F473366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 333 | 628 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300049669|Ga0501235_078221|Ga0501235_078221_152_700 |
| Length | 182 |
| Sequence | MLVTHSLGGFAPRLSARRKTSRSNKSRRRNIMVDILHRVGIKAPLEKVYQALATREGVAGWWTTDTQGESKVGGMLKTLFTVDGKLLGGFDLEVLALEPKKRVLWQVVEGPPEWIGTKIGFELRQEGEYSIVLFKHEGWKEPVEFMHHCSTKWAIYLMSLKSLVETGQGQPTPNDVAIGDFH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 2 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 3 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 6 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 7 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 8 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 9 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 10 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 11 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 12 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 13 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 14 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 15 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 16 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 17 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 18 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 19 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 20 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 21 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 22 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 23 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 24 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 25 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 26 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 27 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 28 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 29 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 30 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 33 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 190 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 226 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 327 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 331 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 332 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 333 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95 |
| Metatranscriptomes | 0.15 |
| Isolates | 4.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.24 |
| Nodule | 0.76 |
| Rhizoplane | 3.79 |
| Rhizosphere | 86.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10028062 | 3300003316 | Bacteria | 1341 |
| 2 | rootH1_10164810 | 3300003316 | Bacteria | 1062 |
| 3 | rootL2_10036088 | 3300003322 | Bacteria | 1243 |
| 4 | rootL2_10095498 | 3300003322 | Bacteria | 1289 |
| 5 | rootH1_10093008 | 3300003323 | Bacteria | 2473 |
| 6 | Ga0058860_11875516 | 3300004801 | Bacteria | 883 |
| 7 | Ga0065707_10090976 | 3300005295 | Bacteria | 4028 |
| 8 | Ga0065707_10331271 | 3300005295 | Bacteria | 949 |
| 9 | Ga0065707_10458892 | 3300005295 | Bacteria | 793 |
| 10 | Ga0065707_10615757 | 3300005295 | Bacteria | 681 |
| 11 | Ga0070658_10072099 | 3300005327 | Bacteria | 2830 |
| 12 | Ga0070676_10349333 | 3300005328 | Bacteria | 1016 |
| 13 | Ga0070690_100039548 | 3300005330 | Bacteria | 2979 |
| 14 | Ga0070690_100254826 | 3300005330 | Bacteria | 1243 |
| 15 | Ga0070690_100366280 | 3300005330 | Bacteria | 1050 |
| 16 | Ga0070670_100124738 | 3300005331 | Bacteria | 2223 |
| 17 | Ga0070670_100192877 | 3300005331 | Bacteria | 1770 |
| 18 | Ga0070670_100308088 | 3300005331 | Bacteria | 1386 |
| 19 | Ga0070670_100351371 | 3300005331 | Bacteria | 1295 |
| 20 | Ga0070677_10125813 | 3300005333 | Bacteria | 1163 |
| 21 | Ga0068869_100072425 | 3300005334 | Bacteria | 2553 |
| 22 | Ga0068869_100410278 | 3300005334 | Bacteria | 1116 |
| 23 | Ga0068869_101351273 | 3300005334 | Bacteria | 630 |
| 24 | Ga0070666_10027019 | 3300005335 | Bacteria | 3755 |
| 25 | Ga0070666_10070759 | 3300005335 | Bacteria | 2374 |
| 26 | Ga0070680_100097398 | 3300005336 | Bacteria | 2439 |
| 27 | Ga0070680_101156773 | 3300005336 | Bacteria | 669 |
| 28 | Ga0068868_100015816 | 3300005338 | Bacteria | 5589 |
| 29 | Ga0068868_100024655 | 3300005338 | Bacteria | 4567 |
| 30 | Ga0068868_100031398 | 3300005338 | Bacteria | 4080 |
| 31 | Ga0070689_100008791 | 3300005340 | Bacteria | 7132 |
| 32 | Ga0070689_100476496 | 3300005340 | Bacteria | 1066 |
| 33 | Ga0070689_100498655 | 3300005340 | Bacteria | 1043 |
| 34 | Ga0070689_101160449 | 3300005340 | Bacteria | 692 |
| 35 | Ga0070689_101810445 | 3300005340 | Bacteria | 557 |
| 36 | Ga0070687_100130827 | 3300005343 | Bacteria | 1449 |
| 37 | Ga0070661_100024682 | 3300005344 | Bacteria | 4313 |
| 38 | Ga0070661_101071193 | 3300005344 | Bacteria | 671 |
| 39 | Ga0070668_100003237 | 3300005347 | Bacteria | 12002 |
| 40 | Ga0070668_100236313 | 3300005347 | Bacteria | 1512 |
| 41 | Ga0070668_100479463 | 3300005347 | Bacteria | 1074 |
| 42 | Ga0070668_101123846 | 3300005347 | Bacteria | 710 |
| 43 | Ga0070669_100006719 | 3300005353 | Bacteria | 8282 |
| 44 | Ga0070669_100034347 | 3300005353 | Bacteria | 3671 |
| 45 | Ga0070669_100180654 | 3300005353 | Bacteria | 1650 |
| 46 | Ga0070669_100234660 | 3300005353 | Bacteria | 1455 |
| 47 | Ga0070675_100261465 | 3300005354 | Bacteria | 1517 |
| 48 | Ga0070675_101552661 | 3300005354 | Bacteria | 611 |
| 49 | Ga0070671_100507392 | 3300005355 | Bacteria | 1038 |
| 50 | Ga0070671_100538918 | 3300005355 | Bacteria | 1006 |
| 51 | Ga0070674_100467705 | 3300005356 | Bacteria | 1044 |
| 52 | Ga0070674_100811773 | 3300005356 | Bacteria | 809 |
| 53 | Ga0070674_101096477 | 3300005356 | Bacteria | 703 |
| 54 | Ga0070673_100157840 | 3300005364 | Bacteria | 1927 |
| 55 | Ga0070673_101127251 | 3300005364 | Bacteria | 733 |
| 56 | Ga0070673_101657902 | 3300005364 | Bacteria | 605 |
| 57 | Ga0070688_100065271 | 3300005365 | Bacteria | 2313 |
| 58 | Ga0070688_100351667 | 3300005365 | Bacteria | 1079 |
| 59 | Ga0070688_100370142 | 3300005365 | Bacteria | 1054 |
| 60 | Ga0070688_100619758 | 3300005365 | Bacteria | 830 |
| 61 | Ga0070659_100855559 | 3300005366 | Bacteria | 793 |
| 62 | Ga0070667_100000705 | 3300005367 | Bacteria | 32287 |
| 63 | Ga0070667_100014479 | 3300005367 | Bacteria | 6516 |
| 64 | Ga0070667_100058393 | 3300005367 | Bacteria | 3262 |
| 65 | Ga0070667_100202502 | 3300005367 | Bacteria | 1762 |
| 66 | Ga0070667_100257893 | 3300005367 | Bacteria | 1560 |
| 67 | Ga0070667_100375237 | 3300005367 | Bacteria | 1291 |
| 68 | Ga0070667_100620757 | 3300005367 | Bacteria | 997 |
| 69 | Ga0070703_10123796 | 3300005406 | Bacteria | 941 |
| 70 | Ga0070703_10170993 | 3300005406 | Bacteria | 832 |
| 71 | Ga0070709_10616377 | 3300005434 | Bacteria | 837 |
| 72 | Ga0070714_100005738 | 3300005435 | Bacteria | 9519 |
| 73 | Ga0070713_100496585 | 3300005436 | Bacteria | 1151 |
| 74 | Ga0070713_100720529 | 3300005436 | Bacteria | 953 |
| 75 | Ga0070701_10627189 | 3300005438 | Bacteria | 715 |
| 76 | Ga0070705_100001468 | 3300005440 | Bacteria | 12477 |
| 77 | Ga0070705_100371121 | 3300005440 | Bacteria | 1050 |
| 78 | Ga0070700_100510035 | 3300005441 | Bacteria | 927 |
| 79 | Ga0070700_101198424 | 3300005441 | Bacteria | 634 |
| 80 | Ga0070694_100012918 | 3300005444 | Bacteria | 5208 |
| 81 | Ga0070694_100117665 | 3300005444 | Bacteria | 1903 |
| 82 | Ga0070694_100540614 | 3300005444 | Bacteria | 932 |
| 83 | Ga0070708_101191909 | 3300005445 | Bacteria | 712 |
| 84 | Ga0070678_100108230 | 3300005456 | Bacteria | 2169 |
| 85 | Ga0070678_100313026 | 3300005456 | Bacteria | 1338 |
| 86 | Ga0070678_101597729 | 3300005456 | Bacteria | 612 |
| 87 | Ga0070681_10021867 | 3300005458 | Bacteria | 6416 |
| 88 | Ga0068867_100079121 | 3300005459 | Bacteria | 2474 |
| 89 | Ga0068867_100383634 | 3300005459 | Bacteria | 1181 |
| 90 | Ga0070685_10146062 | 3300005466 | Bacteria | 1494 |
| 91 | Ga0070685_10210822 | 3300005466 | Bacteria | 1268 |
| 92 | Ga0070685_10612211 | 3300005466 | Bacteria | 785 |
| 93 | Ga0070685_10631159 | 3300005466 | Bacteria | 774 |
| 94 | Ga0070685_10810270 | 3300005466 | Bacteria | 691 |
| 95 | Ga0070698_100698027 | 3300005471 | Bacteria | 957 |
| 96 | Ga0070679_100152313 | 3300005530 | Bacteria | 2289 |
| 97 | Ga0070684_100033562 | 3300005535 | Bacteria | 4383 |
| 98 | Ga0070684_100157043 | 3300005535 | Bacteria | 2063 |
| 99 | Ga0070684_101649697 | 3300005535 | Bacteria | 605 |
| 100 | Ga0070672_100210060 | 3300005543 | Bacteria | 1630 |
| 101 | Ga0070672_100818825 | 3300005543 | Bacteria | 820 |
| 102 | Ga0070686_100001557 | 3300005544 | Bacteria | 12882 |
| 103 | Ga0070686_100035054 | 3300005544 | Bacteria | 3097 |
| 104 | Ga0070695_100125219 | 3300005545 | Bacteria | 1764 |
| 105 | Ga0070696_100268300 | 3300005546 | Bacteria | 1297 |
| 106 | Ga0070693_100000154 | 3300005547 | Bacteria | 31511 |
| 107 | Ga0070665_100013296 | 3300005548 | Bacteria | 8286 |
| 108 | Ga0070665_100086099 | 3300005548 | Bacteria | 3148 |
| 109 | Ga0070665_100087623 | 3300005548 | Bacteria | 3119 |
| 110 | Ga0070665_100124266 | 3300005548 | Bacteria | 2582 |
| 111 | Ga0070665_100137823 | 3300005548 | Bacteria | 2443 |
| 112 | Ga0070665_100760510 | 3300005548 | Bacteria | 982 |
| 113 | Ga0070665_101361525 | 3300005548 | Bacteria | 719 |
| 114 | Ga0068855_100292934 | 3300005563 | Bacteria | 1804 |
| 115 | Ga0070664_100025792 | 3300005564 | Bacteria | 4872 |
| 116 | Ga0068854_100495379 | 3300005578 | Bacteria | 1028 |
| 117 | Ga0068854_100677911 | 3300005578 | Bacteria | 888 |
| 118 | Ga0068856_100380884 | 3300005614 | Bacteria | 1430 |
| 119 | Ga0068856_100995013 | 3300005614 | Bacteria | 857 |
| 120 | Ga0068852_100490800 | 3300005616 | Bacteria | 1222 |
| 121 | Ga0068859_100029793 | 3300005617 | Bacteria | 5476 |
| 122 | Ga0068859_100928486 | 3300005617 | Bacteria | 954 |
| 123 | Ga0068864_100005699 | 3300005618 | Bacteria | 10212 |
| 124 | Ga0068864_100030734 | 3300005618 | Bacteria | 4554 |
| 125 | Ga0068864_100088604 | 3300005618 | Bacteria | 2726 |
| 126 | Ga0068864_100273008 | 3300005618 | Bacteria | 1576 |
| 127 | Ga0068864_100484425 | 3300005618 | Bacteria | 1188 |
| 128 | Ga0068861_100007761 | 3300005719 | Bacteria | 7371 |
| 129 | Ga0068861_100034591 | 3300005719 | Bacteria | 3737 |
| 130 | Ga0068861_100109063 | 3300005719 | Bacteria | 2215 |
| 131 | Ga0068861_100214265 | 3300005719 | Bacteria | 1624 |
| 132 | Ga0068861_100493972 | 3300005719 | Bacteria | 1105 |
| 133 | Ga0068861_100586770 | 3300005719 | Bacteria | 1021 |
