0268264_10098798 | 3300028381 | Bacteria | 2532 |
| 473 | Ga0268264_10232840 | 3300028381 | Bacteria | 1702 |
| 474 | Ga0268264_10700814 | 3300028381 | Bacteria | 1006 |
| 475 | Ga0307515_10049149 | 3300028794 | Bacteria | 6356 |
| 476 | Ga0265338_10142549 | 3300028800 | Bacteria | 1875 |
| 477 | Ga0316180_1040358 | 3300030736 | Bacteria | 1003 |
| 478 | Ga0307513_10176714 | 3300031456 | Bacteria | 2004 |
| 479 | Ga0307513_10305976 | 3300031456 | Bacteria | 1354 |
| 480 | Ga0307509_10062257 | 3300031507 | Bacteria | 3935 |
| 481 | Ga0307408_100707801 | 3300031548 | Bacteria | 906 |
| 482 | Ga0307410_10833520 | 3300031852 | Bacteria | 786 |
| 483 | Ga0307407_10208620 | 3300031903 | Unclassified | 1314 |
| 484 | Ga0307409_100456376 | 3300031995 | Bacteria | 1235 |
| 485 | Ga0307416_103130897 | 3300032002 | Bacteria | 553 |
| 486 | Ga0307416_103759930 | 3300032002 | Bacteria | 508 |
| 487 | Ga0307411_10119946 | 3300032005 | Bacteria | 1901 |
| 488 | Ga0307411_10761932 | 3300032005 | Bacteria | 849 |
| 489 | Ga0307411_11632240 | 3300032005 | Bacteria | 595 |
| 490 | Ga0307415_100959448 | 3300032126 | Bacteria | 792 |
| 491 | Ga0373938_0138619 | 3300034957 | Bacteria | 640 |
| 492 | Ga0373928_0060616 | 3300035084 | Bacteria | 914 |
| 493 | Ga0373939_0033440 | 3300035114 | Bacteria | 1502 |
| 494 | Ga0373939_0042498 | 3300035114 | Bacteria | 1375 |
| 495 | Ga0373939_0065700 | 3300035114 | Bacteria | 1168 |
| 496 | Ga0373960_0350048 | 3300035121 | Bacteria | 560 |
| 497 | Ga0373943_0243435 | 3300035170 | Bacteria | 1008 |
| 498 | Ga0373962_0027965 | 3300035242 | Bacteria | 1528 |
| 499 | Ga0373931_0009374 | 3300035691 | Bacteria | 4679 |
| 500 | Ga0373931_0123657 | 3300035691 | Bacteria | 1481 |
| 501 | Ga0373931_0925439 | 3300035691 | Bacteria | 587 |
| 502 | Ga0373931_1124231 | 3300035691 | Bacteria | 535 |
| 503 | Ga0395899_0117457 | 3300037312 | Bacteria | 1908 |
| 504 | Ga0395900_0045787 | 3300037418 | Bacteria | 4506 |
| 505 | Ga0395898_0320856 | 3300037466 | Bacteria | 1478 |
| 506 | Ga0395905_0140386 | 3300037471 | Bacteria | 2273 |
| 507 | Ga0395905_0309012 | 3300037471 | Bacteria | 1469 |
| 508 | Ga0395905_0410187 | 3300037471 | Bacteria | 1250 |
| 509 | Ga0395901_0474171 | 3300038443 | Bacteria | 1277 |
| 510 | Ga0395901_0488994 | 3300038443 | Bacteria | 1254 |
| 511 | Ga0439439_0251544 | 3300041406 | Bacteria | 524 |
| 512 | Ga0451787_458879 | 3300041441 | Bacteria | 546 |
| 513 | Ga0451795_0251339 | 3300041456 | Bacteria | 508 |
| 514 | Ga0451807_1691547 | 3300041486 | Bacteria | 726 |
| 515 | Ga0451853_3244223 | 3300041512 | Bacteria | 533 |
| 516 | Ga0439431_0169998 | 3300041997 | Bacteria | 626 |
| 517 | Ga0439443_001792 | 3300042003 | Bacteria | 2457 |
| 518 | Ga0439454_116660 | 3300042011 | Bacteria | 514 |
| 519 | Ga0439462_0060647 | 3300042015 | Bacteria | 1024 |
| 520 | Ga0439435_0079856 | 3300042436 | Bacteria | 980 |
| 521 | Ga0439460_0007551 | 3300042461 | Bacteria | 2724 |
| 522 | Ga0439460_0116060 | 3300042461 | Bacteria | 872 |
| 523 | Ga0439460_0260369 | 3300042461 | Bacteria | 601 |
| 524 | Ga0451577_0202244 | 3300042876 | Bacteria | 1793 |
| 525 | Ga0451577_1187704 | 3300042876 | Bacteria | 681 |
| 526 | Ga0453684_0396338 | 3300044712 | Bacteria | 1547 |
| 527 | Ga0453684_1887590 | 3300044712 | Bacteria | 605 |
| 528 | Ga0451576_0333798 | 3300045051 | Bacteria | 1587 |
| 529 | Ga0451576_1055325 | 3300045051 | Bacteria | 851 |
| 530 | Ga0495638_0492088 | 3300046460 | Bacteria | 619 |
| 531 | Ga0495651_0988581 | 3300046462 | Bacteria | 511 |
| 532 | Ga0495580_0024894 | 3300046472 | Bacteria | 4375 |
| 533 | Ga0495580_0565244 | 3300046472 | Bacteria | 754 |
| 534 | Ga0495582_0001944 | 3300046473 | Bacteria | 11607 |
| 535 | Ga0495630_0499460 | 3300046517 | Bacteria | 933 |
| 536 | Ga0495640_0851130 | 3300046533 | Bacteria | 542 |
| 537 | Ga0495586_0192221 | 3300046535 | Bacteria | 1156 |
| 538 | Ga0495598_0148316 | 3300046537 | Bacteria | 817 |
| 539 | Ga0495621_0063065 | 3300046539 | Bacteria | 1350 |
| 540 | Ga0495645_0042589 | 3300046543 | Bacteria | 3311 |
| 541 | Ga0495668_0286936 | 3300046616 | Bacteria | 902 |
| 542 | Ga0495635_0590080 | 3300046663 | Bacteria | 726 |
| 543 | Ga0495657_0770357 | 3300046675 | Bacteria | 551 |
| 544 | Ga0495658_0108988 | 3300046683 | Bacteria | 1663 |
| 545 | Ga0495658_0608921 | 3300046683 | Bacteria | 700 |
| 546 | Ga0495669_0138492 | 3300046684 | Bacteria | 1148 |
| 547 | Ga0495669_0288127 | 3300046684 | Bacteria | 791 |
| 548 | Ga0495613_0094379 | 3300046689 | Bacteria | 2165 |
| 549 | Ga0495624_0612952 | 3300046690 | Bacteria | 648 |
| 550 | Ga0495604_0545759 | 3300047317 | Bacteria | 748 |
| 551 | Ga0495677_0122827 | 3300047445 | Bacteria | 991 |
| 552 | Ga0495593_0338352 | 3300047673 | Bacteria | 752 |
| 553 | Ga0495614_0113366 | 3300048089 | Bacteria | 1191 |
| 554 | Ga0496100_0107369 | 3300048903 | Unclassified | 1934 |
| 555 | Ga0496100_0975133 | 3300048903 | Unclassified | 667 |
| 556 | Ga0496100_1652565 | 3300048903 | Bacteria | 506 |
| 557 | Ga0496101_0215965 | 3300048904 | Bacteria | 1487 |
| 558 | Ga0496101_1253290 | 3300048904 | Bacteria | 580 |
| 559 | Ga0496102_0015891 | 3300048905 | Bacteria | 6566 |
| 560 | Ga0496102_0479055 | 3300048905 | Bacteria | 1166 |
| 561 | Ga0496104_0342404 | 3300048907 | Bacteria | 1408 |
| 562 | Ga0496104_0563086 | 3300048907 | Unclassified | 1050 |
| 563 | Ga0496105_0190919 | 3300048908 | Bacteria | 1675 |
| 564 | Ga0496106_0225428 | 3300048909 | Bacteria | 1495 |
| 565 | Ga0496107_0260843 | 3300048910 | Bacteria | 1289 |
| 566 | Ga0496107_0409641 | 3300048910 | Bacteria | 1008 |
| 567 | Ga0496107_0777893 | 3300048910 | Bacteria | 701 |
| 568 | Ga0496108_0651874 | 3300048911 | Bacteria | 915 |
| 569 | Ga0496109_0135440 | 3300048912 | Bacteria | 2301 |
| 570 | Ga0496110_0160686 | 3300048913 | Bacteria | 2037 |
| 571 | Ga0496111_0243873 | 3300048914 | Bacteria | 1334 |
| 572 | Ga0496112_0153262 | 3300048915 | Bacteria | 2272 |
| 573 | Ga0496112_0392301 | 3300048915 | Bacteria | 1328 |
| 574 | Ga0496112_1219165 | 3300048915 | Bacteria | 669 |
| 575 | Ga0496112_1272869 | 3300048915 | Bacteria | 651 |
| 576 | Ga0496115_1343690 | 3300048918 | Bacteria | 530 |
| 577 | Ga0501036_1056407 | 3300049572 | Unclassified | 664 |
| 578 | Ga0501039_0401811 | 3300049575 | Bacteria | 1076 |
| 579 | Ga0501039_1096366 | 3300049575 | Bacteria | 617 |
| 580 | Ga0501040_0070401 | 3300049576 | Bacteria | 2414 |
| 581 | Ga0501040_0110603 | 3300049576 | Bacteria | 1921 |
| 582 | Ga0501040_0706401 | 3300049576 | Bacteria | 729 |
| 583 | Ga0501041_0068690 | 3300049577 | Bacteria | 2172 |
| 584 | Ga0501041_0148563 | 3300049577 | Bacteria | 1463 |
| 585 | Ga0501041_0423069 | 3300049577 | Bacteria | 845 |
| 586 | Ga0501041_0782910 | 3300049577 | Bacteria | 611 |
| 587 | Ga0501042_0153517 | 3300049578 | Bacteria | 1660 |
| 588 | Ga0501067_0205483 | 3300049583 | Bacteria | 1097 |
| 589 | Ga0501071_0142652 | 3300049587 | Bacteria | 1784 |
| 590 | Ga0501072_0581547 | 3300049588 | Bacteria | 883 |
| 591 | Ga0501072_0584643 | 3300049588 | Bacteria | 881 |
| 592 | Ga0501072_0823164 | 3300049588 | Bacteria | 727 |
| 593 | Ga0501072_0943134 | 3300049588 | Bacteria | 673 |
| 594 | Ga0501073_0335452 | 3300049589 | Bacteria | 1044 |
| 595 | Ga0501073_0462469 | 3300049589 | Unclassified | 877 |
| 596 | Ga0501074_0462361 | 3300049590 | Unclassified | 899 |
| 597 | Ga0501074_0950502 | 3300049590 | Bacteria | 604 |
| 598 | Ga0501075_0056332 | 3300049591 | Bacteria | 2959 |
| 599 | Ga0501075_0112628 | 3300049591 | Bacteria | 2069 |
| 600 | Ga0501075_0677192 | 3300049591 | Bacteria | 786 |
| 601 | Ga0501075_1239855 | 3300049591 | Bacteria | 565 |
| 602 | Ga0501075_1326843 | 3300049591 | Bacteria | 545 |
| 603 | Ga0501076_0001133 | 3300049592 | Bacteria | 17618 |
| 604 | Ga0501076_0730518 | 3300049592 | Unclassified | 817 |
| 605 | Ga0501076_0968334 | 3300049592 | Bacteria | 701 |
| 606 | Ga0501077_0366530 | 3300049593 | Bacteria | 920 |
| 607 | Ga0501253_104196 | 3300049683 | Bacteria | 669 |
| 608 | Ga0501221_076226 | 3300049704 | Bacteria | 800 |
| 609 | Ga0501079_0056500 | 3300049741 | Bacteria | 3028 |
| 610 | Ga0501080_0221377 | 3300049742 | Bacteria | 1732 |
| 611 | Ga0501080_0226394 | 3300049742 | Unclassified | 1710 |
| 612 | Ga0501080_0352811 | 3300049742 | Bacteria | 1328 |
| 613 | Ga0501081_0034966 | 3300049743 | Bacteria | 3420 |
| 614 | Ga0501081_0424697 | 3300049743 | Bacteria | 986 |
| 615 | Ga0501035_0576089 | 3300049822 | Bacteria | 920 |
| 616 | Ga0501045_0217188 | 3300049824 | Bacteria | 1424 |
| 617 | Ga0501045_0283199 | 3300049824 | Unclassified | 1234 |
| 618 | nmdc:mga00v17_414675_c1 | 3300050491 | Bacteria | 875 |
| 619 | nmdc:mga0k408_289720_c1 | 3300050493 | Bacteria | 977 |
| 620 | nmdc:mga04h51_77010_c1 | 3300050495 | Bacteria | 1176 |
| 621 | nmdc:mga05p37_116_c1 | 3300050507 | Bacteria | 48738 |
| 622 | nmdc:mga05p37_168844_c1 | 3300050507 | Bacteria | 2669 |
| 623 | nmdc:mga05p37_2061015_c1 | 3300050507 | Bacteria | 537 |
| 624 | nmdc:mga05p37_493650_c1 | 3300050507 | Bacteria | 1407 |
| 625 | nmdc:mga05p37_803347_c1 | 3300050507 | Bacteria | 1029 |
| 626 | nmdc:mga09592_110936_c1 | 3300050508 | Bacteria | 2353 |
| 627 | nmdc:mga09592_272832_c1 | 3300050508 | Bacteria | 1467 |
| 628 | nmdc:mga09592_601686_c1 | 3300050508 | Bacteria | 942 |
| 629 | nmdc:mga09592_8310_c1 | 3300050508 | Bacteria | 8442 |
| 630 | nmdc:mga0qj67_121164_c1 | 3300050509 | Bacteria | 2116 |
| 631 | nmdc:mga0qj67_14492_c1 | 3300050509 | Bacteria | 5961 |
| 632 | nmdc:mga0qj67_315686_c1 | 3300050509 | Bacteria | 1265 |
| 633 | nmdc:mga06r32_1038089_c1 | 3300050510 | Bacteria | 771 |
| 634 | nmdc:mga06r32_115706_c1 | 3300050510 | Bacteria | 2641 |
| 635 | nmdc:mga06r32_1372953_c1 | 3300050510 | Bacteria | 649 |
| 636 | nmdc:mga08y16_1084476_c1 | 3300050511 | Bacteria | 777 |
| 637 | nmdc:mga08y16_1127399_c1 | 3300050511 | Bacteria | 758 |
| 638 | nmdc:mga08y16_34858_c1 | 3300050511 | Bacteria | 5288 |
| 639 | nmdc:mga08y16_533604_c1 | 3300050511 | Bacteria | 1189 |
| 640 | nmdc:mga0n895_1545112_c1 | 3300050512 | Unclassified | 629 |
| 641 | nmdc:mga0rr50_103162_c1 | 3300050513 | Bacteria | 2244 |
| 642 | nmdc:mga0rr50_1364747_c1 | 3300050513 | Bacteria | 600 |
| 643 | nmdc:mga0rr50_26_c1 | 3300050513 | Bacteria | 110468 |
| 644 | nmdc:mga0rr50_490177_c1 | 3300050513 | Bacteria | 1044 |
| 645 | nmdc:mga08x19_2284_c2 | 3300050514 | Bacteria | 9815 |
| 646 | nmdc:mga0a205_39183_c2 | 3300050515 | Bacteria | 2596 |
| 647 | nmdc:mga0a205_828267_c1 | 3300050515 | Unclassified | 773 |
| 648 | nmdc:mga0sz30_175961_c1 | 3300050516 | Bacteria | 949 |
| 649 | Ga0500583_0115710 | 3300053092 | Bacteria | 1324 |
| 650 | Ga0500641_0001084 | 3300053096 | Bacteria | 9692 |
| 651 | Ga0500555_020942 | 3300053103 | Bacteria | 1884 |
| 652 | Ga0500608_021037 | 3300053122 | Bacteria | 3009 |
| 653 | Ga0500573_0091400 | 3300053140 | Bacteria | 1719 |
| 654 | Ga0500590_085935 | 3300053148 | Bacteria | 1536 |
| 655 | Ga0501084_0077260 | 3300054114 | Bacteria | 2791 |
| 656 | Ga0501084_1683786 | 3300054114 | Bacteria | 530 |
| 657 | Ga0590077_080692 | 3300059426 | Bacteria | 749 |
| 658 | Ga0501082_0081207 | 3300060353 | Unclassified | 2798 |
| 659 | Ga0501082_0851521 | 3300060353 | Bacteria | 797 |
| 660 | Ga0501082_1202177 | 3300060353 | Bacteria | 662 |
| 661 | Ga0530510_0654066 | 3300061734 | Bacteria | 800 |
| 662 | Ga0530510_0860298 | 3300061734 | Bacteria | 692 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100606239 | Ga0070668_1006062392 | 69 |
| 2 | 3300005456 | Ga0070678_100070177 | Ga0070678_1000701773 | 69 |
| 3 | 3300006237 | Ga0097621_100717242 | Ga0097621_1007172422 | 69 |
| 4 | 3300009177 | Ga0105248_11044497 | Ga0105248_110444972 | 69 |
| 5 | 3300009551 | Ga0105238_12428353 | Ga0105238_124283531 | 69 |
| 6 | 3300013306 | Ga0163162_10023926 | Ga0163162_100239264 | 69 |
| 7 | 3300025972 | Ga0207668_10603813 | Ga0207668_106038132 | 69 |
| 8 | 3300026089 | Ga0207648_10183314 | Ga0207648_101833142 | 69 |
| 9 | 3300009147 | Ga0114129_10665844 | Ga0114129_106658442 | 70 |
| 10 | 3300012502 | Ga0157347_1063638 | Ga0157347_10636382 | 70 |
| 11 | 3300050516 | nmdc:mga0sz30_175961_c1 | nmdc:mga0sz30_175961_c1_672_917 | 70 |
| 12 | 3300053122 | Ga0500608_021037 | Ga0500608_021037_2703_2948 | 70 |
| 13 | 3300053140 | Ga0500573_0091400 | Ga0500573_0091400_1140_1385 | 70 |
| 14 | 3300010159 | Ga0099796_10002357 | Ga0099796_100023576 | 71 |
| 15 | 3300005339 | Ga0070660_100002703 | Ga0070660_1000027036 | 72 |
| 16 | 3300005340 | Ga0070689_101504876 | Ga0070689_1015048761 | 72 |
| 17 | 3300005344 | Ga0070661_100016797 | Ga0070661_1000167973 | 72 |
| 18 | 3300005353 | Ga0070669_101506892 | Ga0070669_1015068922 | 72 |
| 19 | 3300005365 | Ga0070688_100450057 | Ga0070688_1004500572 | 72 |
| 20 | 3300005366 | Ga0070659_100000025 | Ga0070659_10000002592 | 72 |
| 21 | 3300005406 | Ga0070703_10428441 | Ga0070703_104284412 | 72 |
| 22 | 3300005444 | Ga0070694_100105286 | Ga0070694_1001052862 | 72 |
| 23 | 3300005444 | Ga0070694_101510724 | Ga0070694_1015107242 | 72 |
| 24 | 3300005459 | Ga0068867_100332776 | Ga0068867_1003327762 | 72 |
| 25 | 3300005530 | Ga0070679_100964999 | Ga0070679_1009649992 | 72 |
| 26 | 3300005549 | Ga0070704_100021145 | Ga0070704_1000211457 | 72 |
| 27 | 3300005549 | Ga0070704_100585697 | Ga0070704_1005856972 | 72 |
| 28 | 3300005577 | Ga0068857_100469186 | Ga0068857_1004691862 | 72 |
| 29 | 3300005617 | Ga0068859_100129037 | Ga0068859_1001290373 | 72 |
| 30 | 3300005618 | Ga0068864_100423987 | Ga0068864_1004239872 | 72 |
| 31 | 3300005844 | Ga0068862_100087723 | Ga0068862_1000877233 | 72 |
| 32 | 3300005985 | Ga0081539_10184947 | Ga0081539_101849472 | 72 |
| 33 | 3300006914 | Ga0075436_100016028 | Ga0075436_1000160282 | 72 |
| 34 | 3300006931 | Ga0097620_100129031 | Ga0097620_1001290313 | 72 |
| 35 | 3300007076 | Ga0075435_100009967 | Ga0075435_1000099676 | 72 |
| 36 | 3300009094 | Ga0111539_11591105 | Ga0111539_115911052 | 72 |
| 37 | 3300009148 | Ga0105243_11041403 | Ga0105243_110414032 | 72 |
| 38 | 3300013297 | Ga0157378_10795335 | Ga0157378_107953352 | 72 |
| 39 | 3300013307 | Ga0157372_10034000 | Ga0157372_100340005 | 72 |
| 40 | 3300014326 | Ga0157380_10563520 | Ga0157380_105635202 | 72 |
| 41 | 3300014745 | Ga0157377_10332258 | Ga0157377_103322582 | 72 |
| 42 | 3300025919 | Ga0207657_10007702 | Ga0207657_100077025 | 72 |
| 43 | 3300025927 | Ga0207687_11291754 | Ga0207687_112917542 | 72 |
| 44 | 3300025928 | Ga0207700_10646964 | Ga0207700_106469642 | 72 |
| 45 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005384 | 72 |
| 46 | 3300025932 | Ga0207690_10663083 | Ga0207690_106630832 | 72 |
| 47 | 3300025945 | Ga0207679_11306713 | Ga0207679_113067131 | 72 |
| 48 | 3300026041 | Ga0207639_10801285 | Ga0207639_108012851 | 72 |
| 49 | 3300028794 | Ga0307515_10049149 | Ga0307515_100491492 | 72 |
| 50 | 3300030736 | Ga0316180_1040358 | Ga0316180_10403583 | 72 |
| 51 | 3300037471 | Ga0395905_0140386 | Ga0395905_0140386_420_656 | 72 |
| 52 | 3300037471 | Ga0395905_0410187 | Ga0395905_0410187_487_723 | 72 |