| 134 | Ga0068870_10040692 | 3300005840 | Bacteria | 2412 |
| 135 | Ga0068870_10097649 | 3300005840 | Bacteria | 1654 |
| 136 | Ga0068870_10377991 | 3300005840 | Bacteria | 916 |
| 137 | Ga0068870_10990553 | 3300005840 | Bacteria | 599 |
| 138 | Ga0068863_100010108 | 3300005841 | Bacteria | 9177 |
| 139 | Ga0068863_100318244 | 3300005841 | Bacteria | 1511 |
| 140 | Ga0068863_100698865 | 3300005841 | Bacteria | 1008 |
| 141 | Ga0068860_100036269 | 3300005843 | Bacteria | 4725 |
| 142 | Ga0068860_100091956 | 3300005843 | Bacteria | 2891 |
| 143 | Ga0068860_100092574 | 3300005843 | Bacteria | 2881 |
| 144 | Ga0068860_100097921 | 3300005843 | Bacteria | 2797 |
| 145 | Ga0068860_100117711 | 3300005843 | Bacteria | 2542 |
| 146 | Ga0068860_100282316 | 3300005843 | Bacteria | 1623 |
| 147 | Ga0068860_100404293 | 3300005843 | Bacteria | 1351 |
| 148 | Ga0068860_100504600 | 3300005843 | Bacteria | 1208 |
| 149 | Ga0068860_101356909 | 3300005843 | Bacteria | 732 |
| 150 | Ga0068860_101813949 | 3300005843 | Bacteria | 632 |
| 151 | Ga0068862_100025306 | 3300005844 | Bacteria | 4983 |
| 152 | Ga0068862_100029031 | 3300005844 | Bacteria | 4659 |
| 153 | Ga0068862_100071389 | 3300005844 | Bacteria | 2998 |
| 154 | Ga0068862_100139527 | 3300005844 | Bacteria | 2150 |
| 155 | Ga0068862_100444379 | 3300005844 | Bacteria | 1221 |
| 156 | Ga0068862_100929455 | 3300005844 | Bacteria | 857 |
| 157 | Ga0081455_10003566 | 3300005937 | Bacteria | 17857 |
| 158 | Ga0081455_10034300 | 3300005937 | Bacteria | 4549 |
| 159 | Ga0081455_10078930 | 3300005937 | Bacteria | 2704 |
| 160 | Ga0081538_10214563 | 3300005981 | Bacteria | 771 |
| 161 | Ga0081540_1076160 | 3300005983 | Bacteria | 1530 |
| 162 | Ga0081539_10002135 | 3300005985 | Bacteria | 29216 |
| 163 | Ga0070717_10169159 | 3300006028 | Bacteria | 1900 |
| 164 | Ga0075365_10464733 | 3300006038 | Bacteria | 894 |
| 165 | Ga0075365_10569517 | 3300006038 | Bacteria | 801 |
| 166 | Ga0075363_100007959 | 3300006048 | Bacteria | 4910 |
| 167 | Ga0075363_100252818 | 3300006048 | Bacteria | 1015 |
| 168 | Ga0075363_100276618 | 3300006048 | Bacteria | 970 |
| 169 | Ga0075364_10045520 | 3300006051 | Bacteria | 2856 |
| 170 | Ga0075362_10147263 | 3300006177 | Bacteria | 1128 |
| 171 | Ga0075367_10619971 | 3300006178 | Bacteria | 688 |
| 172 | Ga0075366_10032569 | 3300006195 | Bacteria | 3068 |
| 173 | Ga0075366_10066613 | 3300006195 | Bacteria | 2143 |
| 174 | Ga0075366_10133477 | 3300006195 | Bacteria | 1499 |
| 175 | Ga0075366_10238710 | 3300006195 | Bacteria | 1108 |
| 176 | Ga0075366_10309548 | 3300006195 | Bacteria | 967 |
| 177 | Ga0097621_100389633 | 3300006237 | Bacteria | 1246 |
| 178 | Ga0097621_100801449 | 3300006237 | Bacteria | 873 |
| 179 | Ga0097621_101251010 | 3300006237 | Bacteria | 700 |
| 180 | Ga0075370_10048649 | 3300006353 | Bacteria | 2402 |
| 181 | Ga0068871_100012374 | 3300006358 | Bacteria | 6287 |
| 182 | Ga0068871_100052049 | 3300006358 | Bacteria | 3315 |
| 183 | Ga0068871_100189199 | 3300006358 | Bacteria | 1772 |
| 184 | Ga0068871_100845186 | 3300006358 | Bacteria | 846 |
| 185 | Ga0075428_100015367 | 3300006844 | Bacteria | 8489 |
| 186 | Ga0075428_100248011 | 3300006844 | Bacteria | 1919 |
| 187 | Ga0075428_100272684 | 3300006844 | Bacteria | 1820 |
| 188 | Ga0075428_100443436 | 3300006844 | Bacteria | 1391 |
| 189 | Ga0075428_100449169 | 3300006844 | Bacteria | 1381 |
| 190 | Ga0075428_100542304 | 3300006844 | Bacteria | 1243 |
| 191 | Ga0075428_100819246 | 3300006844 | Bacteria | 989 |
| 192 | Ga0075428_101130915 | 3300006844 | Bacteria | 827 |
| 193 | Ga0075430_100030229 | 3300006846 | Bacteria | 4599 |
| 194 | Ga0075430_100042137 | 3300006846 | Bacteria | 3861 |
| 195 | Ga0075430_100315140 | 3300006846 | Bacteria | 1293 |
| 196 | Ga0075430_100340170 | 3300006846 | Bacteria | 1239 |
| 197 | Ga0075430_100412747 | 3300006846 | Bacteria | 1114 |
| 198 | Ga0075431_100012461 | 3300006847 | Bacteria | 8581 |
| 199 | Ga0075431_100022698 | 3300006847 | Bacteria | 6414 |
| 200 | Ga0075431_100025017 | 3300006847 | Bacteria | 6120 |
| 201 | Ga0075431_100048795 | 3300006847 | Bacteria | 4366 |
| 202 | Ga0075431_100108461 | 3300006847 | Bacteria | 2865 |
| 203 | Ga0075431_100598223 | 3300006847 | Bacteria | 1087 |
| 204 | Ga0075434_100242236 | 3300006871 | Bacteria | 1823 |
| 205 | Ga0075434_101110719 | 3300006871 | Bacteria | 804 |
| 206 | Ga0075429_100000076 | 3300006880 | Bacteria | 49832 |
| 207 | Ga0075429_100023263 | 3300006880 | Bacteria | 5374 |
| 208 | Ga0075429_100314138 | 3300006880 | Bacteria | 1371 |
| 209 | Ga0075429_100323543 | 3300006880 | Bacteria | 1349 |
| 210 | Ga0068865_100038500 | 3300006881 | Bacteria | 3237 |
| 211 | Ga0068865_100430313 | 3300006881 | Bacteria | 1087 |
| 212 | Ga0075436_100039815 | 3300006914 | Bacteria | 3243 |
| 213 | Ga0097620_100029793 | 3300006931 | Bacteria | 5476 |
| 214 | Ga0097620_100778344 | 3300006931 | Bacteria | 1045 |
| 215 | Ga0097620_100928574 | 3300006931 | Bacteria | 954 |
| 216 | Ga0075435_100020986 | 3300007076 | Bacteria | 5018 |
| 217 | Ga0075435_100389057 | 3300007076 | Bacteria | 1198 |
| 218 | Ga0075435_101294897 | 3300007076 | Bacteria | 638 |
| 219 | Ga0099794_10132115 | 3300007265 | Bacteria | 1261 |
| 220 | Ga0099795_10005512 | 3300007788 | Bacteria | 3374 |
| 221 | Ga0111539_10010757 | 3300009094 | Bacteria | 11517 |
| 222 | Ga0111539_10022910 | 3300009094 | Bacteria | 7669 |
| 223 | Ga0111539_10025280 | 3300009094 | Bacteria | 7279 |
| 224 | Ga0111539_10072216 | 3300009094 | Bacteria | 4070 |
| 225 | Ga0111539_10112595 | 3300009094 | Bacteria | 3192 |
| 226 | Ga0105245_10051126 | 3300009098 | Bacteria | 3705 |
| 227 | Ga0105245_10085271 | 3300009098 | Bacteria | 2895 |
| 228 | Ga0105245_10961592 | 3300009098 | Bacteria | 897 |
| 229 | Ga0105247_10012124 | 3300009101 | Bacteria | 5182 |
| 230 | Ga0105247_10160954 | 3300009101 | Bacteria | 1486 |
| 231 | Ga0114129_10000791 | 3300009147 | Bacteria | 40561 |
| 232 | Ga0114129_10039464 | 3300009147 | Bacteria | 6656 |
| 233 | Ga0114129_10235239 | 3300009147 | Bacteria | 2465 |
| 234 | Ga0114129_11027911 | 3300009147 | Bacteria | 1036 |
| 235 | Ga0114129_11280053 | 3300009147 | Bacteria | 910 |
| 236 | Ga0114129_11471477 | 3300009147 | Bacteria | 838 |
| 237 | Ga0105243_10002015 | 3300009148 | Bacteria | 17271 |
| 238 | Ga0105241_10414356 | 3300009174 | Bacteria | 1184 |
| 239 | Ga0105241_11163091 | 3300009174 | Bacteria | 729 |
| 240 | Ga0105242_10351324 | 3300009176 | Bacteria | 1362 |
| 241 | Ga0105248_10175010 | 3300009177 | Bacteria | 2419 |
| 242 | Ga0105248_10196243 | 3300009177 | Bacteria | 2274 |
| 243 | Ga0105248_11666499 | 3300009177 | Bacteria | 723 |
| 244 | Ga0105248_11872608 | 3300009177 | Bacteria | 681 |
| 245 | Ga0105238_10027142 | 3300009551 | Bacteria | 5836 |
| 246 | Ga0105238_10851199 | 3300009551 | Bacteria | 929 |
| 247 | Ga0105249_10008874 | 3300009553 | Bacteria | 8782 |
| 248 | Ga0105249_10024555 | 3300009553 | Bacteria | 5418 |
| 249 | Ga0105249_10076432 | 3300009553 | Bacteria | 3104 |
| 250 | Ga0105249_10744092 | 3300009553 | Bacteria | 1042 |
| 251 | Ga0105249_10960369 | 3300009553 | Bacteria | 923 |
| 252 | Ga0105249_11862391 | 3300009553 | Bacteria | 674 |
| 253 | Ga0099796_10034040 | 3300010159 | Bacteria | 1680 |
| 254 | Ga0105239_10018290 | 3300010375 | Bacteria | 7748 |
| 255 | Ga0105246_10011573 | 3300011119 | Bacteria | 5476 |
| 256 | Ga0105246_10063131 | 3300011119 | Bacteria | 2582 |
| 257 | Ga0105246_10319590 | 3300011119 | Bacteria | 1261 |
| 258 | Ga0105246_10569373 | 3300011119 | Bacteria | 974 |
| 259 | Ga0105246_10695237 | 3300011119 | Unclassified | 891 |
| 260 | Ga0157374_10014182 | 3300013296 | Bacteria | 6968 |
| 261 | Ga0157374_11019606 | 3300013296 | Bacteria | 847 |
| 262 | Ga0157378_10344261 | 3300013297 | Bacteria | 1455 |
| 263 | Ga0157378_10466819 | 3300013297 | Bacteria | 1255 |
| 264 | Ga0157378_10618782 | 3300013297 | Bacteria | 1096 |
| 265 | Ga0157378_10822855 | 3300013297 | Bacteria | 956 |
| 266 | Ga0163162_10007161 | 3300013306 | Bacteria | 10829 |
| 267 | Ga0163162_10911324 | 3300013306 | Bacteria | 992 |
| 268 | Ga0157372_11777467 | 3300013307 | Bacteria | 709 |
| 269 | Ga0157375_10060113 | 3300013308 | Bacteria | 3767 |
| 270 | Ga0157375_10140914 | 3300013308 | Bacteria | 2538 |
| 271 | Ga0157375_10163655 | 3300013308 | Bacteria | 2368 |
| 272 | Ga0157375_10485389 | 3300013308 | Bacteria | 1400 |
| 273 | Ga0157375_11221852 | 3300013308 | Bacteria | 882 |
| 274 | Ga0163163_10131646 | 3300014325 | Bacteria | 2541 |
| 275 | Ga0163163_11332243 | 3300014325 | Bacteria | 780 |
| 276 | Ga0163163_11451241 | 3300014325 | Bacteria | 748 |
| 277 | Ga0163163_11610983 | 3300014325 | Bacteria | 710 |
| 278 | Ga0163163_12243904 | 3300014325 | Bacteria | 605 |
| 279 | Ga0157380_10530696 | 3300014326 | Bacteria | 1150 |
| 280 | Ga0157377_10010946 | 3300014745 | Bacteria | 4509 |
| 281 | Ga0157377_10783861 | 3300014745 | Bacteria | 701 |
| 282 | Ga0157379_10087031 | 3300014968 | Bacteria | 2801 |
| 283 | Ga0157379_10095627 | 3300014968 | Bacteria | 2665 |
| 284 | Ga0157376_10696816 | 3300014969 | Bacteria | 1020 |
| 285 | Ga0157376_12424735 | 3300014969 | Bacteria | 564 |
| 286 | Ga0183367_1015 | 3300015688 | Bacteria | 298435 |
| 287 | Ga0163161_10171856 | 3300017792 | Bacteria | 1657 |
| 288 | Ga0163161_11943127 | 3300017792 | Bacteria | 523 |
| 289 | Ga0207697_10223339 | 3300025315 | Bacteria | 831 |
| 290 | Ga0207653_10388533 | 3300025885 | Bacteria | 547 |
| 291 | Ga0207682_10040929 | 3300025893 | Bacteria | 1890 |
| 292 | Ga0207710_10043447 | 3300025900 | Bacteria | 1999 |
| 293 | Ga0207710_10309870 | 3300025900 | Bacteria | 799 |
| 294 | Ga0207680_10045482 | 3300025903 | Bacteria | 2588 |
| 295 | Ga0207680_10046779 | 3300025903 | Bacteria | 2560 |
| 296 | Ga0207645_10523367 | 3300025907 | Bacteria | 804 |
| 297 | Ga0207643_10042285 | 3300025908 | Bacteria | 2569 |
| 298 | Ga0207643_10169252 | 3300025908 | Bacteria | 1318 |
| 299 | Ga0207643_10314761 | 3300025908 | Bacteria | 976 |
| 300 | Ga0207643_10323565 | 3300025908 | Bacteria | 963 |
| 301 | Ga0207705_10098936 | 3300025909 | Bacteria | 2144 |
| 302 | Ga0207654_10175597 | 3300025911 | Bacteria | 1394 |
| 303 | Ga0207707_10482201 | 3300025912 | Bacteria | 1059 |
| 304 | Ga0207693_10610435 | 3300025915 | Bacteria | 849 |
| 305 | Ga0207693_10903341 | 3300025915 | Bacteria | 678 |
| 306 | Ga0207660_10033166 | 3300025917 | Bacteria | 3569 |
| 307 | Ga0207662_10002400 | 3300025918 | Bacteria | 9397 |
| 308 | Ga0207649_10041029 | 3300025920 | Bacteria | 2816 |
| 309 | Ga0207652_10534742 | 3300025921 | Bacteria | 1054 |