| 53 | 3300038443 | Ga0395901_0488994 | Ga0395901_0488994_644_880 | 72 |
| 54 | 3300041441 | Ga0451787_458879 | Ga0451787_458879_117_359 | 72 |
| 55 | 3300042003 | Ga0439443_001792 | Ga0439443_001792_10_246 | 72 |
| 56 | 3300042011 | Ga0439454_116660 | Ga0439454_116660_95_331 | 72 |
| 57 | 3300042461 | Ga0439460_0116060 | Ga0439460_0116060_383_619 | 72 |
| 58 | 3300042461 | Ga0439460_0260369 | Ga0439460_0260369_126_362 | 72 |
| 59 | 3300042876 | Ga0451577_0202244 | Ga0451577_0202244_634_912 | 72 |
| 60 | 3300048903 | Ga0496100_0975133 | Ga0496100_0975133_129_365 | 72 |
| 61 | 3300048910 | Ga0496107_0260843 | Ga0496107_0260843_103_339 | 72 |
| 62 | 3300049577 | Ga0501041_0423069 | Ga0501041_0423069_511_747 | 72 |
| 63 | 3300049588 | Ga0501072_0943134 | Ga0501072_0943134_192_428 | 72 |
| 64 | 3300049591 | Ga0501075_1326843 | Ga0501075_1326843_99_335 | 72 |
| 65 | 3300050513 | nmdc:mga0rr50_26_c1 | nmdc:mga0rr50_26_c1_96659_96895 | 72 |
| 66 | 3300050514 | nmdc:mga08x19_2284_c2 | nmdc:mga08x19_2284_c2_9338_9574 | 72 |
| 67 | 3300053092 | Ga0500583_0115710 | Ga0500583_0115710_687_923 | 72 |
| 68 | 3300005328 | Ga0070676_11269675 | Ga0070676_112696751 | 73 |
| 69 | 3300005338 | Ga0068868_102401313 | Ga0068868_1024013132 | 73 |
| 70 | 3300005347 | Ga0070668_100929735 | Ga0070668_1009297351 | 73 |
| 71 | 3300005355 | Ga0070671_100078705 | Ga0070671_1000787052 | 73 |
| 72 | 3300005355 | Ga0070671_100297152 | Ga0070671_1002971521 | 73 |
| 73 | 3300005366 | Ga0070659_100948193 | Ga0070659_1009481932 | 73 |
| 74 | 3300005367 | Ga0070667_100100777 | Ga0070667_1001007772 | 73 |
| 75 | 3300005367 | Ga0070667_100206629 | Ga0070667_1002066292 | 73 |
| 76 | 3300005455 | Ga0070663_100737880 | Ga0070663_1007378801 | 73 |
| 77 | 3300005456 | Ga0070678_100003819 | Ga0070678_1000038198 | 73 |
| 78 | 3300005456 | Ga0070678_100033857 | Ga0070678_1000338572 | 73 |
| 79 | 3300005456 | Ga0070678_101749686 | Ga0070678_1017496861 | 73 |
| 80 | 3300005535 | Ga0070684_101203367 | Ga0070684_1012033671 | 73 |
| 81 | 3300005539 | Ga0068853_100098417 | Ga0068853_1000984173 | 73 |
| 82 | 3300005548 | Ga0070665_100027600 | Ga0070665_1000276003 | 73 |
| 83 | 3300005615 | Ga0070702_100813741 | Ga0070702_1008137412 | 73 |
| 84 | 3300005617 | Ga0068859_103122151 | Ga0068859_1031221511 | 73 |
| 85 | 3300005719 | Ga0068861_100682049 | Ga0068861_1006820492 | 73 |
| 86 | 3300005844 | Ga0068862_100889089 | Ga0068862_1008890892 | 73 |
| 87 | 3300006237 | Ga0097621_100110850 | Ga0097621_1001108502 | 73 |
| 88 | 3300006237 | Ga0097621_100161589 | Ga0097621_1001615892 | 73 |
| 89 | 3300006237 | Ga0097621_100872331 | Ga0097621_1008723312 | 73 |
| 90 | 3300006358 | Ga0068871_100515751 | Ga0068871_1005157512 | 73 |
| 91 | 3300006358 | Ga0068871_101024464 | Ga0068871_1010244641 | 73 |
| 92 | 3300006914 | Ga0075436_101001989 | Ga0075436_1010019892 | 73 |
| 93 | 3300006931 | Ga0097620_103121840 | Ga0097620_1031218401 | 73 |
| 94 | 3300009176 | Ga0105242_11874617 | Ga0105242_118746172 | 73 |
| 95 | 3300009177 | Ga0105248_10233078 | Ga0105248_102330782 | 73 |
| 96 | 3300013296 | Ga0157374_10477786 | Ga0157374_104777861 | 73 |
| 97 | 3300013296 | Ga0157374_11085610 | Ga0157374_110856101 | 73 |
| 98 | 3300013297 | Ga0157378_11449364 | Ga0157378_114493642 | 73 |
| 99 | 3300013306 | Ga0163162_11054635 | Ga0163162_110546351 | 73 |
| 100 | 3300013306 | Ga0163162_12940104 | Ga0163162_129401041 | 73 |
| 101 | 3300013308 | Ga0157375_10311349 | Ga0157375_103113493 | 73 |
| 102 | 3300014968 | Ga0157379_10138036 | Ga0157379_101380363 | 73 |
| 103 | 3300014968 | Ga0157379_11524082 | Ga0157379_115240821 | 73 |
| 104 | 3300014969 | Ga0157376_10219809 | Ga0157376_102198092 | 73 |
| 105 | 3300014969 | Ga0157376_11083859 | Ga0157376_110838592 | 73 |
| 106 | 3300020081 | Ga0206354_11602318 | Ga0206354_116023184 | 73 |
| 107 | 3300020082 | Ga0206353_12008140 | Ga0206353_120081403 | 73 |
| 108 | 3300025972 | Ga0207668_10426933 | Ga0207668_104269332 | 73 |
| 109 | 3300025986 | Ga0207658_10234693 | Ga0207658_102346932 | 73 |
| 110 | 3300026041 | Ga0207639_10135680 | Ga0207639_101356803 | 73 |
| 111 | 3300026067 | Ga0207678_10491767 | Ga0207678_104917672 | 73 |
| 112 | 3300026118 | Ga0207675_100354508 | Ga0207675_1003545082 | 73 |
| 113 | 3300026121 | Ga0207683_10071259 | Ga0207683_100712593 | 73 |
| 114 | 3300028379 | Ga0268266_10008824 | Ga0268266_100088244 | 73 |
| 115 | 3300028380 | Ga0268265_10744664 | Ga0268265_107446642 | 73 |
| 116 | 3300028381 | Ga0268264_10700814 | Ga0268264_107008142 | 73 |
| 117 | 3300031507 | Ga0307509_10062257 | Ga0307509_100622574 | 73 |
| 118 | 3300041486 | Ga0451807_1691547 | Ga0451807_1691547_168_410 | 73 |
| 119 | 3300046517 | Ga0495630_0499460 | Ga0495630_0499460_150_392 | 73 |
| 120 | 3300046539 | Ga0495621_0063065 | Ga0495621_0063065_399_641 | 73 |
| 121 | 3300046616 | Ga0495668_0286936 | Ga0495668_0286936_279_518 | 73 |
| 122 | 3300047445 | Ga0495677_0122827 | Ga0495677_0122827_208_450 | 73 |
| 123 | 3300048903 | Ga0496100_0107369 | Ga0496100_0107369_103_345 | 73 |
| 124 | 3300048904 | Ga0496101_0215965 | Ga0496101_0215965_117_359 | 73 |
| 125 | 3300048907 | Ga0496104_0563086 | Ga0496104_0563086_724_966 | 73 |
| 126 | 3300048910 | Ga0496107_0409641 | Ga0496107_0409641_352_594 | 73 |
| 127 | 3300048918 | Ga0496115_1343690 | Ga0496115_1343690_132_383 | 73 |
| 128 | 3300049572 | Ga0501036_1056407 | Ga0501036_1056407_249_491 | 73 |
| 129 | 3300049576 | Ga0501040_0706401 | Ga0501040_0706401_72_314 | 73 |
| 130 | 3300049577 | Ga0501041_0782910 | Ga0501041_0782910_111_353 | 73 |
| 131 | 3300049589 | Ga0501073_0462469 | Ga0501073_0462469_248_490 | 73 |
| 132 | 3300049590 | Ga0501074_0462361 | Ga0501074_0462361_544_786 | 73 |
| 133 | 3300049591 | Ga0501075_0677192 | Ga0501075_0677192_346_588 | 73 |
| 134 | 3300049592 | Ga0501076_0730518 | Ga0501076_0730518_264_506 | 73 |
| 135 | 3300049742 | Ga0501080_0226394 | Ga0501080_0226394_346_588 | 73 |
| 136 | 3300049824 | Ga0501045_0283199 | Ga0501045_0283199_352_594 | 73 |
| 137 | 3300050493 | nmdc:mga0k408_289720_c1 | nmdc:mga0k408_289720_c1_664_915 | 73 |
| 138 | 3300053096 | Ga0500641_0001084 | Ga0500641_0001084_6642_6884 | 73 |
| 139 | 3300060353 | Ga0501082_0081207 | Ga0501082_0081207_727_969 | 73 |
| 140 | 3300005578 | Ga0068854_101205467 | Ga0068854_1012054672 | 74 |
| 141 | 3300025944 | Ga0207661_11685960 | Ga0207661_116859601 | 74 |
| 142 | 3300032126 | Ga0307415_100959448 | Ga0307415_1009594481 | 74 |
| 143 | 3300048915 | Ga0496112_1272869 | Ga0496112_1272869_272_523 | 74 |
| 144 | 3300005330 | Ga0070690_100408255 | Ga0070690_1004082552 | 75 |
| 145 | 3300005331 | Ga0070670_100166827 | Ga0070670_1001668272 | 75 |
| 146 | 3300005347 | Ga0070668_100392397 | Ga0070668_1003923973 | 75 |
| 147 | 3300005353 | Ga0070669_100609158 | Ga0070669_1006091583 | 75 |
| 148 | 3300005354 | Ga0070675_100421343 | Ga0070675_1004213431 | 75 |
| 149 | 3300005356 | Ga0070674_100500692 | Ga0070674_1005006922 | 75 |
| 150 | 3300005364 | Ga0070673_100836065 | Ga0070673_1008360651 | 75 |
| 151 | 3300005459 | Ga0068867_100486835 | Ga0068867_1004868352 | 75 |
| 152 | 3300005543 | Ga0070672_100819295 | Ga0070672_1008192951 | 75 |
| 153 | 3300005543 | Ga0070672_100879987 | Ga0070672_1008799872 | 75 |
| 154 | 3300005577 | Ga0068857_101433961 | Ga0068857_1014339612 | 75 |
| 155 | 3300006042 | Ga0075368_10280356 | Ga0075368_102803562 | 75 |
| 156 | 3300006177 | Ga0075362_10410277 | Ga0075362_104102772 | 75 |
| 157 | 3300007076 | Ga0075435_100779755 | Ga0075435_1007797552 | 75 |
| 158 | 3300009098 | Ga0105245_10000268 | Ga0105245_1000026814 | 75 |
| 159 | 3300012478 | Ga0157328_1009701 | Ga0157328_10097012 | 75 |
| 160 | 3300013306 | Ga0163162_10019287 | Ga0163162_100192873 | 75 |
| 161 | 3300013306 | Ga0163162_10889181 | Ga0163162_108891812 | 75 |
| 162 | 3300013308 | Ga0157375_10955252 | Ga0157375_109552521 | 75 |
| 163 | 3300014968 | Ga0157379_12598346 | Ga0157379_125983461 | 75 |
| 164 | 3300025925 | Ga0207650_10406633 | Ga0207650_104066332 | 75 |
| 165 | 3300025927 | Ga0207687_10000168 | Ga0207687_1000016819 | 75 |
| 166 | 3300025940 | Ga0207691_10081864 | Ga0207691_100818643 | 75 |
| 167 | 3300025972 | Ga0207668_10668391 | Ga0207668_106683911 | 75 |
| 168 | 3300026075 | Ga0207708_11654442 | Ga0207708_116544422 | 75 |
| 169 | 3300026116 | Ga0207674_12095610 | Ga0207674_120956102 | 75 |
| 170 | 3300026142 | Ga0207698_11179814 | Ga0207698_111798142 | 75 |
| 171 | 3300028379 | Ga0268266_10869845 | Ga0268266_108698452 | 75 |
| 172 | 3300035691 | Ga0373931_1124231 | Ga0373931_1124231_205_447 | 75 |
| 173 | 3300050495 | nmdc:mga04h51_77010_c1 | nmdc:mga04h51_77010_c1_572_820 | 75 |
| 174 | 3300050513 | nmdc:mga0rr50_1364747_c1 | nmdc:mga0rr50_1364747_c1_147_395 | 75 |
| 175 | 3300050515 | nmdc:mga0a205_828267_c1 | nmdc:mga0a205_828267_c1_85_333 | 75 |
| 176 | 3300053103 | Ga0500555_020942 | Ga0500555_020942_1378_1614 | 75 |
| 177 | 3300005353 | Ga0070669_100553875 | Ga0070669_1005538752 | 76 |
| 178 | 3300005438 | Ga0070701_10059661 | Ga0070701_100596612 | 76 |
| 179 | 3300005439 | Ga0070711_100242985 | Ga0070711_1002429853 | 76 |
| 180 | 3300005441 | Ga0070700_100008534 | Ga0070700_1000085343 | 76 |
| 181 | 3300005467 | Ga0070706_100083549 | Ga0070706_1000835495 | 76 |
| 182 | 3300005536 | Ga0070697_100043471 | Ga0070697_1000434712 | 76 |
| 183 | 3300005577 | Ga0068857_101179710 | Ga0068857_1011797102 | 76 |
| 184 | 3300005617 | Ga0068859_100020921 | Ga0068859_1000209214 | 76 |
| 185 | 3300005844 | Ga0068862_100089446 | Ga0068862_1000894463 | 76 |
| 186 | 3300005985 | Ga0081539_10287889 | Ga0081539_102878893 | 76 |
| 187 | 3300006028 | Ga0070717_10148522 | Ga0070717_101485223 | 76 |
| 188 | 3300006175 | Ga0070712_100124529 | Ga0070712_1001245291 | 76 |
| 189 | 3300006237 | Ga0097621_100078235 | Ga0097621_1000782354 | 76 |
| 190 | 3300006931 | Ga0097620_100020922 | Ga0097620_1000209224 | 76 |
| 191 | 3300007076 | Ga0075435_100638216 | Ga0075435_1006382162 | 76 |
| 192 | 3300009094 | Ga0111539_10032952 | Ga0111539_100329526 | 76 |
| 193 | 3300009147 | Ga0114129_11217166 | Ga0114129_112171662 | 76 |
| 194 | 3300009553 | Ga0105249_10395588 | Ga0105249_103955882 | 76 |
| 195 | 3300025898 | Ga0207692_10937337 | Ga0207692_109373372 | 76 |
| 196 | 3300025915 | Ga0207693_10075667 | Ga0207693_100756673 | 76 |
| 197 | 3300025916 | Ga0207663_10887495 | Ga0207663_108874952 | 76 |
| 198 | 3300025923 | Ga0207681_10367019 | Ga0207681_103670192 | 76 |
| 199 | 3300025939 | Ga0207665_11634621 | Ga0207665_116346212 | 76 |
| 200 | 3300025942 | Ga0207689_11049759 | Ga0207689_110497591 | 76 |
| 201 | 3300026023 | Ga0207677_10145792 | Ga0207677_101457921 | 76 |
| 202 | 3300026075 | Ga0207708_10008408 | Ga0207708_100084085 | 76 |
| 203 | 3300026088 | Ga0207641_10730999 | Ga0207641_107309993 | 76 |
| 204 | 3300026089 | Ga0207648_10145377 | Ga0207648_101453772 | 76 |
| 205 | 3300026116 | Ga0207674_10293120 | Ga0207674_102931202 | 76 |
| 206 | 3300028381 | Ga0268264_10232840 | Ga0268264_102328402 | 76 |
| 207 | 3300031456 | Ga0307513_10176714 | Ga0307513_101767143 | 76 |
| 208 | 3300031903 | Ga0307407_10208620 | Ga0307407_102086203 | 76 |
| 209 | 3300031995 | Ga0307409_100456376 | Ga0307409_1004563762 | 76 |
| 210 | 3300032002 | Ga0307416_103130897 | Ga0307416_1031308972 | 76 |
| 211 | 3300037312 | Ga0395899_0117457 | Ga0395899_0117457_1311_1547 | 76 |
| 212 | 3300037418 | Ga0395900_0045787 | Ga0395900_0045787_2808_3044 | 76 |
| 213 | 3300037466 | Ga0395898_0320856 | Ga0395898_0320856_474_710 | 76 |
| 214 | 3300037471 | Ga0395905_0309012 | Ga0395905_0309012_314_550 | 76 |
| 215 | 3300038443 | Ga0395901_0474171 | Ga0395901_0474171_706_942 | 76 |
| 216 | 3300041406 | Ga0439439_0251544 | Ga0439439_0251544_262_513 | 76 |
| 217 | 3300041997 | Ga0439431_0169998 | Ga0439431_0169998_168_419 | 76 |
| 218 | 3300042015 | Ga0439462_0060647 | Ga0439462_0060647_705_956 | 76 |
| 219 | 3300042436 | Ga0439435_0079856 | Ga0439435_0079856_694_945 | 76 |
| 220 | 3300046462 | Ga0495651_0988581 | Ga0495651_0988581_147_395 | 76 |
| 221 | 3300046537 | Ga0495598_0148316 | Ga0495598_0148316_83_337 | 76 |
| 222 | 3300046543 | Ga0495645_0042589 | Ga0495645_0042589_2604_2852 | 76 |
| 223 | 3300046675 | Ga0495657_0770357 | Ga0495657_0770357_62_310 | 76 |
| 224 | 3300046683 | Ga0495658_0108988 | Ga0495658_0108988_530_775 | 76 |
| 225 | 3300046684 | Ga0495669_0288127 | Ga0495669_0288127_514_759 | 76 |
| 226 | 3300048905 | Ga0496102_0479055 | Ga0496102_0479055_749_1000 | 76 |
| 227 | 3300048915 | Ga0496112_0153262 | Ga0496112_0153262_1439_1690 | 76 |
| 228 | 3300049589 | Ga0501073_0335452 | Ga0501073_0335452_301_549 | 76 |
| 229 | 3300050507 | nmdc:mga05p37_803347_c1 | nmdc:mga05p37_803347_c1_427_675 | 76 |
| 230 | 3300050511 | nmdc:mga08y16_34858_c1 | nmdc:mga08y16_34858_c1_1400_1648 | 76 |
| 231 | 3300050512 | nmdc:mga0n895_1545112_c1 | nmdc:mga0n895_1545112_c1_85_330 | 76 |
| 232 | 3300050513 | nmdc:mga0rr50_103162_c1 | nmdc:mga0rr50_103162_c1_676_912 | 76 |
| 233 | 3300054114 | Ga0501084_1683786 | Ga0501084_1683786_38_289 | 76 |
| 234 | 3300005290 | Ga0065712_10598818 | Ga0065712_105988181 | 77 |
| 235 | 3300005293 | Ga0065715_10573733 | Ga0065715_105737332 | 77 |
| 236 | 3300005330 | Ga0070690_100247170 | Ga0070690_1002471702 | 77 |
| 237 | 3300005330 | Ga0070690_100964223 | Ga0070690_1009642232 | 77 |
| 238 | 3300005331 | Ga0070670_101122447 | Ga0070670_1011224472 | 77 |
| 239 | 3300005353 | Ga0070669_100171691 | Ga0070669_1001716912 | 77 |
| 240 | 3300005354 | Ga0070675_100073690 | Ga0070675_1000736903 | 77 |
| 241 | 3300005364 | Ga0070673_101140176 | Ga0070673_1011401762 | 77 |
| 242 | 3300005365 | Ga0070688_100250426 | Ga0070688_1002504262 | 77 |
| 243 | 3300005365 | Ga0070688_100287198 | Ga0070688_1002871982 | 77 |
| 244 | 3300005365 | Ga0070688_100764341 | Ga0070688_1007643412 | 77 |
| 245 | 3300005367 | Ga0070667_101126440 | Ga0070667_1011264402 | 77 |
| 246 | 3300005459 | Ga0068867_101047560 | Ga0068867_1010475602 | 77 |
| 247 | 3300005466 | Ga0070685_10030146 | Ga0070685_100301461 | 77 |
| 248 | 3300005466 | Ga0070685_10175876 | Ga0070685_101758762 | 77 |
| 249 | 3300005544 | Ga0070686_100334876 | Ga0070686_1003348763 | 77 |
| 250 | 3300005548 | Ga0070665_100616461 | Ga0070665_1006164612 | 77 |
| 251 | 3300005564 | Ga0070664_100748285 | Ga0070664_1007482852 | 77 |
| 252 | 3300005578 | Ga0068854_100215134 | Ga0068854_1002151342 | 77 |
| 253 | 3300005615 | Ga0070702_100482708 | Ga0070702_1004827083 | 77 |
| 254 | 3300005617 | Ga0068859_100047572 | Ga0068859_1000475723 | 77 |
| 255 | 3300005617 | Ga0068859_102920775 | Ga0068859_1029207752 | 77 |
| 256 | 3300005618 | Ga0068864_100404644 | Ga0068864_1004046442 | 77 |
| 257 | 3300005842 | Ga0068858_100225282 | Ga0068858_1002252823 | 77 |
| 258 | 3300005844 | Ga0068862_101557490 | Ga0068862_1015574902 | 77 |
| 259 | 3300006844 | Ga0075428_100116951 | Ga0075428_1001169512 | 77 |
| 260 | 3300006844 | Ga0075428_100141981 | Ga0075428_1001419811 | 77 |
| 261 | 3300006846 | Ga0075430_100051217 | Ga0075430_1000512173 | 77 |
| 262 | 3300006846 | Ga0075430_100136238 | Ga0075430_1001362383 | 77 |