| 310 | Ga0207681_10004367 | 3300025923 | Bacteria | 8718 |
| 311 | Ga0207681_10159817 | 3300025923 | Bacteria | 1697 |
| 312 | Ga0207681_10374114 | 3300025923 | Bacteria | 1145 |
| 313 | Ga0207681_10417328 | 3300025923 | Bacteria | 1087 |
| 314 | Ga0207650_10064780 | 3300025925 | Bacteria | 2736 |
| 315 | Ga0207650_10356570 | 3300025925 | Bacteria | 1204 |
| 316 | Ga0207650_10542822 | 3300025925 | Bacteria | 974 |
| 317 | Ga0207650_10916414 | 3300025925 | Bacteria | 744 |
| 318 | Ga0207650_11537059 | 3300025925 | Bacteria | 565 |
| 319 | Ga0207659_10375608 | 3300025926 | Bacteria | 1184 |
| 320 | Ga0207687_10016447 | 3300025927 | Bacteria | 4859 |
| 321 | Ga0207687_10025347 | 3300025927 | Bacteria | 3968 |
| 322 | Ga0207664_10003993 | 3300025929 | Bacteria | 9939 |
| 323 | Ga0207644_10030943 | 3300025931 | Bacteria | 3726 |
| 324 | Ga0207644_10217104 | 3300025931 | Bacteria | 1514 |
| 325 | Ga0207690_11227615 | 3300025932 | Bacteria | 626 |
| 326 | Ga0207706_10519254 | 3300025933 | Bacteria | 1027 |
| 327 | Ga0207686_10157330 | 3300025934 | Bacteria | 1589 |
| 328 | Ga0207709_10195651 | 3300025935 | Bacteria | 1440 |
| 329 | Ga0207670_10081397 | 3300025936 | Bacteria | 2266 |
| 330 | Ga0207670_10090055 | 3300025936 | Bacteria | 2166 |
| 331 | Ga0207670_10579462 | 3300025936 | Bacteria | 920 |
| 332 | Ga0207669_10861512 | 3300025937 | Bacteria | 755 |
| 333 | Ga0207704_10952375 | 3300025938 | Bacteria | 724 |
| 334 | Ga0207691_10325274 | 3300025940 | Bacteria | 1318 |
| 335 | Ga0207711_10167770 | 3300025941 | Bacteria | 1990 |
| 336 | Ga0207711_10430231 | 3300025941 | Bacteria | 1228 |
| 337 | Ga0207711_11547052 | 3300025941 | Bacteria | 606 |
| 338 | Ga0207689_10002939 | 3300025942 | Bacteria | 15741 |
| 339 | Ga0207689_10006916 | 3300025942 | Bacteria | 9977 |
| 340 | Ga0207689_10047332 | 3300025942 | Bacteria | 3552 |
| 341 | Ga0207689_10078731 | 3300025942 | Bacteria | 2709 |
| 342 | Ga0207689_10138580 | 3300025942 | Bacteria | 2004 |
| 343 | Ga0207689_10737209 | 3300025942 | Bacteria | 831 |
| 344 | Ga0207689_11052702 | 3300025942 | Bacteria | 686 |
| 345 | Ga0207679_10476141 | 3300025945 | Bacteria | 1111 |
| 346 | Ga0207679_11703771 | 3300025945 | Bacteria | 577 |
| 347 | Ga0207667_10295439 | 3300025949 | Bacteria | 1655 |
| 348 | Ga0207667_10478328 | 3300025949 | Bacteria | 1265 |
| 349 | Ga0207651_10140746 | 3300025960 | Bacteria | 1863 |
| 350 | Ga0207712_10003403 | 3300025961 | Bacteria | 10055 |
| 351 | Ga0207712_10108852 | 3300025961 | Bacteria | 2074 |
| 352 | Ga0207712_10194614 | 3300025961 | Bacteria | 1603 |
| 353 | Ga0207668_10002007 | 3300025972 | Bacteria | 11879 |
| 354 | Ga0207668_10006919 | 3300025972 | Bacteria | 6730 |
| 355 | Ga0207668_10073171 | 3300025972 | Bacteria | 2455 |
| 356 | Ga0207668_10267265 | 3300025972 | Bacteria | 1397 |
| 357 | Ga0207640_10515949 | 3300025981 | Bacteria | 998 |
| 358 | Ga0207658_10118596 | 3300025986 | Bacteria | 2105 |
| 359 | Ga0207658_10216849 | 3300025986 | Bacteria | 1607 |
| 360 | Ga0207658_10459509 | 3300025986 | Bacteria | 1128 |
| 361 | Ga0207677_10075709 | 3300026023 | Bacteria | 2393 |
| 362 | Ga0207677_10140638 | 3300026023 | Bacteria | 1847 |
| 363 | Ga0207708_10115229 | 3300026075 | Bacteria | 2090 |
| 364 | Ga0207708_11095608 | 3300026075 | Bacteria | 694 |
| 365 | Ga0207708_11152618 | 3300026075 | Bacteria | 677 |
| 366 | Ga0207702_10403491 | 3300026078 | Bacteria | 1319 |
| 367 | Ga0207641_10027446 | 3300026088 | Bacteria | 4701 |
| 368 | Ga0207641_10425048 | 3300026088 | Bacteria | 1280 |
| 369 | Ga0207641_10436742 | 3300026088 | Bacteria | 1263 |
| 370 | Ga0207641_10548127 | 3300026088 | Bacteria | 1127 |
| 371 | Ga0207648_10207504 | 3300026089 | Bacteria | 1739 |
| 372 | Ga0207648_10648241 | 3300026089 | Bacteria | 976 |
| 373 | Ga0207648_10800960 | 3300026089 | Bacteria | 877 |
| 374 | Ga0207648_11525321 | 3300026089 | Bacteria | 628 |
| 375 | Ga0207676_10043379 | 3300026095 | Bacteria | 3462 |
| 376 | Ga0207676_10124318 | 3300026095 | Bacteria | 2181 |
| 377 | Ga0207676_10783259 | 3300026095 | Bacteria | 929 |
| 378 | Ga0207674_10355646 | 3300026116 | Bacteria | 1416 |
| 379 | Ga0207675_100002127 | 3300026118 | Bacteria | 19640 |
| 380 | Ga0207675_100040991 | 3300026118 | Bacteria | 4324 |
| 381 | Ga0207675_100112684 | 3300026118 | Bacteria | 2568 |
| 382 | Ga0207675_100315242 | 3300026118 | Bacteria | 1526 |
| 383 | Ga0207683_10047124 | 3300026121 | Bacteria | 3774 |
| 384 | Ga0207683_10177776 | 3300026121 | Bacteria | 1929 |
| 385 | Ga0207683_11526289 | 3300026121 | Bacteria | 617 |
| 386 | Ga0207683_11785781 | 3300026121 | Bacteria | 564 |
| 387 | Ga0207698_10385854 | 3300026142 | Bacteria | 1334 |
| 388 | Ga0207428_10008419 | 3300027907 | Bacteria | 9313 |
| 389 | Ga0207428_10014397 | 3300027907 | Bacteria | 6875 |
| 390 | Ga0207428_10050362 | 3300027907 | Bacteria | 3333 |
| 391 | Ga0265354_1021620 | 3300028016 | Bacteria | 612 |
| 392 | Ga0265355_1001558 | 3300028036 | Bacteria | 1508 |
| 393 | Ga0268266_10054887 | 3300028379 | Bacteria | 3424 |
| 394 | Ga0268266_10058537 | 3300028379 | Bacteria | 3318 |
| 395 | Ga0268266_10920252 | 3300028379 | Bacteria | 846 |
| 396 | Ga0268265_10391193 | 3300028380 | Bacteria | 1282 |
| 397 | Ga0268265_10479842 | 3300028380 | Bacteria | 1167 |
| 398 | Ga0268265_10883977 | 3300028380 | Bacteria | 876 |
| 399 | Ga0268264_10005460 | 3300028381 | Bacteria | 10774 |
| 400 | Ga0268264_10379795 | 3300028381 | Bacteria | 1353 |
| 401 | Ga0268264_10474476 | 3300028381 | Bacteria | 1216 |
| 402 | Ga0268264_11457173 | 3300028381 | Bacteria | 695 |
| 403 | Ga0265319_1106929 | 3300028563 | Bacteria | 876 |
| 404 | Ga0265334_10202895 | 3300028573 | Bacteria | 689 |
| 405 | Ga0307517_10210001 | 3300028786 | Bacteria | 1201 |
| 406 | Ga0307515_10000038 | 3300028794 | Bacteria | 331376 |
| 407 | Ga0307515_10057087 | 3300028794 | Bacteria | 5657 |
| 408 | Ga0265338_10217700 | 3300028800 | Bacteria | 1428 |
| 409 | Ga0265338_10244088 | 3300028800 | Bacteria | 1328 |
| 410 | Ga0265330_10154537 | 3300031235 | Bacteria | 975 |
| 411 | Ga0265325_10100540 | 3300031241 | Bacteria | 1416 |
| 412 | Ga0265325_10168020 | 3300031241 | Bacteria | 1028 |
| 413 | Ga0265339_10071518 | 3300031249 | Bacteria | 1848 |
| 414 | Ga0265316_10006348 | 3300031344 | Bacteria | 11306 |
| 415 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 416 | Ga0307513_10001365 | 3300031456 | Bacteria | 35245 |
| 417 | Ga0307513_10001895 | 3300031456 | Bacteria | 29712 |
| 418 | Ga0307513_10004600 | 3300031456 | Bacteria | 18380 |
| 419 | Ga0307513_10032379 | 3300031456 | Bacteria | 5897 |
| 420 | Ga0307513_10293538 | 3300031456 | Bacteria | 1396 |
| 421 | Ga0265313_10001954 | 3300031595 | Bacteria | 18641 |
| 422 | Ga0265314_10010506 | 3300031711 | Bacteria | 7715 |
| 423 | Ga0265342_10046823 | 3300031712 | Bacteria | 2598 |
| 424 | Ga0307410_10029993 | 3300031852 | Bacteria | 3471 |
| 425 | Ga0307410_10285553 | 3300031852 | Bacteria | 1297 |
| 426 | Ga0326468_10020064 | 3300031889 | Bacteria | 789 |
| 427 | Ga0307409_100048855 | 3300031995 | Bacteria | 3223 |
| 428 | Ga0307416_100898681 | 3300032002 | Bacteria | 986 |
| 429 | Ga0307411_10349806 | 3300032005 | Bacteria | 1204 |
| 430 | Ga0307411_11799298 | 3300032005 | Bacteria | 569 |
| 431 | Ga0373959_0042380 | 3300034820 | Bacteria | 959 |
| 432 | Ga0373928_0001224 | 3300035084 | Bacteria | 5054 |
| 433 | Ga0373949_0125357 | 3300035090 | Bacteria | 724 |
| 434 | Ga0373941_0017811 | 3300035115 | Bacteria | 1953 |
| 435 | Ga0373946_0736420 | 3300035171 | Bacteria | 517 |
| 436 | Ga0373955_0230059 | 3300035172 | Bacteria | 1109 |
| 437 | Ga0373942_0161513 | 3300035207 | Bacteria | 725 |
| 438 | Ga0373961_0194864 | 3300035241 | Bacteria | 712 |
| 439 | Ga0373931_0000382 | 3300035691 | Bacteria | 18245 |
| 440 | Ga0373931_0113595 | 3300035691 | Bacteria | 1540 |
| 441 | Ga0373937_0304242 | 3300036401 | Bacteria | 1507 |
| 442 | Ga0373937_0481356 | 3300036401 | Bacteria | 1179 |
| 443 | Ga0373925_0049515 | 3300037068 | Bacteria | 3132 |
| 444 | Ga0373925_0064958 | 3300037068 | Bacteria | 2748 |
| 445 | Ga0395900_1207452 | 3300037418 | Bacteria | 672 |
| 446 | Ga0395905_0002016 | 3300037471 | Bacteria | 23213 |
| 447 | Ga0439447_095227 | 3300041407 | Bacteria | 684 |
| 448 | Ga0451789_1005102 | 3300041443 | Bacteria | 637 |
| 449 | Ga0451789_1201068 | 3300041443 | Bacteria | 584 |
| 450 | Ga0451793_1912977 | 3300041452 | Bacteria | 997 |
| 451 | Ga0451795_0648233 | 3300041456 | Bacteria | 1185 |
| 452 | Ga0451798_1144670 | 3300041458 | Bacteria | 832 |
| 453 | Ga0451800_0426012 | 3300041459 | Bacteria | 1185 |
| 454 | Ga0451800_0809926 | 3300041459 | Bacteria | 1251 |
| 455 | Ga0451807_0537413 | 3300041486 | Bacteria | 1308 |
| 456 | Ga0451807_1205355 | 3300041486 | Bacteria | 673 |
| 457 | Ga0451807_1355410 | 3300041486 | Bacteria | 935 |
| 458 | Ga0451845_0084914 | 3300041501 | Bacteria | 534 |
| 459 | Ga0451853_2328193 | 3300041512 | Bacteria | 2660 |
| 460 | Ga0439431_0062457 | 3300041997 | Bacteria | 982 |
| 461 | Ga0439446_0004412 | 3300042156 | Bacteria | 3570 |
| 462 | Ga0439434_0006231 | 3300042435 | Bacteria | 3479 |
| 463 | Ga0439434_0087775 | 3300042435 | Bacteria | 992 |
| 464 | Ga0450918_093667 | 3300042531 | Bacteria | 583 |
| 465 | Ga0451577_0026851 | 3300042876 | Bacteria | 5213 |
| 466 | Ga0451577_0312875 | 3300042876 | Bacteria | 1423 |
| 467 | Ga0466961_0417387 | 3300044693 | Bacteria | 813 |
| 468 | Ga0466963_0006875 | 3300044694 | Bacteria | 6767 |
| 469 | Ga0466964_0347689 | 3300044706 | Bacteria | 761 |
| 470 | Ga0453684_0219397 | 3300044712 | Bacteria | 2204 |
| 471 | Ga0466971_0186051 | 3300044719 | Bacteria | 977 |
| 472 | Ga0466968_0257062 | 3300044735 | Bacteria | 831 |
| 473 | Ga0466970_0177360 | 3300044765 | Bacteria | 1182 |
| 474 | Ga0451576_0007110 | 3300045051 | Bacteria | 13517 |
| 475 | Ga0451576_0015697 | 3300045051 | Bacteria | 8384 |
| 476 | Ga0451576_0448232 | 3300045051 | Bacteria | 1355 |
| 477 | Ga0495603_0328555 | 3300046455 | Bacteria | 878 |
| 478 | Ga0495580_0245568 | 3300046472 | Bacteria | 1226 |
| 479 | Ga0495582_0477575 | 3300046473 | Bacteria | 720 |
| 480 | Ga0495594_0438299 | 3300046499 | Bacteria | 743 |
| 481 | Ga0495630_0340550 | 3300046517 | Bacteria | 1147 |
| 482 | Ga0495632_0185622 | 3300046519 | Bacteria | 951 |
| 483 | Ga0495643_0198961 | 3300046522 | Bacteria | 963 |
| 484 | Ga0495648_0231524 | 3300046524 | Bacteria | 904 |
| 485 | Ga0495648_0302270 | 3300046524 | Bacteria | 749 |
| 486 | Ga0495652_0536809 | 3300046529 | Bacteria | 806 |