| 263 | 3300006846 | Ga0075430_100596921 | Ga0075430_1005969212 | 77 |
| 264 | 3300006847 | Ga0075431_100900130 | Ga0075431_1009001302 | 77 |
| 265 | 3300006847 | Ga0075431_101194047 | Ga0075431_1011940472 | 77 |
| 266 | 3300006880 | Ga0075429_100002103 | Ga0075429_1000021035 | 77 |
| 267 | 3300006880 | Ga0075429_100008855 | Ga0075429_1000088556 | 77 |
| 268 | 3300006931 | Ga0097620_100047572 | Ga0097620_1000475723 | 77 |
| 269 | 3300006931 | Ga0097620_102918038 | Ga0097620_1029180382 | 77 |
| 270 | 3300009094 | Ga0111539_12276034 | Ga0111539_122760342 | 77 |
| 271 | 3300009147 | Ga0114129_10187978 | Ga0114129_101879785 | 77 |
| 272 | 3300009147 | Ga0114129_10378776 | Ga0114129_103787762 | 77 |
| 273 | 3300009147 | Ga0114129_11351415 | Ga0114129_113514152 | 77 |
| 274 | 3300009177 | Ga0105248_10954037 | Ga0105248_109540372 | 77 |
| 275 | 3300009177 | Ga0105248_12012541 | Ga0105248_120125412 | 77 |
| 276 | 3300009553 | Ga0105249_11288774 | Ga0105249_112887742 | 77 |
| 277 | 3300009553 | Ga0105249_12070230 | Ga0105249_120702302 | 77 |
| 278 | 3300011119 | Ga0105246_10402080 | Ga0105246_104020802 | 77 |
| 279 | 3300013296 | Ga0157374_12917044 | Ga0157374_129170442 | 77 |
| 280 | 3300013306 | Ga0163162_10643430 | Ga0163162_106434302 | 77 |
| 281 | 3300013308 | Ga0157375_11842166 | Ga0157375_118421662 | 77 |
| 282 | 3300014325 | Ga0163163_10114721 | Ga0163163_101147213 | 77 |
| 283 | 3300025893 | Ga0207682_10040397 | Ga0207682_100403972 | 77 |
| 284 | 3300025923 | Ga0207681_10522993 | Ga0207681_105229932 | 77 |
| 285 | 3300025941 | Ga0207711_10393498 | Ga0207711_103934982 | 77 |
| 286 | 3300025941 | Ga0207711_10861799 | Ga0207711_108617991 | 77 |
| 287 | 3300025945 | Ga0207679_11436773 | Ga0207679_114367732 | 77 |
| 288 | 3300025961 | Ga0207712_10997669 | Ga0207712_109976692 | 77 |
| 289 | 3300025961 | Ga0207712_11392208 | Ga0207712_113922082 | 77 |
| 290 | 3300026023 | Ga0207677_11253730 | Ga0207677_112537302 | 77 |
| 291 | 3300026089 | Ga0207648_11373351 | Ga0207648_113733512 | 77 |
| 292 | 3300026095 | Ga0207676_10167509 | Ga0207676_101675092 | 77 |
| 293 | 3300028380 | Ga0268265_12280548 | Ga0268265_122805482 | 77 |
| 294 | 3300031548 | Ga0307408_100707801 | Ga0307408_1007078011 | 77 |
| 295 | 3300032005 | Ga0307411_10761932 | Ga0307411_107619322 | 77 |
| 296 | 3300035114 | Ga0373939_0065700 | Ga0373939_0065700_207_446 | 77 |
| 297 | 3300041512 | Ga0451853_3244223 | Ga0451853_3244223_154_405 | 77 |
| 298 | 3300042876 | Ga0451577_1187704 | Ga0451577_1187704_151_390 | 77 |
| 299 | 3300044712 | Ga0453684_0396338 | Ga0453684_0396338_551_790 | 77 |
| 300 | 3300045051 | Ga0451576_0333798 | Ga0451576_0333798_1010_1249 | 77 |
| 301 | 3300046460 | Ga0495638_0492088 | Ga0495638_0492088_19_297 | 77 |
| 302 | 3300046533 | Ga0495640_0851130 | Ga0495640_0851130_21_260 | 77 |
| 303 | 3300046663 | Ga0495635_0590080 | Ga0495635_0590080_71_310 | 77 |
| 304 | 3300046683 | Ga0495658_0608921 | Ga0495658_0608921_301_540 | 77 |
| 305 | 3300046690 | Ga0495624_0612952 | Ga0495624_0612952_339_578 | 77 |
| 306 | 3300049588 | Ga0501072_0584643 | Ga0501072_0584643_48_302 | 77 |
| 307 | 3300049683 | Ga0501253_104196 | Ga0501253_104196_65_319 | 77 |
| 308 | 3300049704 | Ga0501221_076226 | Ga0501221_076226_195_449 | 77 |
| 309 | 3300050507 | nmdc:mga05p37_168844_c1 | nmdc:mga05p37_168844_c1_2210_2452 | 77 |
| 310 | 3300050507 | nmdc:mga05p37_2061015_c1 | nmdc:mga05p37_2061015_c1_247_501 | 77 |
| 311 | 3300050508 | nmdc:mga09592_110936_c1 | nmdc:mga09592_110936_c1_2045_2299 | 77 |
| 312 | 3300050508 | nmdc:mga09592_272832_c1 | nmdc:mga09592_272832_c1_21_269 | 77 |
| 313 | 3300050508 | nmdc:mga09592_8310_c1 | nmdc:mga09592_8310_c1_3704_3946 | 77 |
| 314 | 3300050509 | nmdc:mga0qj67_121164_c1 | nmdc:mga0qj67_121164_c1_712_966 | 77 |
| 315 | 3300050509 | nmdc:mga0qj67_14492_c1 | nmdc:mga0qj67_14492_c1_4708_4953 | 77 |
| 316 | 3300050509 | nmdc:mga0qj67_315686_c1 | nmdc:mga0qj67_315686_c1_814_1056 | 77 |
| 317 | 3300050510 | nmdc:mga06r32_1038089_c1 | nmdc:mga06r32_1038089_c1_460_702 | 77 |
| 318 | 3300050510 | nmdc:mga06r32_115706_c1 | nmdc:mga06r32_115706_c1_1108_1362 | 77 |
| 319 | 3300005289 | Ga0065704_10871835 | Ga0065704_108718352 | 78 |
| 320 | 3300005295 | Ga0065707_10474698 | Ga0065707_104746982 | 78 |
| 321 | 3300005328 | Ga0070676_10015484 | Ga0070676_100154846 | 78 |
| 322 | 3300005329 | Ga0070683_100590095 | Ga0070683_1005900951 | 78 |
| 323 | 3300005330 | Ga0070690_100052401 | Ga0070690_1000524013 | 78 |
| 324 | 3300005331 | Ga0070670_100893584 | Ga0070670_1008935842 | 78 |
| 325 | 3300005333 | Ga0070677_10288935 | Ga0070677_102889351 | 78 |
| 326 | 3300005334 | Ga0068869_100008173 | Ga0068869_1000081734 | 78 |
| 327 | 3300005334 | Ga0068869_100374296 | Ga0068869_1003742961 | 78 |
| 328 | 3300005334 | Ga0068869_100748003 | Ga0068869_1007480032 | 78 |
| 329 | 3300005334 | Ga0068869_100813563 | Ga0068869_1008135632 | 78 |
| 330 | 3300005334 | Ga0068869_100900618 | Ga0068869_1009006182 | 78 |
| 331 | 3300005335 | Ga0070666_10009507 | Ga0070666_100095077 | 78 |
| 332 | 3300005336 | Ga0070680_100103767 | Ga0070680_1001037673 | 78 |
| 333 | 3300005336 | Ga0070680_101860112 | Ga0070680_1018601121 | 78 |
| 334 | 3300005337 | Ga0070682_100054927 | Ga0070682_1000549274 | 78 |
| 335 | 3300005338 | Ga0068868_100110556 | Ga0068868_1001105563 | 78 |
| 336 | 3300005338 | Ga0068868_100206559 | Ga0068868_1002065593 | 78 |
| 337 | 3300005339 | Ga0070660_100018398 | Ga0070660_1000183986 | 78 |
| 338 | 3300005340 | Ga0070689_100245192 | Ga0070689_1002451922 | 78 |
| 339 | 3300005343 | Ga0070687_100049727 | Ga0070687_1000497273 | 78 |
| 340 | 3300005344 | Ga0070661_100088652 | Ga0070661_1000886525 | 78 |
| 341 | 3300005344 | Ga0070661_100389580 | Ga0070661_1003895802 | 78 |
| 342 | 3300005347 | Ga0070668_100035245 | Ga0070668_1000352452 | 78 |
| 343 | 3300005353 | Ga0070669_100129828 | Ga0070669_1001298283 | 78 |
| 344 | 3300005353 | Ga0070669_100568233 | Ga0070669_1005682333 | 78 |
| 345 | 3300005354 | Ga0070675_100287657 | Ga0070675_1002876573 | 78 |
| 346 | 3300005356 | Ga0070674_101278304 | Ga0070674_1012783042 | 78 |
| 347 | 3300005365 | Ga0070688_100045488 | Ga0070688_1000454883 | 78 |
| 348 | 3300005366 | Ga0070659_100150623 | Ga0070659_1001506233 | 78 |
| 349 | 3300005367 | Ga0070667_100214880 | Ga0070667_1002148802 | 78 |
| 350 | 3300005434 | Ga0070709_11280593 | Ga0070709_112805932 | 78 |
| 351 | 3300005435 | Ga0070714_100992950 | Ga0070714_1009929502 | 78 |
| 352 | 3300005436 | Ga0070713_100109093 | Ga0070713_1001090932 | 78 |
| 353 | 3300005436 | Ga0070713_100715282 | Ga0070713_1007152821 | 78 |
| 354 | 3300005436 | Ga0070713_101753068 | Ga0070713_1017530681 | 78 |
| 355 | 3300005438 | Ga0070701_10034373 | Ga0070701_100343733 | 78 |
| 356 | 3300005439 | Ga0070711_100308434 | Ga0070711_1003084342 | 78 |
| 357 | 3300005439 | Ga0070711_100388931 | Ga0070711_1003889312 | 78 |
| 358 | 3300005439 | Ga0070711_100398900 | Ga0070711_1003989002 | 78 |
| 359 | 3300005440 | Ga0070705_100055663 | Ga0070705_1000556632 | 78 |
| 360 | 3300005444 | Ga0070694_100285475 | Ga0070694_1002854752 | 78 |
| 361 | 3300005445 | Ga0070708_100934750 | Ga0070708_1009347501 | 78 |
| 362 | 3300005445 | Ga0070708_101313129 | Ga0070708_1013131292 | 78 |
| 363 | 3300005455 | Ga0070663_100026770 | Ga0070663_1000267706 | 78 |
| 364 | 3300005455 | Ga0070663_100054918 | Ga0070663_1000549183 | 78 |
| 365 | 3300005455 | Ga0070663_101813234 | Ga0070663_1018132341 | 78 |
| 366 | 3300005456 | Ga0070678_100703457 | Ga0070678_1007034572 | 78 |
| 367 | 3300005457 | Ga0070662_100004056 | Ga0070662_1000040567 | 78 |