| 487 | Ga0495586_0638191 | 3300046535 | Unclassified | 615 |
| 488 | Ga0495587_0750450 | 3300046536 | Bacteria | 534 |
| 489 | Ga0495645_0189097 | 3300046543 | Bacteria | 1405 |
| 490 | Ga0495667_0483446 | 3300046559 | Unclassified | 776 |
| 491 | Ga0495667_0549551 | 3300046559 | Bacteria | 722 |
| 492 | Ga0495668_0053018 | 3300046616 | Bacteria | 2244 |
| 493 | Ga0495623_0204113 | 3300046679 | Bacteria | 1135 |
| 494 | Ga0495623_0469988 | 3300046679 | Bacteria | 667 |
| 495 | Ga0495658_0073987 | 3300046683 | Bacteria | 1984 |
| 496 | Ga0495624_0035461 | 3300046690 | Bacteria | 3221 |
| 497 | Ga0495671_0465229 | 3300046692 | Bacteria | 604 |
| 498 | Ga0495649_0162445 | 3300046694 | Bacteria | 1171 |
| 499 | Ga0495589_0577996 | 3300046794 | Bacteria | 512 |
| 500 | Ga0495604_0128175 | 3300047317 | Bacteria | 1827 |
| 501 | Ga0495604_0177509 | 3300047317 | Bacteria | 1492 |
| 502 | Ga0495604_0227794 | 3300047317 | Bacteria | 1280 |
| 503 | Ga0495636_0039253 | 3300047318 | Bacteria | 1960 |
| 504 | Ga0495674_0296256 | 3300047319 | Bacteria | 1322 |
| 505 | Ga0495674_0980772 | 3300047319 | Bacteria | 649 |
| 506 | Ga0495672_0001992 | 3300047320 | Bacteria | 19304 |
| 507 | Ga0495672_0303679 | 3300047320 | Bacteria | 755 |
| 508 | Ga0495672_0535778 | 3300047320 | Bacteria | 515 |
| 509 | Ga0495685_015009 | 3300047447 | Bacteria | 2638 |
| 510 | Ga0495685_042079 | 3300047447 | Bacteria | 1560 |
| 511 | Ga0496103_0780713 | 3300048906 | Bacteria | 603 |
| 512 | Ga0496108_0533584 | 3300048911 | Bacteria | 1024 |
| 513 | Ga0496109_0446928 | 3300048912 | Bacteria | 1221 |
| 514 | Ga0496109_0592087 | 3300048912 | Bacteria | 1045 |
| 515 | Ga0496109_0802904 | 3300048912 | Bacteria | 879 |
| 516 | Ga0496110_0366481 | 3300048913 | Bacteria | 1313 |
| 517 | Ga0496111_0363689 | 3300048914 | Bacteria | 1071 |
| 518 | Ga0496111_0546768 | 3300048914 | Bacteria | 850 |
| 519 | Ga0496112_0045127 | 3300048915 | Bacteria | 4320 |
| 520 | Ga0496112_0296353 | 3300048915 | Bacteria | 1563 |
| 521 | Ga0496113_0460243 | 3300048916 | Bacteria | 1022 |
| 522 | Ga0496113_0779293 | 3300048916 | Bacteria | 760 |
| 523 | Ga0496114_0088141 | 3300048917 | Bacteria | 2632 |
| 524 | Ga0496114_0160396 | 3300048917 | Bacteria | 1955 |
| 525 | Ga0496115_0255146 | 3300048918 | Bacteria | 1443 |
| 526 | Ga0496116_0261467 | 3300048919 | Bacteria | 853 |
| 527 | Ga0496126_0032668 | 3300048929 | Bacteria | 4901 |
| 528 | Ga0496126_0394996 | 3300048929 | Bacteria | 1123 |
| 529 | Ga0501031_0138261 | 3300049568 | Bacteria | 1592 |
| 530 | Ga0501031_0992613 | 3300049568 | Bacteria | 537 |
| 531 | Ga0501033_0217241 | 3300049570 | Bacteria | 1362 |
| 532 | Ga0501034_0080155 | 3300049571 | Bacteria | 3268 |
| 533 | Ga0501036_0335141 | 3300049572 | Bacteria | 1264 |
| 534 | Ga0501036_1363836 | 3300049572 | Bacteria | 575 |
| 535 | Ga0501037_0068760 | 3300049573 | Bacteria | 2579 |
| 536 | Ga0501038_0251987 | 3300049574 | Bacteria | 1398 |
| 537 | Ga0501038_0337733 | 3300049574 | Bacteria | 1175 |
| 538 | Ga0501039_0035680 | 3300049575 | Bacteria | 3838 |
| 539 | Ga0501039_0251282 | 3300049575 | Bacteria | 1390 |
| 540 | Ga0501039_0274707 | 3300049575 | Bacteria | 1325 |
| 541 | Ga0501040_0194379 | 3300049576 | Bacteria | 1440 |
| 542 | Ga0501040_0203027 | 3300049576 | Bacteria | 1408 |
| 543 | Ga0501040_0220740 | 3300049576 | Bacteria | 1348 |
| 544 | Ga0501040_0557804 | 3300049576 | Bacteria | 827 |
| 545 | Ga0501041_0013271 | 3300049577 | Bacteria | 4881 |
| 546 | Ga0501041_0034824 | 3300049577 | Bacteria | 3049 |
| 547 | Ga0501041_0585197 | 3300049577 | Bacteria | 712 |
| 548 | Ga0501068_0020934 | 3300049584 | Bacteria | 3817 |
| 549 | Ga0501068_0081875 | 3300049584 | Bacteria | 1982 |
| 550 | Ga0501068_0314364 | 3300049584 | Bacteria | 1004 |
| 551 | Ga0501068_0662191 | 3300049584 | Bacteria | 682 |
| 552 | Ga0501068_0883067 | 3300049584 | Bacteria | 588 |
| 553 | Ga0501070_0103939 | 3300049586 | Bacteria | 2349 |
| 554 | Ga0501070_0117683 | 3300049586 | Bacteria | 2195 |
| 555 | Ga0501071_0001799 | 3300049587 | Bacteria | 12667 |
| 556 | Ga0501071_0047370 | 3300049587 | Bacteria | 3088 |
| 557 | Ga0501071_0231868 | 3300049587 | Bacteria | 1391 |
| 558 | Ga0501072_0020170 | 3300049588 | Bacteria | 5162 |
| 559 | Ga0501072_0384339 | 3300049588 | Bacteria | 1114 |
| 560 | Ga0501072_1094129 | 3300049588 | Bacteria | 620 |
| 561 | Ga0501073_0022360 | 3300049589 | Bacteria | 4555 |
| 562 | Ga0501073_0121275 | 3300049589 | Bacteria | 1812 |
| 563 | Ga0501074_0077398 | 3300049590 | Bacteria | 2387 |
| 564 | Ga0501075_0006563 | 3300049591 | Bacteria | 8012 |
| 565 | Ga0501075_0304999 | 3300049591 | Bacteria | 1213 |
| 566 | Ga0501076_0032218 | 3300049592 | Bacteria | 4090 |
| 567 | Ga0501076_0092273 | 3300049592 | Bacteria | 2436 |
| 568 | Ga0501235_078221 | 3300049669 | Bacteria | 788 |
| 569 | Ga0501079_0104599 | 3300049741 | Bacteria | 2196 |
| 570 | Ga0501079_0237312 | 3300049741 | Bacteria | 1424 |
| 571 | Ga0501079_0423847 | 3300049741 | Bacteria | 1045 |
| 572 | Ga0501080_0008180 | 3300049742 | Bacteria | 9474 |
| 573 | Ga0501081_0005916 | 3300049743 | Bacteria | 7914 |
| 574 | Ga0501081_0131965 | 3300049743 | Bacteria | 1785 |
| 575 | Ga0501035_0596888 | 3300049822 | Bacteria | 900 |
| 576 | Ga0501044_0469760 | 3300049823 | Bacteria | 1162 |
| 577 | Ga0501045_0164745 | 3300049824 | Bacteria | 1651 |
| 578 | Ga0501045_0312207 | 3300049824 | Bacteria | 1170 |
| 579 | Ga0501045_0480169 | 3300049824 | Bacteria | 923 |
| 580 | nmdc:mga03n38_504782_c1 | 3300050490 | Bacteria | 679 |
| 581 | nmdc:mga03n38_546319_c1 | 3300050490 | Bacteria | 655 |
| 582 | nmdc:mga0yw44_285738_c1 | 3300050492 | Bacteria | 1103 |
| 583 | nmdc:mga0k408_113632_c1 | 3300050493 | Bacteria | 1601 |
| 584 | nmdc:mga0k408_392658_c1 | 3300050493 | Bacteria | 826 |
| 585 | nmdc:mga0k408_71882_c1 | 3300050493 | Bacteria | 2020 |
| 586 | nmdc:mga06z11_555071_c1 | 3300050494 | Bacteria | 697 |
| 587 | nmdc:mga07m45_47934_c1 | 3300050496 | Bacteria | 2402 |
| 588 | nmdc:mga05p37_72_c1 | 3300050507 | Bacteria | 88725 |
| 589 | nmdc:mga09592_23529_c1 | 3300050508 | Bacteria | 5089 |
| 590 | nmdc:mga09592_573767_c1 | 3300050508 | Bacteria | 968 |
| 591 | nmdc:mga09592_65101_c1 | 3300050508 | Bacteria | 3087 |
| 592 | nmdc:mga09592_833350_c1 | 3300050508 | Bacteria | 779 |
| 593 | nmdc:mga0qj67_116442_c1 | 3300050509 | Bacteria | 2160 |
| 594 | nmdc:mga0qj67_333042_c1 | 3300050509 | Bacteria | 1228 |
| 595 | nmdc:mga0qj67_472149_c1 | 3300050509 | Bacteria | 1010 |
| 596 | nmdc:mga0qj67_540017_c1 | 3300050509 | Bacteria | 936 |
| 597 | nmdc:mga0qj67_55912_c1 | 3300050509 | Bacteria | 3127 |
| 598 | nmdc:mga06r32_1047806_c1 | 3300050510 | Bacteria | 767 |
| 599 | nmdc:mga06r32_184499_c1 | 3300050510 | Bacteria | 2073 |
| 600 | nmdc:mga06r32_635259_c1 | 3300050510 | Bacteria | 1037 |
| 601 | nmdc:mga06r32_714922_c1 | 3300050510 | Bacteria | 967 |
| 602 | nmdc:mga06r32_851204_c1 | 3300050510 | Bacteria | 870 |
| 603 | nmdc:mga08y16_1292_c1 | 3300050511 | Bacteria | 24852 |
| 604 | nmdc:mga08y16_250335_c1 | 3300050511 | Bacteria | 1831 |
| 605 | nmdc:mga08y16_5195_c1 | 3300050511 | Bacteria | 13599 |
| 606 | nmdc:mga08y16_530695_c1 | 3300050511 | Bacteria | 1193 |
| 607 | nmdc:mga08y16_64970_c1 | 3300050511 | Bacteria | 3809 |
| 608 | nmdc:mga08y16_8483_c1 | 3300050511 | Bacteria | 10764 |
| 609 | nmdc:mga0n895_340253_c1 | 3300050512 | Bacteria | 1520 |
| 610 | nmdc:mga0rr50_1227653_c1 | 3300050513 | Bacteria | 637 |
| 611 | nmdc:mga0rr50_84234_c1 | 3300050513 | Bacteria | 2461 |
| 612 | nmdc:mga08x19_64236_c1 | 3300050514 | Bacteria | 2383 |
| 613 | nmdc:mga0a205_37767_c1 | 3300050515 | Bacteria | 4644 |
| 614 | nmdc:mga0a205_441482_c1 | 3300050515 | Bacteria | 1162 |
| 615 | Ga0495601_0104602 | 3300053077 | Bacteria | 1830 |
| 616 | Ga0495595_0352805 | 3300053084 | Bacteria | 743 |
| 617 | Ga0500594_0087829 | 3300053118 | Bacteria | 940 |
| 618 | Ga0500594_0261915 | 3300053118 | Bacteria | 576 |
| 619 | Ga0500559_0134133 | 3300053136 | Bacteria | 1157 |
| 620 | Ga0500568_0196058 | 3300053139 | Bacteria | 740 |
| 621 | Ga0500573_0005994 | 3300053140 | Bacteria | 6543 |
| 622 | Ga0500577_0433203 | 3300053142 | Bacteria | 575 |
| 623 | Ga0501084_1354069 | 3300054114 | Bacteria | 596 |
| 624 | Ga0501082_0435927 | 3300060353 | Bacteria | 1144 |
| 625 | Ga0501082_0752774 | 3300060353 | Bacteria | 853 |
| 626 | Ga0530510_0107072 | 3300061734 | Bacteria | 2046 |
| 627 | Ga0530510_0139220 | 3300061734 | Bacteria | 1787 |
| 628 | Ga0530510_0443267 | 3300061734 | Bacteria | 981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10217700 | Ga0265338_102177002 | 126 |
| 2 | 3300031235 | Ga0265330_10154537 | Ga0265330_101545371 | 126 |
| 3 | 3300031241 | Ga0265325_10100540 | Ga0265325_101005402 | 126 |
| 4 | 3300031249 | Ga0265339_10071518 | Ga0265339_100715182 | 126 |
| 5 | 3300031595 | Ga0265313_10001954 | Ga0265313_100019543 | 126 |
| 6 | 3300031712 | Ga0265342_10046823 | Ga0265342_100468232 | 126 |
| 7 | 3300049584 | Ga0501068_0662191 | Ga0501068_0662191_16_408 | 128 |
| 8 | 3300049588 | Ga0501072_0384339 | Ga0501072_0384339_709_1101 | 130 |
| 9 | 3300005843 | Ga0068860_100282316 | Ga0068860_1002823163 | 140 |
| 10 | 3300014969 | Ga0157376_12424735 | Ga0157376_124247351 | 140 |
| 11 | 3300025915 | Ga0207693_10903341 | Ga0207693_109033411 | 140 |
| 12 | 3300026088 | Ga0207641_10436742 | Ga0207641_104367422 | 140 |
| 13 | 3300048917 | Ga0496114_0088141 | Ga0496114_0088141_104_553 | 140 |
| 14 | 3300028800 | Ga0265338_10244088 | Ga0265338_102440883 | 142 |
| 15 | iso_pu_bacteria | 2515154088 | 2515495334 | 142 |
| 16 | iso_pu_bacteria | 2515154137 | 2515759386 | 142 |
| 17 | iso_pu_bacteria | 2515154203 | 2516092240 | 142 |
| 18 | iso_pu_bacteria | 2582581313 | 2585307953 | 142 |
| 19 | iso_pu_bacteria | 2687453743 | 2689990606 | 142 |
| 20 | iso_pu_bacteria | 2738543011 | 2739240228 | 142 |
| 21 | iso_pu_bacteria | 2862281513 | 2862286501 | 142 |
| 22 | iso_pu_bacteria | 2889300758 | 2889302858 | 142 |
| 23 | iso_pu_bacteria | 2891554331 | 2891561410 | 142 |
| 24 | iso_pu_bacteria | 2939743619 | 2939749062 | 142 |
| 25 | iso_pu_bacteria | 2945956166 | 2945959429 | 142 |
| 26 | iso_pu_bacteria | 2954711539 | 2954719397 | 142 |
| 27 | iso_pu_bacteria | 2954721474 | 2954729377 | 142 |
| 28 | iso_pu_bacteria | 2954731030 | 2954732431 | 142 |
| 29 | iso_pu_bacteria | 2954740390 | 2954748280 | 142 |
| 30 | iso_pu_bacteria | 2954749733 | 2954751319 | 142 |
| 31 | iso_pu_bacteria | 2954759201 | 2954767403 | 142 |
| 32 | iso_pu_bacteria | 8002775197 | 8002782960 | 142 |