| 368 | 3300005457 | Ga0070662_100110201 | Ga0070662_1001102012 | 78 |
| 369 | 3300005457 | Ga0070662_100205716 | Ga0070662_1002057163 | 78 |
| 370 | 3300005459 | Ga0068867_100040962 | Ga0068867_1000409623 | 78 |
| 371 | 3300005459 | Ga0068867_100409323 | Ga0068867_1004093232 | 78 |
| 372 | 3300005468 | Ga0070707_100700503 | Ga0070707_1007005032 | 78 |
| 373 | 3300005518 | Ga0070699_100593386 | Ga0070699_1005933862 | 78 |
| 374 | 3300005530 | Ga0070679_100161558 | Ga0070679_1001615584 | 78 |
| 375 | 3300005530 | Ga0070679_101587368 | Ga0070679_1015873681 | 78 |
| 376 | 3300005535 | Ga0070684_100166858 | Ga0070684_1001668583 | 78 |
| 377 | 3300005536 | Ga0070697_100332587 | Ga0070697_1003325873 | 78 |
| 378 | 3300005539 | Ga0068853_100009185 | Ga0068853_1000091857 | 78 |
| 379 | 3300005539 | Ga0068853_101472436 | Ga0068853_1014724362 | 78 |
| 380 | 3300005543 | Ga0070672_100005316 | Ga0070672_1000053163 | 78 |
| 381 | 3300005544 | Ga0070686_100121643 | Ga0070686_1001216432 | 78 |
| 382 | 3300005544 | Ga0070686_100500525 | Ga0070686_1005005252 | 78 |
| 383 | 3300005546 | Ga0070696_100737869 | Ga0070696_1007378692 | 78 |
| 384 | 3300005547 | Ga0070693_100128393 | Ga0070693_1001283932 | 78 |
| 385 | 3300005548 | Ga0070665_100046925 | Ga0070665_1000469256 | 78 |
| 386 | 3300005548 | Ga0070665_100123161 | Ga0070665_1001231613 | 78 |
| 387 | 3300005549 | Ga0070704_101778654 | Ga0070704_1017786541 | 78 |
| 388 | 3300005563 | Ga0068855_100003776 | Ga0068855_10000377615 | 78 |
| 389 | 3300005563 | Ga0068855_102350156 | Ga0068855_1023501561 | 78 |
| 390 | 3300005564 | Ga0070664_100085694 | Ga0070664_1000856945 | 78 |
| 391 | 3300005564 | Ga0070664_100110802 | Ga0070664_1001108024 | 78 |
| 392 | 3300005564 | Ga0070664_100576987 | Ga0070664_1005769873 | 78 |
| 393 | 3300005577 | Ga0068857_101323589 | Ga0068857_1013235892 | 78 |
| 394 | 3300005578 | Ga0068854_100002823 | Ga0068854_1000028239 | 78 |
| 395 | 3300005578 | Ga0068854_100259132 | Ga0068854_1002591323 | 78 |
| 396 | 3300005614 | Ga0068856_100002343 | Ga0068856_10000234318 | 78 |
| 397 | 3300005614 | Ga0068856_102460236 | Ga0068856_1024602362 | 78 |
| 398 | 3300005615 | Ga0070702_100093233 | Ga0070702_1000932332 | 78 |
| 399 | 3300005616 | Ga0068852_100091821 | Ga0068852_1000918213 | 78 |
| 400 | 3300005617 | Ga0068859_100012763 | Ga0068859_1000127635 | 78 |
| 401 | 3300005617 | Ga0068859_100026780 | Ga0068859_1000267808 | 78 |
| 402 | 3300005617 | Ga0068859_100929039 | Ga0068859_1009290392 | 78 |
| 403 | 3300005618 | Ga0068864_100363654 | Ga0068864_1003636542 | 78 |
| 404 | 3300005718 | Ga0068866_10008527 | Ga0068866_100085277 | 78 |
| 405 | 3300005718 | Ga0068866_10035055 | Ga0068866_100350553 | 78 |
| 406 | 3300005719 | Ga0068861_100010852 | Ga0068861_1000108522 | 78 |
| 407 | 3300005834 | Ga0068851_10009450 | Ga0068851_100094502 | 78 |
| 408 | 3300005834 | Ga0068851_10768220 | Ga0068851_107682202 | 78 |
| 409 | 3300005840 | Ga0068870_10168921 | Ga0068870_101689212 | 78 |
| 410 | 3300005840 | Ga0068870_10633191 | Ga0068870_106331911 | 78 |
| 411 | 3300005841 | Ga0068863_100139097 | Ga0068863_1001390973 | 78 |
| 412 | 3300005842 | Ga0068858_100049034 | Ga0068858_1000490344 | 78 |
| 413 | 3300005842 | Ga0068858_100116594 | Ga0068858_1001165943 | 78 |
| 414 | 3300005843 | Ga0068860_100045175 | Ga0068860_1000451753 | 78 |
| 415 | 3300005843 | Ga0068860_100202033 | Ga0068860_1002020332 | 78 |
| 416 | 3300005843 | Ga0068860_101313013 | Ga0068860_1013130132 | 78 |
| 417 | 3300005844 | Ga0068862_100027922 | Ga0068862_1000279226 | 78 |
| 418 | 3300005844 | Ga0068862_100035305 | Ga0068862_1000353052 | 78 |
| 419 | 3300005937 | Ga0081455_11031900 | Ga0081455_110319002 | 78 |
| 420 | 3300006028 | Ga0070717_10185757 | Ga0070717_101857572 | 78 |
| 421 | 3300006051 | Ga0075364_10018032 | Ga0075364_100180322 | 78 |
| 422 | 3300006051 | Ga0075364_10574104 | Ga0075364_105741042 | 78 |
| 423 | 3300006163 | Ga0070715_10077934 | Ga0070715_100779341 | 78 |
| 424 | 3300006173 | Ga0070716_100038817 | Ga0070716_1000388172 | 78 |
| 425 | 3300006173 | Ga0070716_100245391 | Ga0070716_1002453912 | 78 |
| 426 | 3300006175 | Ga0070712_100010067 | Ga0070712_1000100678 | 78 |
| 427 | 3300006175 | Ga0070712_100048432 | Ga0070712_1000484324 | 78 |
| 428 | 3300006178 | Ga0075367_10005952 | Ga0075367_100059523 | 78 |
| 429 | 3300006195 | Ga0075366_10054892 | Ga0075366_100548923 | 78 |
| 430 | 3300006237 | Ga0097621_100295338 | Ga0097621_1002953383 | 78 |
| 431 | 3300006358 | Ga0068871_100035073 | Ga0068871_1000350733 | 78 |
| 432 | 3300006358 | Ga0068871_100086142 | Ga0068871_1000861425 | 78 |
| 433 | 3300006847 | Ga0075431_101656941 | Ga0075431_1016569412 | 78 |
| 434 | 3300006852 | Ga0075433_10983795 | Ga0075433_109837952 | 78 |
| 435 | 3300006871 | Ga0075434_100693573 | Ga0075434_1006935733 | 78 |
| 436 | 3300006880 | Ga0075429_100399543 | Ga0075429_1003995433 | 78 |
| 437 | 3300006881 | Ga0068865_100011201 | Ga0068865_1000112014 | 78 |
| 438 | 3300006881 | Ga0068865_100045007 | Ga0068865_1000450075 | 78 |
| 439 | 3300006914 | Ga0075436_100805320 | Ga0075436_1008053202 | 78 |
| 440 | 3300006931 | Ga0097620_100012764 | Ga0097620_1000127644 | 78 |
| 441 | 3300006931 | Ga0097620_100026781 | Ga0097620_1000267818 | 78 |
| 442 | 3300006931 | Ga0097620_100928817 | Ga0097620_1009288172 | 78 |
| 443 | 3300009093 | Ga0105240_10032471 | Ga0105240_100324718 | 78 |
| 444 | 3300009094 | Ga0111539_10025171 | Ga0111539_100251714 | 78 |
| 445 | 3300009094 | Ga0111539_10943993 | Ga0111539_109439932 | 78 |
| 446 | 3300009098 | Ga0105245_10011633 | Ga0105245_100116333 | 78 |
| 447 | 3300009098 | Ga0105245_10053825 | Ga0105245_100538253 | 78 |
| 448 | 3300009101 | Ga0105247_10009261 | Ga0105247_100092616 | 78 |
| 449 | 3300009147 | Ga0114129_10000783 | Ga0114129_1000078318 | 78 |
| 450 | 3300009147 | Ga0114129_10190039 | Ga0114129_101900394 | 78 |
| 451 | 3300009147 | Ga0114129_11129983 | Ga0114129_111299832 | 78 |
| 452 | 3300009148 | Ga0105243_10034676 | Ga0105243_100346764 | 78 |
| 453 | 3300009148 | Ga0105243_10066242 | Ga0105243_100662423 | 78 |
| 454 | 3300009174 | Ga0105241_10010190 | Ga0105241_100101908 | 78 |
| 455 | 3300009174 | Ga0105241_10343372 | Ga0105241_103433722 | 78 |
| 456 | 3300009176 | Ga0105242_10015729 | Ga0105242_100157293 | 78 |
| 457 | 3300009176 | Ga0105242_10019367 | Ga0105242_100193676 | 78 |
| 458 | 3300009176 | Ga0105242_11418000 | Ga0105242_114180002 | 78 |
| 459 | 3300009177 | Ga0105248_10036335 | Ga0105248_100363356 | 78 |
| 460 | 3300009545 | Ga0105237_10018241 | Ga0105237_100182415 | 78 |
| 461 | 3300009545 | Ga0105237_10060251 | Ga0105237_100602515 | 78 |
| 462 | 3300009551 | Ga0105238_10017878 | Ga0105238_100178787 | 78 |
| 463 | 3300009551 | Ga0105238_12464525 | Ga0105238_124645252 | 78 |
| 464 | 3300009553 | Ga0105249_10014251 | Ga0105249_100142518 | 78 |
| 465 | 3300009553 | Ga0105249_10019172 | Ga0105249_100191722 | 78 |
| 466 | 3300010375 | Ga0105239_10033308 | Ga0105239_100333086 | 78 |
| 467 | 3300010375 | Ga0105239_10875919 | Ga0105239_108759193 | 78 |
| 468 | 3300010375 | Ga0105239_11597132 | Ga0105239_115971321 | 78 |
| 469 | 3300011119 | Ga0105246_10125001 | Ga0105246_101250012 | 78 |
| 470 | 3300011119 | Ga0105246_10211534 | Ga0105246_102115343 | 78 |
| 471 | 3300011119 | Ga0105246_10285838 | Ga0105246_102858382 | 78 |
| 472 | 3300013100 | Ga0157373_10009270 | Ga0157373_100092709 | 78 |
| 473 | 3300013102 | Ga0157371_10014824 | Ga0157371_100148246 | 78 |
| 474 | 3300013105 | Ga0157369_10013449 | Ga0157369_1001344910 | 78 |