| 33 | iso_pu_bacteria | 8054913762 | 8054916427 | 142 |
| 34 | iso_pu_bacteria | 8057568493 | 8057574214 | 142 |
| 35 | iso_pu_bacteria | 2675903059 | 2676485789 | 143 |
| 36 | iso_pu_bacteria | 2855670206 | 2855674703 | 143 |
| 37 | iso_pu_bacteria | 2855676851 | 2855680152 | 143 |
| 38 | iso_pu_bacteria | 2857288857 | 2857289268 | 143 |
| 39 | iso_pu_bacteria | 2858848962 | 2858854794 | 143 |
| 40 | iso_pu_bacteria | 2858882152 | 2858887343 | 143 |
| 41 | iso_pu_bacteria | 2858888857 | 2858890242 | 143 |
| 42 | iso_pu_bacteria | 2858895516 | 2858902206 | 143 |
| 43 | iso_pu_bacteria | 2869048445 | 2869050016 | 143 |
| 44 | iso_pu_bacteria | 2869061728 | 2869066406 | 143 |
| 45 | iso_pu_bacteria | 2869068681 | 2869070449 | 143 |
| 46 | iso_pu_bacteria | 2880495981 | 2880496949 | 143 |
| 47 | 3300005344 | Ga0070661_101071193 | Ga0070661_1010711931 | 144 |
| 48 | 3300005356 | Ga0070674_101096477 | Ga0070674_1010964771 | 144 |
| 49 | 3300005367 | Ga0070667_100257893 | Ga0070667_1002578932 | 144 |
| 50 | 3300005535 | Ga0070684_101649697 | Ga0070684_1016496971 | 144 |
| 51 | 3300005548 | Ga0070665_100760510 | Ga0070665_1007605102 | 144 |
| 52 | 3300005578 | Ga0068854_100495379 | Ga0068854_1004953792 | 144 |
| 53 | 3300005616 | Ga0068852_100490800 | Ga0068852_1004908002 | 144 |
| 54 | 3300005719 | Ga0068861_100034591 | Ga0068861_1000345913 | 144 |
| 55 | 3300005843 | Ga0068860_100404293 | Ga0068860_1004042932 | 144 |
| 56 | 3300005844 | Ga0068862_100071389 | Ga0068862_1000713893 | 144 |
| 57 | 3300005937 | Ga0081455_10034300 | Ga0081455_100343004 | 144 |
| 58 | 3300006844 | Ga0075428_100272684 | Ga0075428_1002726842 | 144 |
| 59 | 3300006844 | Ga0075428_101130915 | Ga0075428_1011309151 | 144 |
| 60 | 3300006846 | Ga0075430_100315140 | Ga0075430_1003151402 | 144 |
| 61 | 3300006846 | Ga0075430_100340170 | Ga0075430_1003401702 | 144 |
| 62 | 3300006847 | Ga0075431_100108461 | Ga0075431_1001084613 | 144 |
| 63 | 3300006880 | Ga0075429_100314138 | Ga0075429_1003141382 | 144 |
| 64 | 3300006880 | Ga0075429_100323543 | Ga0075429_1003235432 | 144 |
| 65 | 3300009094 | Ga0111539_10072216 | Ga0111539_100722164 | 144 |
| 66 | 3300009147 | Ga0114129_11027911 | Ga0114129_110279112 | 144 |
| 67 | 3300009147 | Ga0114129_11471477 | Ga0114129_114714772 | 144 |
| 68 | 3300009551 | Ga0105238_10851199 | Ga0105238_108511991 | 144 |
| 69 | 3300009553 | Ga0105249_10076432 | Ga0105249_100764324 | 144 |
| 70 | 3300011119 | Ga0105246_10319590 | Ga0105246_103195902 | 144 |
| 71 | 3300013307 | Ga0157372_11777467 | Ga0157372_117774672 | 144 |
| 72 | 3300014325 | Ga0163163_11610983 | Ga0163163_116109831 | 144 |
| 73 | 3300025931 | Ga0207644_10217104 | Ga0207644_102171042 | 144 |
| 74 | 3300025961 | Ga0207712_10194614 | Ga0207712_101946142 | 144 |
| 75 | 3300025986 | Ga0207658_10459509 | Ga0207658_104595092 | 144 |
| 76 | 3300026118 | Ga0207675_100002127 | Ga0207675_1000021279 | 144 |
| 77 | 3300026142 | Ga0207698_10385854 | Ga0207698_103858542 | 144 |
| 78 | 3300027907 | Ga0207428_10050362 | Ga0207428_100503622 | 144 |
| 79 | 3300028380 | Ga0268265_10391193 | Ga0268265_103911931 | 144 |
| 80 | 3300028381 | Ga0268264_10379795 | Ga0268264_103797952 | 144 |
| 81 | 3300041459 | Ga0451800_0809926 | Ga0451800_0809926_293_733 | 144 |
| 82 | 3300041501 | Ga0451845_0084914 | Ga0451845_0084914_15_455 | 144 |
| 83 | 3300042531 | Ga0450918_093667 | Ga0450918_093667_68_511 | 144 |
| 84 | 3300048912 | Ga0496109_0446928 | Ga0496109_0446928_513_956 | 144 |
| 85 | 3300048913 | Ga0496110_0366481 | Ga0496110_0366481_454_903 | 144 |
| 86 | 3300048914 | Ga0496111_0546768 | Ga0496111_0546768_348_791 | 144 |
| 87 | 3300048916 | Ga0496113_0460243 | Ga0496113_0460243_223_666 | 144 |
| 88 | 3300048917 | Ga0496114_0160396 | Ga0496114_0160396_1089_1538 | 144 |
| 89 | 3300049571 | Ga0501034_0080155 | Ga0501034_0080155_1892_2335 | 144 |
| 90 | 3300049572 | Ga0501036_1363836 | Ga0501036_1363836_34_477 | 144 |
| 91 | 3300049574 | Ga0501038_0337733 | Ga0501038_0337733_105_548 | 144 |
| 92 | 3300049575 | Ga0501039_0274707 | Ga0501039_0274707_175_618 | 144 |
| 93 | 3300049576 | Ga0501040_0203027 | Ga0501040_0203027_303_746 | 144 |
| 94 | 3300049577 | Ga0501041_0585197 | Ga0501041_0585197_247_690 | 144 |
| 95 | 3300049586 | Ga0501070_0103939 | Ga0501070_0103939_1082_1546 | 144 |
| 96 | 3300049586 | Ga0501070_0117683 | Ga0501070_0117683_1005_1469 | 144 |
| 97 | 3300049592 | Ga0501076_0092273 | Ga0501076_0092273_1784_2227 | 144 |
| 98 | 3300049741 | Ga0501079_0423847 | Ga0501079_0423847_52_495 | 144 |
| 99 | 3300049823 | Ga0501044_0469760 | Ga0501044_0469760_54_497 | 144 |
| 100 | 3300049824 | Ga0501045_0164745 | Ga0501045_0164745_853_1296 | 144 |
| 101 | 3300050508 | nmdc:mga09592_573767_c1 | nmdc:mga09592_573767_c1_447_890 | 144 |
| 102 | 3300050509 | nmdc:mga0qj67_116442_c1 | nmdc:mga0qj67_116442_c1_679_1122 | 144 |
| 103 | 3300050509 | nmdc:mga0qj67_55912_c1 | nmdc:mga0qj67_55912_c1_1053_1496 | 144 |
| 104 | 3300050510 | nmdc:mga06r32_635259_c1 | nmdc:mga06r32_635259_c1_73_516 | 144 |
| 105 | 3300053139 | Ga0500568_0196058 | Ga0500568_0196058_118_561 | 144 |
| 106 | 3300053140 | Ga0500573_0005994 | Ga0500573_0005994_2553_2996 | 144 |
| 107 | 3300060353 | Ga0501082_0752774 | Ga0501082_0752774_230_673 | 144 |
| 108 | 3300046529 | Ga0495652_0536809 | Ga0495652_0536809_65_502 | 145 |
| 109 | 3300048918 | Ga0496115_0255146 | Ga0496115_0255146_523_960 | 145 |
| 110 | 3300003316 | rootH1_10164810 | rootH1_101648102 | 146 |
| 111 | 3300003322 | rootL2_10036088 | rootL2_100360883 | 146 |
| 112 | 3300003323 | rootH1_10093008 | rootH1_100930083 | 146 |
| 113 | 3300005295 | Ga0065707_10458892 | Ga0065707_104588922 | 146 |
| 114 | 3300005295 | Ga0065707_10615757 | Ga0065707_106157571 | 146 |
| 115 | 3300005331 | Ga0070670_100124738 | Ga0070670_1001247383 | 146 |
| 116 | 3300005340 | Ga0070689_101160449 | Ga0070689_1011604491 | 146 |
| 117 | 3300005353 | Ga0070669_100234660 | Ga0070669_1002346603 | 146 |
| 118 | 3300005618 | Ga0068864_100273008 | Ga0068864_1002730083 | 146 |
| 119 | 3300005840 | Ga0068870_10990553 | Ga0068870_109905531 | 146 |
| 120 | 3300005937 | Ga0081455_10078930 | Ga0081455_100789303 | 146 |
| 121 | 3300005983 | Ga0081540_1076160 | Ga0081540_10761603 | 146 |
| 122 | 3300005985 | Ga0081539_10002135 | Ga0081539_100021356 | 146 |
| 123 | 3300006048 | Ga0075363_100007959 | Ga0075363_1000079593 | 146 |
| 124 | 3300006048 | Ga0075363_100252818 | Ga0075363_1002528182 | 146 |
| 125 | 3300006051 | Ga0075364_10045520 | Ga0075364_100455202 | 146 |
| 126 | 3300006195 | Ga0075366_10238710 | Ga0075366_102387103 | 146 |
| 127 | 3300006353 | Ga0075370_10048649 | Ga0075370_100486494 | 146 |
| 128 | 3300006844 | Ga0075428_100015367 | Ga0075428_1000153675 | 146 |
| 129 | 3300006844 | Ga0075428_100443436 | Ga0075428_1004434362 | 146 |
| 130 | 3300006846 | Ga0075430_100030229 | Ga0075430_1000302292 | 146 |
| 131 | 3300006847 | Ga0075431_100012461 | Ga0075431_1000124618 | 146 |
| 132 | 3300006847 | Ga0075431_100022698 | Ga0075431_1000226982 | 146 |
| 133 | 3300006847 | Ga0075431_100048795 | Ga0075431_1000487953 | 146 |
| 134 | 3300006880 | Ga0075429_100023263 | Ga0075429_1000232635 | 146 |
| 135 | 3300007788 | Ga0099795_10005512 | Ga0099795_100055124 | 146 |
| 136 | 3300009094 | Ga0111539_10022910 | Ga0111539_100229104 | 146 |
| 137 | 3300009147 | Ga0114129_10039464 | Ga0114129_100394642 | 146 |
| 138 | 3300009147 | Ga0114129_10235239 | Ga0114129_102352394 | 146 |
| 139 | 3300009148 | Ga0105243_10002015 | Ga0105243_100020159 | 146 |
| 140 | 3300009177 | Ga0105248_11666499 | Ga0105248_116664991 | 146 |
| 141 | 3300009177 | Ga0105248_11872608 | Ga0105248_118726082 | 146 |
| 142 | 3300010159 | Ga0099796_10034040 | Ga0099796_100340402 | 146 |
| 143 | 3300013308 | Ga0157375_10140914 | Ga0157375_101409142 | 146 |
| 144 | 3300014325 | Ga0163163_11332243 | Ga0163163_113322431 | 146 |
| 145 | 3300015688 | Ga0183367_1015 | Ga0183367_1015193 | 146 |
| 146 | 3300025925 | Ga0207650_10542822 | Ga0207650_105428222 | 146 |
| 147 | 3300025936 | Ga0207670_10579462 | Ga0207670_105794621 | 146 |
| 148 | 3300027907 | Ga0207428_10014397 | Ga0207428_100143971 | 146 |
| 149 | 3300028016 | Ga0265354_1021620 | Ga0265354_10216202 | 146 |
| 150 | 3300028563 | Ga0265319_1106929 | Ga0265319_11069292 | 146 |
| 151 | 3300028573 | Ga0265334_10202895 | Ga0265334_102028951 | 146 |
| 152 | 3300028794 | Ga0307515_10000038 | Ga0307515_10000038267 | 146 |
| 153 | 3300028794 | Ga0307515_10057087 | Ga0307515_100570873 | 146 |
| 154 | 3300031241 | Ga0265325_10168020 | Ga0265325_101680201 | 146 |
| 155 | 3300031344 | Ga0265316_10006348 | Ga0265316_100063483 | 146 |
| 156 | 3300031456 | Ga0307513_10000001 | Ga0307513_10000001567 | 146 |
| 157 | 3300031456 | Ga0307513_10001895 | Ga0307513_1000189510 | 146 |
| 158 | 3300032002 | Ga0307416_100898681 | Ga0307416_1008986812 | 146 |
| 159 | 3300037418 | Ga0395900_1207452 | Ga0395900_1207452_55_495 | 146 |
| 160 | 3300041452 | Ga0451793_1912977 | Ga0451793_1912977_315_761 | 146 |
| 161 | 3300041512 | Ga0451853_2328193 | Ga0451853_2328193_1335_1778 | 146 |
| 162 | 3300044693 | Ga0466961_0417387 | Ga0466961_0417387_278_718 | 146 |
| 163 | 3300044694 | Ga0466963_0006875 | Ga0466963_0006875_634_1074 | 146 |
| 164 | 3300044706 | Ga0466964_0347689 | Ga0466964_0347689_207_647 | 146 |
| 165 | 3300044719 | Ga0466971_0186051 | Ga0466971_0186051_171_611 | 146 |
| 166 | 3300044735 | Ga0466968_0257062 | Ga0466968_0257062_79_519 | 146 |
| 167 | 3300044765 | Ga0466970_0177360 | Ga0466970_0177360_577_1017 | 146 |
| 168 | 3300046522 | Ga0495643_0198961 | Ga0495643_0198961_413_853 | 146 |
| 169 | 3300046536 | Ga0495587_0750450 | Ga0495587_0750450_56_502 | 146 |
| 170 | 3300046559 | Ga0495667_0549551 | Ga0495667_0549551_73_516 | 146 |
| 171 | 3300046679 | Ga0495623_0469988 | Ga0495623_0469988_30_473 | 146 |
| 172 | 3300046694 | Ga0495649_0162445 | Ga0495649_0162445_168_608 | 146 |
| 173 | 3300047317 | Ga0495604_0177509 | Ga0495604_0177509_118_561 | 146 |
| 174 | 3300047318 | Ga0495636_0039253 | Ga0495636_0039253_658_1101 | 146 |
| 175 | 3300047320 | Ga0495672_0001992 | Ga0495672_0001992_1935_2378 | 146 |
| 176 | 3300047447 | Ga0495685_015009 | Ga0495685_015009_132_575 | 146 |
| 177 | 3300047447 | Ga0495685_042079 | Ga0495685_042079_761_1201 | 146 |
| 178 | 3300049570 | Ga0501033_0217241 | Ga0501033_0217241_639_1082 | 146 |
| 179 | 3300049572 | Ga0501036_0335141 | Ga0501036_0335141_201_644 | 146 |
| 180 | 3300049574 | Ga0501038_0251987 | Ga0501038_0251987_205_648 | 146 |
| 181 | 3300049575 | Ga0501039_0035680 | Ga0501039_0035680_1328_1771 | 146 |
| 182 | 3300049576 | Ga0501040_0220740 | Ga0501040_0220740_781_1224 | 146 |
| 183 | 3300049577 | Ga0501041_0034824 | Ga0501041_0034824_24_467 | 146 |
| 184 | 3300049584 | Ga0501068_0020934 | Ga0501068_0020934_941_1384 | 146 |
| 185 | 3300049587 | Ga0501071_0047370 | Ga0501071_0047370_1854_2300 | 146 |
| 186 | 3300049588 | Ga0501072_1094129 | Ga0501072_1094129_102_548 | 146 |
| 187 | 3300049590 | Ga0501074_0077398 | Ga0501074_0077398_1739_2182 | 146 |
| 188 | 3300049591 | Ga0501075_0006563 | Ga0501075_0006563_769_1212 | 146 |
| 189 | 3300049741 | Ga0501079_0237312 | Ga0501079_0237312_545_988 | 146 |
| 190 | 3300049822 | Ga0501035_0596888 | Ga0501035_0596888_281_724 | 146 |
| 191 | 3300049824 | Ga0501045_0480169 | Ga0501045_0480169_272_712 | 146 |
| 192 | 3300050490 | nmdc:mga03n38_504782_c1 | nmdc:mga03n38_504782_c1_169_612 | 146 |
| 193 | 3300050490 | nmdc:mga03n38_546319_c1 | nmdc:mga03n38_546319_c1_32_475 | 146 |
| 194 | 3300050494 | nmdc:mga06z11_555071_c1 | nmdc:mga06z11_555071_c1_32_475 | 146 |
| 195 | 3300050496 | nmdc:mga07m45_47934_c1 | nmdc:mga07m45_47934_c1_1030_1470 | 146 |
| 196 | 3300050508 | nmdc:mga09592_65101_c1 | nmdc:mga09592_65101_c1_1113_1556 | 146 |
| 197 | 3300050508 | nmdc:mga09592_833350_c1 | nmdc:mga09592_833350_c1_58_501 | 146 |
| 198 | 3300050509 | nmdc:mga0qj67_472149_c1 | nmdc:mga0qj67_472149_c1_227_670 | 146 |
| 199 | 3300050509 | nmdc:mga0qj67_540017_c1 | nmdc:mga0qj67_540017_c1_265_708 | 146 |
| 200 | 3300050510 | nmdc:mga06r32_1047806_c1 | nmdc:mga06r32_1047806_c1_96_539 | 146 |
| 201 | 3300050510 | nmdc:mga06r32_714922_c1 | nmdc:mga06r32_714922_c1_364_807 | 146 |
| 202 | 3300050510 | nmdc:mga06r32_851204_c1 | nmdc:mga06r32_851204_c1_172_615 | 146 |
| 203 | 3300050511 | nmdc:mga08y16_5195_c1 | nmdc:mga08y16_5195_c1_1404_1847 | 146 |
| 204 | 3300061734 | Ga0530510_0107072 | Ga0530510_0107072_1523_1966 | 146 |
| 205 | 3300061734 | Ga0530510_0139220 | Ga0530510_0139220_1329_1772 | 146 |
| 206 | 3300005330 | Ga0070690_100254826 | Ga0070690_1002548262 | 147 |
| 207 | 3300005335 | Ga0070666_10027019 | Ga0070666_100270192 | 147 |
| 208 | 3300005338 | Ga0068868_100024655 | Ga0068868_1000246552 | 147 |
| 209 | 3300005340 | Ga0070689_100008791 | Ga0070689_1000087917 | 147 |
| 210 | 3300005344 | Ga0070661_100024682 | Ga0070661_1000246821 | 147 |
| 211 | 3300005347 | Ga0070668_100003237 | Ga0070668_10000323714 | 147 |
| 212 | 3300005347 | Ga0070668_100479463 | Ga0070668_1004794632 | 147 |
| 213 | 3300005354 | Ga0070675_101552661 | Ga0070675_1015526611 | 147 |
| 214 | 3300005364 | Ga0070673_100157840 | Ga0070673_1001578402 | 147 |
| 215 | 3300005365 | Ga0070688_100065271 | Ga0070688_1000652711 | 147 |
| 216 | 3300005367 | Ga0070667_100014479 | Ga0070667_1000144795 | 147 |
| 217 | 3300005406 | Ga0070703_10123796 | Ga0070703_101237962 | 147 |
| 218 | 3300005435 | Ga0070714_100005738 | Ga0070714_1000057386 | 147 |
| 219 | 3300005436 | Ga0070713_100720529 | Ga0070713_1007205292 | 147 |
| 220 | 3300005440 | Ga0070705_100371121 | Ga0070705_1003711212 | 147 |
| 221 | 3300005441 | Ga0070700_100510035 | Ga0070700_1005100352 | 147 |
| 222 | 3300005441 | Ga0070700_101198424 | Ga0070700_1011984242 | 147 |
| 223 | 3300005444 | Ga0070694_100012918 | Ga0070694_1000129187 | 147 |
| 224 | 3300005444 | Ga0070694_100540614 | Ga0070694_1005406141 | 147 |
| 225 | 3300005456 | Ga0070678_100313026 | Ga0070678_1003130261 | 147 |
| 226 | 3300005466 | Ga0070685_10612211 | Ga0070685_106122111 | 147 |
| 227 | 3300005466 | Ga0070685_10810270 | Ga0070685_108102701 | 147 |
| 228 | 3300005535 | Ga0070684_100157043 | Ga0070684_1001570431 | 147 |
| 229 | 3300005543 | Ga0070672_100818825 | Ga0070672_1008188252 | 147 |
| 230 | 3300005544 | Ga0070686_100035054 | Ga0070686_1000350543 | 147 |
| 231 | 3300005545 | Ga0070695_100125219 | Ga0070695_1001252192 | 147 |
| 232 | 3300005546 | Ga0070696_100268300 | Ga0070696_1002683002 | 147 |
| 233 | 3300005548 | Ga0070665_100124266 | Ga0070665_1001242663 | 147 |
| 234 | 3300005563 | Ga0068855_100292934 | Ga0068855_1002929343 | 147 |
| 235 | 3300005564 | Ga0070664_100025792 | Ga0070664_1000257926 | 147 |
| 236 | 3300005614 | Ga0068856_100380884 | Ga0068856_1003808842 | 147 |
| 237 | 3300005618 | Ga0068864_100005699 | Ga0068864_10000569910 | 147 |
| 238 | 3300005719 | Ga0068861_100109063 | Ga0068861_1001090633 | 147 |
| 239 | 3300005840 | Ga0068870_10097649 | Ga0068870_100976492 | 147 |
| 240 | 3300005840 | Ga0068870_10377991 | Ga0068870_103779912 | 147 |
| 241 | 3300005841 | Ga0068863_100010108 | Ga0068863_10001010810 | 147 |
| 242 | 3300005843 | Ga0068860_100091956 | Ga0068860_1000919561 | 147 |
| 243 | 3300005843 | Ga0068860_100504600 | Ga0068860_1005046002 | 147 |
| 244 | 3300005843 | Ga0068860_101356909 | Ga0068860_1013569092 | 147 |
| 245 | 3300005844 | Ga0068862_100139527 | Ga0068862_1001395273 | 147 |
| 246 | 3300005844 | Ga0068862_100444379 | Ga0068862_1004443792 | 147 |
| 247 | 3300006028 | Ga0070717_10169159 | Ga0070717_101691594 | 147 |
| 248 | 3300006038 | Ga0075365_10464733 | Ga0075365_104647332 | 147 |
| 249 | 3300006038 | Ga0075365_10569517 | Ga0075365_105695171 | 147 |
| 250 | 3300006048 | Ga0075363_100276618 | Ga0075363_1002766181 | 147 |
| 251 | 3300006178 | Ga0075367_10619971 | Ga0075367_106199711 | 147 |
| 252 | 3300006358 | Ga0068871_100052049 | Ga0068871_1000520492 | 147 |
| 253 | 3300006358 | Ga0068871_100189199 | Ga0068871_1001891993 | 147 |
| 254 | 3300006844 | Ga0075428_100248011 | Ga0075428_1002480111 | 147 |
| 255 | 3300006844 | Ga0075428_100542304 | Ga0075428_1005423042 | 147 |
| 256 | 3300006844 | Ga0075428_100819246 | Ga0075428_1008192462 | 147 |
| 257 | 3300006846 | Ga0075430_100412747 | Ga0075430_1004127472 | 147 |
| 258 | 3300006931 | Ga0097620_100778344 | Ga0097620_1007783442 | 147 |
| 259 | 3300007076 | Ga0075435_101294897 | Ga0075435_1012948972 | 147 |
| 260 | 3300009094 | Ga0111539_10010757 | Ga0111539_100107576 | 147 |
| 261 | 3300009094 | Ga0111539_10112595 | Ga0111539_101125952 | 147 |
| 262 | 3300009098 | Ga0105245_10051126 | Ga0105245_100511261 | 147 |
| 263 | 3300009101 | Ga0105247_10012124 | Ga0105247_100121241 | 147 |
| 264 | 3300009177 | Ga0105248_10196243 | Ga0105248_101962432 | 147 |
| 265 | 3300009551 | Ga0105238_10027142 | Ga0105238_100271425 | 147 |
| 266 | 3300009553 | Ga0105249_10024555 | Ga0105249_100245555 | 147 |
| 267 | 3300009553 | Ga0105249_10960369 | Ga0105249_109603691 | 147 |
| 268 | 3300009553 | Ga0105249_11862391 | Ga0105249_118623911 | 147 |
| 269 | 3300010375 | Ga0105239_10018290 | Ga0105239_100182907 | 147 |
| 270 | 3300011119 | Ga0105246_10011573 | Ga0105246_100115737 | 147 |
| 271 | 3300013296 | Ga0157374_10014182 | Ga0157374_100141826 | 147 |
| 272 | 3300013306 | Ga0163162_10007161 | Ga0163162_100071615 | 147 |
| 273 | 3300013308 | Ga0157375_10060113 | Ga0157375_100601132 | 147 |
| 274 | 3300014325 | Ga0163163_12243904 | Ga0163163_122439041 | 147 |
| 275 | 3300014326 | Ga0157380_10530696 | Ga0157380_105306961 | 147 |
| 276 | 3300014745 | Ga0157377_10010946 | Ga0157377_100109465 | 147 |
| 277 | 3300014968 | Ga0157379_10087031 | Ga0157379_100870311 | 147 |
| 278 | 3300014969 | Ga0157376_10696816 | Ga0157376_106968162 | 147 |
| 279 | 3300017792 | Ga0163161_11943127 | Ga0163161_119431271 | 147 |
| 280 | 3300025885 | Ga0207653_10388533 | Ga0207653_103885331 | 147 |
| 281 | 3300025900 | Ga0207710_10043447 | Ga0207710_100434472 | 147 |
| 282 | 3300025903 | Ga0207680_10045482 | Ga0207680_100454822 | 147 |
| 283 | 3300025908 | Ga0207643_10169252 | Ga0207643_101692522 | 147 |
| 284 | 3300025915 | Ga0207693_10610435 | Ga0207693_106104351 | 147 |
| 285 | 3300025920 | Ga0207649_10041029 | Ga0207649_100410292 | 147 |
| 286 | 3300025927 | Ga0207687_10016447 | Ga0207687_100164476 | 147 |
| 287 | 3300025929 | Ga0207664_10003993 | Ga0207664_100039938 | 147 |
| 288 | 3300025931 | Ga0207644_10030943 | Ga0207644_100309432 | 147 |
| 289 | 3300025936 | Ga0207670_10090055 | Ga0207670_100900552 | 147 |
| 290 | 3300025940 | Ga0207691_10325274 | Ga0207691_103252741 | 147 |
| 291 | 3300025941 | Ga0207711_10167770 | Ga0207711_101677702 | 147 |
| 292 | 3300025942 | Ga0207689_10737209 | Ga0207689_107372091 | 147 |
| 293 | 3300025945 | Ga0207679_10476141 | Ga0207679_104761411 | 147 |
| 294 | 3300025949 | Ga0207667_10478328 | Ga0207667_104783281 | 147 |
| 295 | 3300025960 | Ga0207651_10140746 | Ga0207651_101407462 | 147 |
| 296 | 3300025961 | Ga0207712_10108852 | Ga0207712_101088523 | 147 |
| 297 | 3300025972 | Ga0207668_10002007 | Ga0207668_100020074 | 147 |
| 298 | 3300026075 | Ga0207708_11095608 | Ga0207708_110956082 | 147 |
| 299 | 3300026075 | Ga0207708_11152618 | Ga0207708_111526182 | 147 |
| 300 | 3300026088 | Ga0207641_10027446 | Ga0207641_100274465 | 147 |
| 301 | 3300026089 | Ga0207648_10800960 | Ga0207648_108009602 | 147 |
| 302 | 3300026095 | Ga0207676_10043379 | Ga0207676_100433792 | 147 |
| 303 | 3300026118 | Ga0207675_100040991 | Ga0207675_1000409913 | 147 |
| 304 | 3300026121 | Ga0207683_10177776 | Ga0207683_101777762 | 147 |
| 305 | 3300028380 | Ga0268265_10479842 | Ga0268265_104798422 | 147 |
| 306 | 3300028381 | Ga0268264_10474476 | Ga0268264_104744763 | 147 |
| 307 | 3300031711 | Ga0265314_10010506 | Ga0265314_100105066 | 147 |
| 308 | 3300035691 | Ga0373931_0113595 | Ga0373931_0113595_705_1154 | 147 |
| 309 | 3300041407 | Ga0439447_095227 | Ga0439447_095227_210_656 | 147 |
| 310 | 3300041443 | Ga0451789_1201068 | Ga0451789_1201068_50_493 | 147 |
| 311 | 3300041486 | Ga0451807_1205355 | Ga0451807_1205355_54_500 | 147 |
| 312 | 3300041997 | Ga0439431_0062457 | Ga0439431_0062457_154_600 | 147 |
| 313 | 3300042156 | Ga0439446_0004412 | Ga0439446_0004412_3054_3500 | 147 |
| 314 | 3300042435 | Ga0439434_0006231 | Ga0439434_0006231_17_463 | 147 |
| 315 | 3300042435 | Ga0439434_0087775 | Ga0439434_0087775_18_464 | 147 |
| 316 | 3300046455 | Ga0495603_0328555 | Ga0495603_0328555_49_498 | 147 |
| 317 | 3300046499 | Ga0495594_0438299 | Ga0495594_0438299_19_468 | 147 |
| 318 | 3300046519 | Ga0495632_0185622 | Ga0495632_0185622_477_926 | 147 |
| 319 | 3300046535 | Ga0495586_0638191 | Ga0495586_0638191_132_581 | 147 |
| 320 | 3300046794 | Ga0495589_0577996 | Ga0495589_0577996_14_460 | 147 |
| 321 | 3300047319 | Ga0495674_0296256 | Ga0495674_0296256_295_744 | 147 |
| 322 | 3300047320 | Ga0495672_0303679 | Ga0495672_0303679_132_578 | 147 |
| 323 | 3300048906 | Ga0496103_0780713 | Ga0496103_0780713_147_590 | 147 |
| 324 | 3300048911 | Ga0496108_0533584 | Ga0496108_0533584_393_839 | 147 |
| 325 | 3300048912 | Ga0496109_0592087 | Ga0496109_0592087_403_852 | 147 |