| 475 | 3300013296 | Ga0157374_10013346 | Ga0157374_100133465 | 78 |
| 476 | 3300013297 | Ga0157378_10007755 | Ga0157378_100077557 | 78 |
| 477 | 3300013306 | Ga0163162_10002231 | Ga0163162_100022312 | 78 |
| 478 | 3300013306 | Ga0163162_10403288 | Ga0163162_104032882 | 78 |
| 479 | 3300013307 | Ga0157372_10002096 | Ga0157372_1000209613 | 78 |
| 480 | 3300013308 | Ga0157375_10293235 | Ga0157375_102932352 | 78 |
| 481 | 3300013308 | Ga0157375_13659332 | Ga0157375_136593322 | 78 |
| 482 | 3300014325 | Ga0163163_10061806 | Ga0163163_100618065 | 78 |
| 483 | 3300014326 | Ga0157380_10048964 | Ga0157380_100489642 | 78 |
| 484 | 3300014326 | Ga0157380_10107548 | Ga0157380_101075483 | 78 |
| 485 | 3300014968 | Ga0157379_10264639 | Ga0157379_102646392 | 78 |
| 486 | 3300014968 | Ga0157379_10296384 | Ga0157379_102963842 | 78 |
| 487 | 3300014969 | Ga0157376_10259937 | Ga0157376_102599372 | 78 |
| 488 | 3300025321 | Ga0207656_10045692 | Ga0207656_100456922 | 78 |
| 489 | 3300025899 | Ga0207642_10099562 | Ga0207642_100995622 | 78 |
| 490 | 3300025900 | Ga0207710_10130436 | Ga0207710_101304363 | 78 |
| 491 | 3300025903 | Ga0207680_10008419 | Ga0207680_100084197 | 78 |
| 492 | 3300025903 | Ga0207680_10069783 | Ga0207680_100697832 | 78 |
| 493 | 3300025905 | Ga0207685_10586448 | Ga0207685_105864481 | 78 |
| 494 | 3300025907 | Ga0207645_10023980 | Ga0207645_100239802 | 78 |
| 495 | 3300025908 | Ga0207643_10170914 | Ga0207643_101709142 | 78 |
| 496 | 3300025911 | Ga0207654_10001435 | Ga0207654_1000143510 | 78 |
| 497 | 3300025912 | Ga0207707_10076097 | Ga0207707_100760975 | 78 |
| 498 | 3300025913 | Ga0207695_10018842 | Ga0207695_100188426 | 78 |
| 499 | 3300025914 | Ga0207671_10008003 | Ga0207671_100080036 | 78 |
| 500 | 3300025915 | Ga0207693_10015899 | Ga0207693_100158998 | 78 |
| 501 | 3300025915 | Ga0207693_10121064 | Ga0207693_101210643 | 78 |
| 502 | 3300025915 | Ga0207693_10713081 | Ga0207693_107130812 | 78 |
| 503 | 3300025916 | Ga0207663_10220488 | Ga0207663_102204882 | 78 |
| 504 | 3300025916 | Ga0207663_10377719 | Ga0207663_103777192 | 78 |
| 505 | 3300025917 | Ga0207660_10082744 | Ga0207660_100827443 | 78 |
| 506 | 3300025918 | Ga0207662_10018481 | Ga0207662_100184815 | 78 |
| 507 | 3300025919 | Ga0207657_10159627 | Ga0207657_101596273 | 78 |
| 508 | 3300025920 | Ga0207649_10031848 | Ga0207649_100318482 | 78 |
| 509 | 3300025920 | Ga0207649_10693526 | Ga0207649_106935262 | 78 |
| 510 | 3300025921 | Ga0207652_10080569 | Ga0207652_100805695 | 78 |
| 511 | 3300025922 | Ga0207646_10369970 | Ga0207646_103699702 | 78 |
| 512 | 3300025923 | Ga0207681_10180089 | Ga0207681_101800893 | 78 |
| 513 | 3300025923 | Ga0207681_10180793 | Ga0207681_101807932 | 78 |
| 514 | 3300025924 | Ga0207694_10012240 | Ga0207694_100122407 | 78 |
| 515 | 3300025926 | Ga0207659_11124840 | Ga0207659_111248402 | 78 |
| 516 | 3300025926 | Ga0207659_11322392 | Ga0207659_113223922 | 78 |
| 517 | 3300025926 | Ga0207659_11409771 | Ga0207659_114097712 | 78 |
| 518 | 3300025927 | Ga0207687_10000742 | Ga0207687_1000074214 | 78 |
| 519 | 3300025927 | Ga0207687_10676875 | Ga0207687_106768752 | 78 |
| 520 | 3300025928 | Ga0207700_10030414 | Ga0207700_100304143 | 78 |
| 521 | 3300025928 | Ga0207700_10130114 | Ga0207700_101301142 | 78 |
| 522 | 3300025929 | Ga0207664_10267759 | Ga0207664_102677593 | 78 |
| 523 | 3300025929 | Ga0207664_10987128 | Ga0207664_109871282 | 78 |
| 524 | 3300025932 | Ga0207690_10059208 | Ga0207690_100592083 | 78 |
| 525 | 3300025933 | Ga0207706_10009801 | Ga0207706_100098017 | 78 |
| 526 | 3300025933 | Ga0207706_10161752 | Ga0207706_101617522 | 78 |
| 527 | 3300025934 | Ga0207686_10027137 | Ga0207686_100271373 | 78 |
| 528 | 3300025935 | Ga0207709_10079690 | Ga0207709_100796902 | 78 |
| 529 | 3300025935 | Ga0207709_10198561 | Ga0207709_101985613 | 78 |
| 530 | 3300025936 | Ga0207670_10123098 | Ga0207670_101230983 | 78 |
| 531 | 3300025936 | Ga0207670_10164987 | Ga0207670_101649872 | 78 |
| 532 | 3300025937 | Ga0207669_10466771 | Ga0207669_104667712 | 78 |
| 533 | 3300025937 | Ga0207669_11311368 | Ga0207669_113113682 | 78 |
| 534 | 3300025938 | Ga0207704_10059813 | Ga0207704_100598135 | 78 |
| 535 | 3300025938 | Ga0207704_10375709 | Ga0207704_103757092 | 78 |
| 536 | 3300025939 | Ga0207665_10033310 | Ga0207665_100333103 | 78 |
| 537 | 3300025939 | Ga0207665_10076933 | Ga0207665_100769333 | 78 |
| 538 | 3300025939 | Ga0207665_10282845 | Ga0207665_102828452 | 78 |
| 539 | 3300025940 | Ga0207691_10020945 | Ga0207691_100209455 | 78 |
| 540 | 3300025941 | Ga0207711_10001257 | Ga0207711_100012578 | 78 |
| 541 | 3300025941 | Ga0207711_10037882 | Ga0207711_100378824 | 78 |
| 542 | 3300025942 | Ga0207689_10105168 | Ga0207689_101051682 | 78 |
| 543 | 3300025944 | Ga0207661_10090641 | Ga0207661_100906414 | 78 |
| 544 | 3300025944 | Ga0207661_10750289 | Ga0207661_107502892 | 78 |
| 545 | 3300025945 | Ga0207679_10015219 | Ga0207679_100152196 | 78 |
| 546 | 3300025949 | Ga0207667_10002588 | Ga0207667_1000258814 | 78 |
| 547 | 3300025949 | Ga0207667_12016676 | Ga0207667_120166762 | 78 |
| 548 | 3300025960 | Ga0207651_10520127 | Ga0207651_105201271 | 78 |
| 549 | 3300025961 | Ga0207712_10128926 | Ga0207712_101289262 | 78 |
| 550 | 3300025961 | Ga0207712_10218363 | Ga0207712_102183632 | 78 |
| 551 | 3300025961 | Ga0207712_10685682 | Ga0207712_106856821 | 78 |
| 552 | 3300025972 | Ga0207668_10033140 | Ga0207668_100331406 | 78 |
| 553 | 3300025972 | Ga0207668_10076673 | Ga0207668_100766733 | 78 |
| 554 | 3300025972 | Ga0207668_10393500 | Ga0207668_103935002 | 78 |
| 555 | 3300025972 | Ga0207668_10551841 | Ga0207668_105518411 | 78 |
| 556 | 3300025981 | Ga0207640_10004697 | Ga0207640_100046973 | 78 |
| 557 | 3300025986 | Ga0207658_10098020 | Ga0207658_100980202 | 78 |
| 558 | 3300025986 | Ga0207658_10177827 | Ga0207658_101778273 | 78 |
| 559 | 3300026023 | Ga0207677_10014671 | Ga0207677_100146717 | 78 |
| 560 | 3300026023 | Ga0207677_10334399 | Ga0207677_103343992 | 78 |
| 561 | 3300026041 | Ga0207639_10046272 | Ga0207639_100462725 | 78 |
| 562 | 3300026067 | Ga0207678_10006653 | Ga0207678_100066533 | 78 |
| 563 | 3300026067 | Ga0207678_10035427 | Ga0207678_100354274 | 78 |
| 564 | 3300026075 | Ga0207708_10381443 | Ga0207708_103814433 | 78 |
| 565 | 3300026078 | Ga0207702_10004756 | Ga0207702_1000475612 | 78 |
| 566 | 3300026089 | Ga0207648_10018901 | Ga0207648_100189014 | 78 |
| 567 | 3300026089 | Ga0207648_10191828 | Ga0207648_101918283 | 78 |
| 568 | 3300026118 | Ga0207675_100040662 | Ga0207675_1000406622 | 78 |
| 569 | 3300026118 | Ga0207675_100272934 | Ga0207675_1002729343 | 78 |
| 570 | 3300026121 | Ga0207683_10088008 | Ga0207683_100880083 | 78 |
| 571 | 3300026142 | Ga0207698_10043438 | Ga0207698_100434383 | 78 |
| 572 | 3300027717 | Ga0209998_10099870 | Ga0209998_100998701 | 78 |
| 573 | 3300027876 | Ga0209974_10065293 | Ga0209974_100652932 | 78 |
| 574 | 3300027907 | Ga0207428_10281690 | Ga0207428_102816902 | 78 |
| 575 | 3300028379 | Ga0268266_10022609 | Ga0268266_100226093 | 78 |
| 576 | 3300028380 | Ga0268265_10111047 | Ga0268265_101110474 | 78 |
| 577 | 3300028380 | Ga0268265_10196894 | Ga0268265_101968942 | 78 |
| 578 | 3300028381 | Ga0268264_10098798 | Ga0268264_100987984 | 78 |
| 579 | 3300028800 | Ga0265338_10142549 | Ga0265338_101425493 | 78 |
| 580 | 3300031456 | Ga0307513_10305976 | Ga0307513_103059762 | 78 |
| 581 | 3300031852 | Ga0307410_10833520 | Ga0307410_108335202 | 78 |
| 582 | 3300032002 | Ga0307416_103759930 | Ga0307416_1037599302 | 78 |
| 583 | 3300032005 | Ga0307411_10119946 | Ga0307411_101199462 | 78 |