| 326 | 3300048914 | Ga0496111_0363689 | Ga0496111_0363689_81_530 | 147 |
| 327 | 3300048915 | Ga0496112_0045127 | Ga0496112_0045127_3783_4232 | 147 |
| 328 | 3300048915 | Ga0496112_0296353 | Ga0496112_0296353_95_541 | 147 |
| 329 | 3300048916 | Ga0496113_0779293 | Ga0496113_0779293_70_519 | 147 |
| 330 | 3300048929 | Ga0496126_0032668 | Ga0496126_0032668_1554_1997 | 147 |
| 331 | 3300048929 | Ga0496126_0394996 | Ga0496126_0394996_198_641 | 147 |
| 332 | 3300049568 | Ga0501031_0138261 | Ga0501031_0138261_380_823 | 147 |
| 333 | 3300049568 | Ga0501031_0992613 | Ga0501031_0992613_67_513 | 147 |
| 334 | 3300049575 | Ga0501039_0251282 | Ga0501039_0251282_386_832 | 147 |
| 335 | 3300049576 | Ga0501040_0557804 | Ga0501040_0557804_96_539 | 147 |
| 336 | 3300049577 | Ga0501041_0013271 | Ga0501041_0013271_828_1274 | 147 |
| 337 | 3300049584 | Ga0501068_0314364 | Ga0501068_0314364_357_800 | 147 |
| 338 | 3300049584 | Ga0501068_0883067 | Ga0501068_0883067_29_571 | 147 |
| 339 | 3300049587 | Ga0501071_0231868 | Ga0501071_0231868_271_714 | 147 |
| 340 | 3300049743 | Ga0501081_0005916 | Ga0501081_0005916_4289_4735 | 147 |
| 341 | 3300049824 | Ga0501045_0312207 | Ga0501045_0312207_18_464 | 147 |
| 342 | 3300050492 | nmdc:mga0yw44_285738_c1 | nmdc:mga0yw44_285738_c1_119_562 | 147 |
| 343 | 3300050509 | nmdc:mga0qj67_333042_c1 | nmdc:mga0qj67_333042_c1_110_556 | 147 |
| 344 | 3300050511 | nmdc:mga08y16_250335_c1 | nmdc:mga08y16_250335_c1_60_506 | 147 |
| 345 | 3300050511 | nmdc:mga08y16_8483_c1 | nmdc:mga08y16_8483_c1_8983_9429 | 147 |
| 346 | 3300050513 | nmdc:mga0rr50_1227653_c1 | nmdc:mga0rr50_1227653_c1_143_589 | 147 |
| 347 | 3300053077 | Ga0495601_0104602 | Ga0495601_0104602_971_1420 | 147 |
| 348 | 3300053118 | Ga0500594_0087829 | Ga0500594_0087829_36_485 | 147 |
| 349 | 3300053142 | Ga0500577_0433203 | Ga0500577_0433203_68_514 | 147 |
| 350 | 3300054114 | Ga0501084_1354069 | Ga0501084_1354069_96_542 | 147 |
| 351 | 3300061734 | Ga0530510_0443267 | Ga0530510_0443267_102_545 | 147 |
| 352 | 3300005458 | Ga0070681_10021867 | Ga0070681_100218676 | 149 |
| 353 | 3300005530 | Ga0070679_100152313 | Ga0070679_1001523132 | 149 |
| 354 | 3300025921 | Ga0207652_10534742 | Ga0207652_105347422 | 149 |
| 355 | 3300005327 | Ga0070658_10072099 | Ga0070658_100720992 | 150 |
| 356 | 3300005328 | Ga0070676_10349333 | Ga0070676_103493332 | 150 |
| 357 | 3300005331 | Ga0070670_100308088 | Ga0070670_1003080882 | 150 |
| 358 | 3300005331 | Ga0070670_100351371 | Ga0070670_1003513712 | 150 |
| 359 | 3300005333 | Ga0070677_10125813 | Ga0070677_101258133 | 150 |
| 360 | 3300005334 | Ga0068869_100410278 | Ga0068869_1004102781 | 150 |
| 361 | 3300005335 | Ga0070666_10070759 | Ga0070666_100707592 | 150 |
| 362 | 3300005336 | Ga0070680_101156773 | Ga0070680_1011567731 | 150 |
| 363 | 3300005338 | Ga0068868_100031398 | Ga0068868_1000313983 | 150 |
| 364 | 3300005347 | Ga0070668_100236313 | Ga0070668_1002363132 | 150 |
| 365 | 3300005347 | Ga0070668_101123846 | Ga0070668_1011238461 | 150 |
| 366 | 3300005353 | Ga0070669_100034347 | Ga0070669_1000343472 | 150 |
| 367 | 3300005355 | Ga0070671_100538918 | Ga0070671_1005389182 | 150 |
| 368 | 3300005356 | Ga0070674_100467705 | Ga0070674_1004677052 | 150 |
| 369 | 3300005356 | Ga0070674_100811773 | Ga0070674_1008117732 | 150 |
| 370 | 3300005364 | Ga0070673_101127251 | Ga0070673_1011272511 | 150 |
| 371 | 3300005366 | Ga0070659_100855559 | Ga0070659_1008555591 | 150 |
| 372 | 3300005367 | Ga0070667_100375237 | Ga0070667_1003752371 | 150 |
| 373 | 3300005367 | Ga0070667_100620757 | Ga0070667_1006207571 | 150 |
| 374 | 3300005456 | Ga0070678_100108230 | Ga0070678_1001082302 | 150 |
| 375 | 3300005459 | Ga0068867_100383634 | Ga0068867_1003836343 | 150 |
| 376 | 3300005466 | Ga0070685_10631159 | Ga0070685_106311591 | 150 |
| 377 | 3300005548 | Ga0070665_100013296 | Ga0070665_1000132963 | 150 |
| 378 | 3300005617 | Ga0068859_100928486 | Ga0068859_1009284861 | 150 |
| 379 | 3300005840 | Ga0068870_10040692 | Ga0068870_100406922 | 150 |
| 380 | 3300006358 | Ga0068871_100845186 | Ga0068871_1008451861 | 150 |
| 381 | 3300006881 | Ga0068865_100430313 | Ga0068865_1004303132 | 150 |
| 382 | 3300006931 | Ga0097620_100928574 | Ga0097620_1009285741 | 150 |
| 383 | 3300013297 | Ga0157378_10466819 | Ga0157378_104668192 | 150 |
| 384 | 3300025315 | Ga0207697_10223339 | Ga0207697_102233392 | 150 |
| 385 | 3300025893 | Ga0207682_10040929 | Ga0207682_100409292 | 150 |
| 386 | 3300025903 | Ga0207680_10046779 | Ga0207680_100467792 | 150 |
| 387 | 3300025907 | Ga0207645_10523367 | Ga0207645_105233672 | 150 |
| 388 | 3300025908 | Ga0207643_10042285 | Ga0207643_100422852 | 150 |
| 389 | 3300025908 | Ga0207643_10314761 | Ga0207643_103147612 | 150 |
| 390 | 3300025909 | Ga0207705_10098936 | Ga0207705_100989361 | 150 |
| 391 | 3300025923 | Ga0207681_10374114 | Ga0207681_103741141 | 150 |
| 392 | 3300025923 | Ga0207681_10417328 | Ga0207681_104173282 | 150 |
| 393 | 3300025925 | Ga0207650_10356570 | Ga0207650_103565702 | 150 |
| 394 | 3300025925 | Ga0207650_10916414 | Ga0207650_109164141 | 150 |
| 395 | 3300025932 | Ga0207690_11227615 | Ga0207690_112276151 | 150 |
| 396 | 3300025933 | Ga0207706_10519254 | Ga0207706_105192542 | 150 |
| 397 | 3300025937 | Ga0207669_10861512 | Ga0207669_108615122 | 150 |
| 398 | 3300025942 | Ga0207689_10047332 | Ga0207689_100473322 | 150 |
| 399 | 3300025972 | Ga0207668_10073171 | Ga0207668_100731715 | 150 |
| 400 | 3300025972 | Ga0207668_10267265 | Ga0207668_102672653 | 150 |
| 401 | 3300025986 | Ga0207658_10216849 | Ga0207658_102168492 | 150 |
| 402 | 3300026023 | Ga0207677_10075709 | Ga0207677_100757092 | 150 |
| 403 | 3300026089 | Ga0207648_10207504 | Ga0207648_102075041 | 150 |
| 404 | 3300026121 | Ga0207683_10047124 | Ga0207683_100471243 | 150 |
| 405 | 3300046524 | Ga0495648_0302270 | Ga0495648_0302270_230_682 | 150 |
| 406 | 3300046692 | Ga0495671_0465229 | Ga0495671_0465229_34_486 | 150 |
| 407 | 3300004801 | Ga0058860_11875516 | Ga0058860_118755161 | 151 |
| 408 | 3300005295 | Ga0065707_10090976 | Ga0065707_100909763 | 151 |
| 409 | 3300005295 | Ga0065707_10331271 | Ga0065707_103312712 | 151 |
| 410 | 3300005330 | Ga0070690_100039548 | Ga0070690_1000395483 | 151 |
| 411 | 3300005330 | Ga0070690_100366280 | Ga0070690_1003662801 | 151 |
| 412 | 3300005331 | Ga0070670_100192877 | Ga0070670_1001928773 | 151 |
| 413 | 3300005334 | Ga0068869_100072425 | Ga0068869_1000724254 | 151 |
| 414 | 3300005334 | Ga0068869_101351273 | Ga0068869_1013512731 | 151 |
| 415 | 3300005336 | Ga0070680_100097398 | Ga0070680_1000973983 | 151 |
| 416 | 3300005338 | Ga0068868_100015816 | Ga0068868_1000158165 | 151 |
| 417 | 3300005340 | Ga0070689_100476496 | Ga0070689_1004764962 | 151 |
| 418 | 3300005340 | Ga0070689_100498655 | Ga0070689_1004986552 | 151 |
| 419 | 3300005340 | Ga0070689_101810445 | Ga0070689_1018104451 | 151 |
| 420 | 3300005343 | Ga0070687_100130827 | Ga0070687_1001308272 | 151 |
| 421 | 3300005353 | Ga0070669_100180654 | Ga0070669_1001806542 | 151 |
| 422 | 3300005354 | Ga0070675_100261465 | Ga0070675_1002614651 | 151 |
| 423 | 3300005355 | Ga0070671_100507392 | Ga0070671_1005073921 | 151 |
| 424 | 3300005365 | Ga0070688_100351667 | Ga0070688_1003516672 | 151 |
| 425 | 3300005365 | Ga0070688_100370142 | Ga0070688_1003701421 | 151 |
| 426 | 3300005365 | Ga0070688_100619758 | Ga0070688_1006197582 | 151 |
| 427 | 3300005367 | Ga0070667_100000705 | Ga0070667_1000007055 | 151 |
| 428 | 3300005367 | Ga0070667_100058393 | Ga0070667_1000583934 | 151 |
| 429 | 3300005367 | Ga0070667_100202502 | Ga0070667_1002025022 | 151 |
| 430 | 3300005406 | Ga0070703_10170993 | Ga0070703_101709932 | 151 |
| 431 | 3300005434 | Ga0070709_10616377 | Ga0070709_106163771 | 151 |
| 432 | 3300005436 | Ga0070713_100496585 | Ga0070713_1004965852 | 151 |
| 433 | 3300005438 | Ga0070701_10627189 | Ga0070701_106271891 | 151 |
| 434 | 3300005440 | Ga0070705_100001468 | Ga0070705_1000014682 | 151 |
| 435 | 3300005444 | Ga0070694_100117665 | Ga0070694_1001176651 | 151 |
| 436 | 3300005445 | Ga0070708_101191909 | Ga0070708_1011919091 | 151 |
| 437 | 3300005456 | Ga0070678_101597729 | Ga0070678_1015977291 | 151 |
| 438 | 3300005459 | Ga0068867_100079121 | Ga0068867_1000791213 | 151 |
| 439 | 3300005466 | Ga0070685_10146062 | Ga0070685_101460623 | 151 |
| 440 | 3300005466 | Ga0070685_10210822 | Ga0070685_102108222 | 151 |
| 441 | 3300005471 | Ga0070698_100698027 | Ga0070698_1006980271 | 151 |
| 442 | 3300005543 | Ga0070672_100210060 | Ga0070672_1002100601 | 151 |
| 443 | 3300005544 | Ga0070686_100001557 | Ga0070686_1000015572 | 151 |
| 444 | 3300005547 | Ga0070693_100000154 | Ga0070693_10000015431 | 151 |
| 445 | 3300005548 | Ga0070665_100086099 | Ga0070665_1000860992 | 151 |
| 446 | 3300005548 | Ga0070665_100087623 | Ga0070665_1000876232 | 151 |
| 447 | 3300005548 | Ga0070665_101361525 | Ga0070665_1013615252 | 151 |
| 448 | 3300005578 | Ga0068854_100677911 | Ga0068854_1006779112 | 151 |
| 449 | 3300005614 | Ga0068856_100995013 | Ga0068856_1009950132 | 151 |
| 450 | 3300005617 | Ga0068859_100029793 | Ga0068859_1000297932 | 151 |
| 451 | 3300005618 | Ga0068864_100030734 | Ga0068864_1000307348 | 151 |
| 452 | 3300005618 | Ga0068864_100088604 | Ga0068864_1000886042 | 151 |
| 453 | 3300005618 | Ga0068864_100484425 | Ga0068864_1004844252 | 151 |
| 454 | 3300005719 | Ga0068861_100007761 | Ga0068861_1000077619 | 151 |
| 455 | 3300005719 | Ga0068861_100214265 | Ga0068861_1002142652 | 151 |
| 456 | 3300005719 | Ga0068861_100493972 | Ga0068861_1004939722 | 151 |
| 457 | 3300005719 | Ga0068861_100586770 | Ga0068861_1005867703 | 151 |
| 458 | 3300005841 | Ga0068863_100318244 | Ga0068863_1003182442 | 151 |
| 459 | 3300005841 | Ga0068863_100698865 | Ga0068863_1006988652 | 151 |
| 460 | 3300005843 | Ga0068860_100036269 | Ga0068860_1000362694 | 151 |
| 461 | 3300005843 | Ga0068860_100092574 | Ga0068860_1000925744 | 151 |
| 462 | 3300005843 | Ga0068860_100097921 | Ga0068860_1000979214 | 151 |
| 463 | 3300005843 | Ga0068860_100117711 | Ga0068860_1001177112 | 151 |
| 464 | 3300005843 | Ga0068860_101813949 | Ga0068860_1018139491 | 151 |
| 465 | 3300005844 | Ga0068862_100025306 | Ga0068862_1000253063 | 151 |
| 466 | 3300005844 | Ga0068862_100029031 | Ga0068862_1000290314 | 151 |
| 467 | 3300005844 | Ga0068862_100929455 | Ga0068862_1009294551 | 151 |
| 468 | 3300005937 | Ga0081455_10003566 | Ga0081455_1000356612 | 151 |
| 469 | 3300005981 | Ga0081538_10214563 | Ga0081538_102145632 | 151 |
| 470 | 3300006177 | Ga0075362_10147263 | Ga0075362_101472632 | 151 |
| 471 | 3300006195 | Ga0075366_10032569 | Ga0075366_100325693 | 151 |
| 472 | 3300006195 | Ga0075366_10066613 | Ga0075366_100666135 | 151 |
| 473 | 3300006195 | Ga0075366_10133477 | Ga0075366_101334772 | 151 |
| 474 | 3300006195 | Ga0075366_10309548 | Ga0075366_103095482 | 151 |
| 475 | 3300006237 | Ga0097621_100389633 | Ga0097621_1003896332 | 151 |
| 476 | 3300006237 | Ga0097621_100801449 | Ga0097621_1008014492 | 151 |
| 477 | 3300006237 | Ga0097621_101251010 | Ga0097621_1012510101 | 151 |
| 478 | 3300006358 | Ga0068871_100012374 | Ga0068871_1000123741 | 151 |
| 479 | 3300006844 | Ga0075428_100449169 | Ga0075428_1004491693 | 151 |
| 480 | 3300006846 | Ga0075430_100042137 | Ga0075430_1000421372 | 151 |
| 481 | 3300006847 | Ga0075431_100025017 | Ga0075431_1000250175 | 151 |
| 482 | 3300006847 | Ga0075431_100598223 | Ga0075431_1005982232 | 151 |
| 483 | 3300006871 | Ga0075434_100242236 | Ga0075434_1002422362 | 151 |
| 484 | 3300006871 | Ga0075434_101110719 | Ga0075434_1011107192 | 151 |
| 485 | 3300006880 | Ga0075429_100000076 | Ga0075429_10000007629 | 151 |
| 486 | 3300006881 | Ga0068865_100038500 | Ga0068865_1000385003 | 151 |
| 487 | 3300006914 | Ga0075436_100039815 | Ga0075436_1000398153 | 151 |
| 488 | 3300006931 | Ga0097620_100029793 | Ga0097620_10002979310 | 151 |
| 489 | 3300007076 | Ga0075435_100389057 | Ga0075435_1003890572 | 151 |
| 490 | 3300007265 | Ga0099794_10132115 | Ga0099794_101321151 | 151 |
| 491 | 3300009094 | Ga0111539_10025280 | Ga0111539_100252807 | 151 |
| 492 | 3300009098 | Ga0105245_10085271 | Ga0105245_100852712 | 151 |
| 493 | 3300009098 | Ga0105245_10961592 | Ga0105245_109615921 | 151 |
| 494 | 3300009101 | Ga0105247_10160954 | Ga0105247_101609543 | 151 |
| 495 | 3300009147 | Ga0114129_10000791 | Ga0114129_1000079118 | 151 |
| 496 | 3300009147 | Ga0114129_11280053 | Ga0114129_112800532 | 151 |
| 497 | 3300009174 | Ga0105241_10414356 | Ga0105241_104143562 | 151 |
| 498 | 3300009174 | Ga0105241_11163091 | Ga0105241_111630912 | 151 |
| 499 | 3300009176 | Ga0105242_10351324 | Ga0105242_103513242 | 151 |
| 500 | 3300009177 | Ga0105248_10175010 | Ga0105248_101750102 | 151 |
| 501 | 3300009553 | Ga0105249_10008874 | Ga0105249_100088742 | 151 |
| 502 | 3300009553 | Ga0105249_10744092 | Ga0105249_107440922 | 151 |
| 503 | 3300011119 | Ga0105246_10063131 | Ga0105246_100631311 | 151 |
| 504 | 3300011119 | Ga0105246_10569373 | Ga0105246_105693731 | 151 |
| 505 | 3300011119 | Ga0105246_10695237 | Ga0105246_106952372 | 151 |
| 506 | 3300013296 | Ga0157374_11019606 | Ga0157374_110196061 | 151 |
| 507 | 3300013297 | Ga0157378_10618782 | Ga0157378_106187821 | 151 |
| 508 | 3300013297 | Ga0157378_10822855 | Ga0157378_108228552 | 151 |
| 509 | 3300013306 | Ga0163162_10911324 | Ga0163162_109113242 | 151 |
| 510 | 3300013308 | Ga0157375_10163655 | Ga0157375_101636552 | 151 |
| 511 | 3300013308 | Ga0157375_10485389 | Ga0157375_104853893 | 151 |
| 512 | 3300013308 | Ga0157375_11221852 | Ga0157375_112218522 | 151 |
| 513 | 3300014325 | Ga0163163_10131646 | Ga0163163_101316463 | 151 |
| 514 | 3300014325 | Ga0163163_11451241 | Ga0163163_114512411 | 151 |
| 515 | 3300014745 | Ga0157377_10783861 | Ga0157377_107838612 | 151 |
| 516 | 3300014968 | Ga0157379_10095627 | Ga0157379_100956273 | 151 |
| 517 | 3300017792 | Ga0163161_10171856 | Ga0163161_101718561 | 151 |
| 518 | 3300025900 | Ga0207710_10309870 | Ga0207710_103098701 | 151 |
| 519 | 3300025908 | Ga0207643_10323565 | Ga0207643_103235651 | 151 |
| 520 | 3300025911 | Ga0207654_10175597 | Ga0207654_101755973 | 151 |
| 521 | 3300025912 | Ga0207707_10482201 | Ga0207707_104822012 | 151 |
| 522 | 3300025917 | Ga0207660_10033166 | Ga0207660_100331662 | 151 |
| 523 | 3300025918 | Ga0207662_10002400 | Ga0207662_100024003 | 151 |
| 524 | 3300025923 | Ga0207681_10159817 | Ga0207681_101598172 | 151 |
| 525 | 3300025925 | Ga0207650_10064780 | Ga0207650_100647802 | 151 |
| 526 | 3300025925 | Ga0207650_11537059 | Ga0207650_115370591 | 151 |
| 527 | 3300025926 | Ga0207659_10375608 | Ga0207659_103756082 | 151 |
| 528 | 3300025927 | Ga0207687_10025347 | Ga0207687_100253473 | 151 |
| 529 | 3300025934 | Ga0207686_10157330 | Ga0207686_101573302 | 151 |
| 530 | 3300025935 | Ga0207709_10195651 | Ga0207709_101956512 | 151 |
| 531 | 3300025936 | Ga0207670_10081397 | Ga0207670_100813971 | 151 |
| 532 | 3300025938 | Ga0207704_10952375 | Ga0207704_109523752 | 151 |
| 533 | 3300025941 | Ga0207711_10430231 | Ga0207711_104302312 | 151 |
| 534 | 3300025941 | Ga0207711_11547052 | Ga0207711_115470522 | 151 |
| 535 | 3300025942 | Ga0207689_10002939 | Ga0207689_100029393 | 151 |
| 536 | 3300025942 | Ga0207689_10006916 | Ga0207689_100069165 | 151 |
| 537 | 3300025942 | Ga0207689_10078731 | Ga0207689_100787316 | 151 |
| 538 | 3300025942 | Ga0207689_10138580 | Ga0207689_101385801 | 151 |
| 539 | 3300025942 | Ga0207689_11052702 | Ga0207689_110527022 | 151 |
| 540 | 3300025945 | Ga0207679_11703771 | Ga0207679_117037711 | 151 |
| 541 | 3300025949 | Ga0207667_10295439 | Ga0207667_102954392 | 151 |
| 542 | 3300025961 | Ga0207712_10003403 | Ga0207712_1000340312 | 151 |
| 543 | 3300025972 | Ga0207668_10006919 | Ga0207668_100069194 | 151 |
| 544 | 3300025981 | Ga0207640_10515949 | Ga0207640_105159492 | 151 |
| 545 | 3300025986 | Ga0207658_10118596 | Ga0207658_101185962 | 151 |
| 546 | 3300026023 | Ga0207677_10140638 | Ga0207677_101406383 | 151 |
| 547 | 3300026075 | Ga0207708_10115229 | Ga0207708_101152292 | 151 |
| 548 | 3300026078 | Ga0207702_10403491 | Ga0207702_104034912 | 151 |
| 549 | 3300026088 | Ga0207641_10425048 | Ga0207641_104250481 | 151 |
| 550 | 3300026088 | Ga0207641_10548127 | Ga0207641_105481272 | 151 |
| 551 | 3300026089 | Ga0207648_10648241 | Ga0207648_106482411 | 151 |
| 552 | 3300026089 | Ga0207648_11525321 | Ga0207648_115253212 | 151 |
| 553 | 3300026095 | Ga0207676_10124318 | Ga0207676_101243183 | 151 |
| 554 | 3300026095 | Ga0207676_10783259 | Ga0207676_107832592 | 151 |
| 555 | 3300026116 | Ga0207674_10355646 | Ga0207674_103556461 | 151 |
| 556 | 3300026118 | Ga0207675_100112684 | Ga0207675_1001126842 | 151 |
| 557 | 3300026118 | Ga0207675_100315242 | Ga0207675_1003152422 | 151 |
| 558 | 3300026121 | Ga0207683_11526289 | Ga0207683_115262891 | 151 |
| 559 | 3300026121 | Ga0207683_11785781 | Ga0207683_117857811 | 151 |
| 560 | 3300027907 | Ga0207428_10008419 | Ga0207428_100084199 | 151 |
| 561 | 3300028036 | Ga0265355_1001558 | Ga0265355_10015582 | 151 |
| 562 | 3300028379 | Ga0268266_10054887 | Ga0268266_100548872 | 151 |
| 563 | 3300028379 | Ga0268266_10920252 | Ga0268266_109202521 | 151 |
| 564 | 3300028380 | Ga0268265_10883977 | Ga0268265_108839771 | 151 |
| 565 | 3300028381 | Ga0268264_10005460 | Ga0268264_100054606 | 151 |
| 566 | 3300028381 | Ga0268264_11457173 | Ga0268264_114571731 | 151 |
| 567 | 3300028786 | Ga0307517_10210001 | Ga0307517_102100013 | 151 |
| 568 | 3300031456 | Ga0307513_10001365 | Ga0307513_1000136517 | 151 |
| 569 | 3300031456 | Ga0307513_10004600 | Ga0307513_1000460011 | 151 |
| 570 | 3300031456 | Ga0307513_10032379 | Ga0307513_100323797 | 151 |
| 571 | 3300031456 | Ga0307513_10293538 | Ga0307513_102935383 | 151 |
| 572 | 3300031852 | Ga0307410_10285553 | Ga0307410_102855533 | 151 |
| 573 | 3300032005 | Ga0307411_11799298 | Ga0307411_117992981 | 151 |
| 574 | 3300034820 | Ga0373959_0042380 | Ga0373959_0042380_433_945 | 151 |
| 575 | 3300035084 | Ga0373928_0001224 | Ga0373928_0001224_1945_2457 | 151 |
| 576 | 3300035090 | Ga0373949_0125357 | Ga0373949_0125357_57_512 | 151 |
| 577 | 3300035115 | Ga0373941_0017811 | Ga0373941_0017811_278_790 | 151 |
| 578 | 3300035171 | Ga0373946_0736420 | Ga0373946_0736420_29_484 | 151 |
| 579 | 3300035172 | Ga0373955_0230059 | Ga0373955_0230059_574_1035 | 151 |
| 580 | 3300035207 | Ga0373942_0161513 | Ga0373942_0161513_116_628 | 151 |
| 581 | 3300035241 | Ga0373961_0194864 | Ga0373961_0194864_184_699 | 151 |
| 582 | 3300035691 | Ga0373931_0000382 | Ga0373931_0000382_12057_12569 | 151 |
| 583 | 3300036401 | Ga0373937_0304242 | Ga0373937_0304242_443_940 | 151 |
| 584 | 3300036401 | Ga0373937_0481356 | Ga0373937_0481356_531_992 | 151 |
| 585 | 3300037068 | Ga0373925_0049515 | Ga0373925_0049515_443_940 | 151 |
| 586 | 3300037068 | Ga0373925_0064958 | Ga0373925_0064958_179_634 | 151 |
| 587 | 3300041443 | Ga0451789_1005102 | Ga0451789_1005102_28_483 | 151 |
| 588 | 3300041456 | Ga0451795_0648233 | Ga0451795_0648233_292_747 | 151 |
| 589 | 3300041458 | Ga0451798_1144670 | Ga0451798_1144670_321_776 | 151 |
| 590 | 3300041459 | Ga0451800_0426012 | Ga0451800_0426012_94_549 | 151 |
| 591 | 3300041486 | Ga0451807_0537413 | Ga0451807_0537413_824_1279 | 151 |
| 592 | 3300042876 | Ga0451577_0026851 | Ga0451577_0026851_602_1057 | 151 |
| 593 | 3300045051 | Ga0451576_0007110 | Ga0451576_0007110_8538_8993 | 151 |
| 594 | 3300045051 | Ga0451576_0015697 | Ga0451576_0015697_318_830 | 151 |
| 595 | 3300046472 | Ga0495580_0245568 | Ga0495580_0245568_560_1072 | 151 |
| 596 | 3300046473 | Ga0495582_0477575 | Ga0495582_0477575_187_642 | 151 |
| 597 | 3300046517 | Ga0495630_0340550 | Ga0495630_0340550_550_1047 | 151 |
| 598 | 3300046524 | Ga0495648_0231524 | Ga0495648_0231524_172_627 | 151 |
| 599 | 3300046543 | Ga0495645_0189097 | Ga0495645_0189097_248_745 | 151 |
| 600 | 3300046559 | Ga0495667_0483446 | Ga0495667_0483446_118_573 | 151 |
| 601 | 3300046616 | Ga0495668_0053018 | Ga0495668_0053018_759_1214 | 151 |
| 602 | 3300046679 | Ga0495623_0204113 | Ga0495623_0204113_404_901 | 151 |
| 603 | 3300046683 | Ga0495658_0073987 | Ga0495658_0073987_498_995 | 151 |
| 604 | 3300046690 | Ga0495624_0035461 | Ga0495624_0035461_1389_1844 | 151 |
| 605 | 3300047317 | Ga0495604_0128175 | Ga0495604_0128175_445_942 | 151 |
| 606 | 3300047317 | Ga0495604_0227794 | Ga0495604_0227794_252_707 | 151 |
| 607 | 3300047319 | Ga0495674_0980772 | Ga0495674_0980772_18_473 | 151 |
| 608 | 3300047320 | Ga0495672_0535778 | Ga0495672_0535778_15_470 | 151 |
| 609 | 3300048912 | Ga0496109_0802904 | Ga0496109_0802904_211_708 | 151 |
| 610 | 3300048919 | Ga0496116_0261467 | Ga0496116_0261467_295_762 | 151 |
| 611 | 3300049589 | Ga0501073_0022360 | Ga0501073_0022360_2916_3371 | 151 |
| 612 | 3300049669 | Ga0501235_078221 | Ga0501235_078221_152_700 | 151 |
| 613 | 3300050493 | nmdc:mga0k408_113632_c1 | nmdc:mga0k408_113632_c1_761_1222 | 151 |
| 614 | 3300050493 | nmdc:mga0k408_392658_c1 | nmdc:mga0k408_392658_c1_43_498 | 151 |
| 615 | 3300050493 | nmdc:mga0k408_71882_c1 | nmdc:mga0k408_71882_c1_292_798 | 151 |
| 616 | 3300050507 | nmdc:mga05p37_72_c1 | nmdc:mga05p37_72_c1_39926_40381 | 151 |
| 617 | 3300050508 | nmdc:mga09592_23529_c1 | nmdc:mga09