| 584 | 3300032005 | Ga0307411_11632240 | Ga0307411_116322402 | 78 |
| 585 | 3300034957 | Ga0373938_0138619 | Ga0373938_0138619_65_325 | 78 |
| 586 | 3300035084 | Ga0373928_0060616 | Ga0373928_0060616_371_631 | 78 |
| 587 | 3300035114 | Ga0373939_0033440 | Ga0373939_0033440_695_943 | 78 |
| 588 | 3300035114 | Ga0373939_0042498 | Ga0373939_0042498_169_429 | 78 |
| 589 | 3300035121 | Ga0373960_0350048 | Ga0373960_0350048_259_507 | 78 |
| 590 | 3300035170 | Ga0373943_0243435 | Ga0373943_0243435_124_363 | 78 |
| 591 | 3300035242 | Ga0373962_0027965 | Ga0373962_0027965_594_854 | 78 |
| 592 | 3300035691 | Ga0373931_0009374 | Ga0373931_0009374_4405_4665 | 78 |
| 593 | 3300035691 | Ga0373931_0123657 | Ga0373931_0123657_1031_1291 | 78 |
| 594 | 3300035691 | Ga0373931_0925439 | Ga0373931_0925439_138_386 | 78 |
| 595 | 3300041456 | Ga0451795_0251339 | Ga0451795_0251339_187_459 | 78 |
| 596 | 3300042461 | Ga0439460_0007551 | Ga0439460_0007551_2114_2401 | 78 |
| 597 | 3300044712 | Ga0453684_1887590 | Ga0453684_1887590_12_269 | 78 |
| 598 | 3300045051 | Ga0451576_1055325 | Ga0451576_1055325_564_821 | 78 |
| 599 | 3300046472 | Ga0495580_0024894 | Ga0495580_0024894_220_480 | 78 |
| 600 | 3300046472 | Ga0495580_0565244 | Ga0495580_0565244_346_609 | 78 |
| 601 | 3300046473 | Ga0495582_0001944 | Ga0495582_0001944_8553_8792 | 78 |
| 602 | 3300046535 | Ga0495586_0192221 | Ga0495586_0192221_644_883 | 78 |
| 603 | 3300046684 | Ga0495669_0138492 | Ga0495669_0138492_268_528 | 78 |
| 604 | 3300046689 | Ga0495613_0094379 | Ga0495613_0094379_1458_1697 | 78 |
| 605 | 3300047317 | Ga0495604_0545759 | Ga0495604_0545759_172_432 | 78 |
| 606 | 3300047673 | Ga0495593_0338352 | Ga0495593_0338352_155_394 | 78 |
| 607 | 3300048089 | Ga0495614_0113366 | Ga0495614_0113366_595_834 | 78 |
| 608 | 3300048903 | Ga0496100_1652565 | Ga0496100_1652565_233_493 | 78 |
| 609 | 3300048904 | Ga0496101_1253290 | Ga0496101_1253290_250_510 | 78 |
| 610 | 3300048905 | Ga0496102_0015891 | Ga0496102_0015891_5228_5488 | 78 |
| 611 | 3300048907 | Ga0496104_0342404 | Ga0496104_0342404_728_988 | 78 |
| 612 | 3300048908 | Ga0496105_0190919 | Ga0496105_0190919_498_758 | 78 |
| 613 | 3300048909 | Ga0496106_0225428 | Ga0496106_0225428_77_337 | 78 |
| 614 | 3300048910 | Ga0496107_0777893 | Ga0496107_0777893_382_642 | 78 |
| 615 | 3300048911 | Ga0496108_0651874 | Ga0496108_0651874_402_662 | 78 |
| 616 | 3300048912 | Ga0496109_0135440 | Ga0496109_0135440_1365_1625 | 78 |
| 617 | 3300048913 | Ga0496110_0160686 | Ga0496110_0160686_162_422 | 78 |
| 618 | 3300048914 | Ga0496111_0243873 | Ga0496111_0243873_707_967 | 78 |
| 619 | 3300048915 | Ga0496112_0392301 | Ga0496112_0392301_192_452 | 78 |
| 620 | 3300048915 | Ga0496112_1219165 | Ga0496112_1219165_48_308 | 78 |
| 621 | 3300049575 | Ga0501039_0401811 | Ga0501039_0401811_96_353 | 78 |
| 622 | 3300049575 | Ga0501039_1096366 | Ga0501039_1096366_44_301 | 78 |
| 623 | 3300049576 | Ga0501040_0070401 | Ga0501040_0070401_1012_1269 | 78 |
| 624 | 3300049576 | Ga0501040_0110603 | Ga0501040_0110603_561_818 | 78 |
| 625 | 3300049577 | Ga0501041_0068690 | Ga0501041_0068690_958_1215 | 78 |
| 626 | 3300049577 | Ga0501041_0148563 | Ga0501041_0148563_23_280 | 78 |
| 627 | 3300049578 | Ga0501042_0153517 | Ga0501042_0153517_460_717 | 78 |
| 628 | 3300049583 | Ga0501067_0205483 | Ga0501067_0205483_376_633 | 78 |
| 629 | 3300049587 | Ga0501071_0142652 | Ga0501071_0142652_290_547 | 78 |
| 630 | 3300049588 | Ga0501072_0581547 | Ga0501072_0581547_381_638 | 78 |
| 631 | 3300049588 | Ga0501072_0823164 | Ga0501072_0823164_153_410 | 78 |
| 632 | 3300049590 | Ga0501074_0950502 | Ga0501074_0950502_311_568 | 78 |
| 633 | 3300049591 | Ga0501075_0056332 | Ga0501075_0056332_2006_2263 | 78 |
| 634 | 3300049591 | Ga0501075_0112628 | Ga0501075_0112628_1636_1893 | 78 |
| 635 | 3300049591 | Ga0501075_1239855 | Ga0501075_1239855_22_309 | 78 |
| 636 | 3300049592 | Ga0501076_0001133 | Ga0501076_0001133_14414_14671 | 78 |
| 637 | 3300049592 | Ga0501076_0968334 | Ga0501076_0968334_242_499 | 78 |
| 638 | 3300049593 | Ga0501077_0366530 | Ga0501077_0366530_439_696 | 78 |
| 639 | 3300049741 | Ga0501079_0056500 | Ga0501079_0056500_282_539 | 78 |
| 640 | 3300049742 | Ga0501080_0221377 | Ga0501080_0221377_359_616 | 78 |
| 641 | 3300049742 | Ga0501080_0352811 | Ga0501080_0352811_107_364 | 78 |
| 642 | 3300049743 | Ga0501081_0034966 | Ga0501081_0034966_1363_1620 | 78 |
| 643 | 3300049743 | Ga0501081_0424697 | Ga0501081_0424697_242_499 | 78 |
| 644 | 3300049822 | Ga0501035_0576089 | Ga0501035_0576089_501_758 | 78 |
| 645 | 3300049824 | Ga0501045_0217188 | Ga0501045_0217188_625_882 | 78 |
| 646 | 3300050491 | nmdc:mga00v17_414675_c1 | nmdc:mga00v17_414675_c1_93_347 | 78 |
| 647 | 3300050507 | nmdc:mga05p37_116_c1 | nmdc:mga05p37_116_c1_8224_8481 | 78 |
| 648 | 3300050507 | nmdc:mga05p37_493650_c1 | nmdc:mga05p37_493650_c1_1026_1283 | 78 |
| 649 | 3300050508 | nmdc:mga09592_601686_c1 | nmdc:mga09592_601686_c1_401_658 | 78 |
| 650 | 3300050510 | nmdc:mga06r32_1372953_c1 | nmdc:mga06r32_1372953_c1_117_374 | 78 |
| 651 | 3300050511 | nmdc:mga08y16_1084476_c1 | nmdc:mga08y16_1084476_c1_363_620 | 78 |
| 652 | 3300050511 | nmdc:mga08y16_1127399_c1 | nmdc:mga08y16_1127399_c1_483_734 | 78 |
| 653 | 3300050511 | nmdc:mga08y16_533604_c1 | nmdc:mga08y16_533604_c1_784_1035 | 78 |
| 654 | 3300050513 | nmdc:mga0rr50_490177_c1 | nmdc:mga0rr50_490177_c1_511_759 | 78 |
| 655 | 3300050515 | nmdc:mga0a205_39183_c2 | nmdc:mga0a205_39183_c2_2026_2283 | 78 |
| 656 | 3300053148 | Ga0500590_085935 | Ga0500590_085935_667_915 | 78 |
| 657 | 3300054114 | Ga0501084_0077260 | Ga0501084_0077260_978_1235 | 78 |
| 658 | 3300059426 | Ga0590077_080692 | Ga0590077_080692_287_538 | 78 |
| 659 | 3300060353 | Ga0501082_0851521 | Ga0501082_0851521_46_303 | 78 |
| 660 | 3300060353 | Ga0501082_1202177 | Ga0501082_1202177_388_645 | 78 |
| 661 | 3300061734 | Ga0530510_0654066 | Ga0530510_0654066_392_649 | 78 |
| 662 | 3300061734 | Ga0530510_0860298 | Ga0530510_0860298_391_648 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.929 | 6 | 58 |
| 3zkc-assembly1.cif.gz_A | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9243 | 6 | 58 |
| 6rnz-assembly2.cif.gz_B | crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) | 0.9141 | 6 | 58 |
| 3f51-assembly1.cif.gz_A | crystal structure of the clp gene regulator clgr from corynebacterium glutamicum | 0.9115 | 7 | 61 |
| 3bs3-assembly1.cif.gz_A-2 | crystal structure of a putative dna-binding protein from bacteroides fragilis | 0.9098 | 2 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qq6B00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9348 | 6 | 58 | 1.10.260.40 |
| 2b5aB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9295 | 6 | 58 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.929 | 6 | 58 | 1.10.260.40 |
| 3zkcA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9243 | 6 | 58 | 1.10.260.40 |
| 2b5aC00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9223 | 6 | 58 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A414FTJ7-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9666 | 3 | 67 |
GO:0003677
|
| AF-A0A6A2SL11-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9655 | 2 | 66 |
GO:0003677
|
| AF-L5N6Y8-F1-model_v4 | Transcriptional regulator | 0.9647 | 2 | 68 |
GO:0003677
|
| AF-A0A4Q5A9M0-F1-model_v4 | Cro/Cl family transcriptional regulator | 0.9636 | 2 | 67 |
GO:0003677
|
| AF-C1FTK8-F1-model_v4 | Transcription regulator, Cro/CI family-related protein | 0.9629 | 3 | 66 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar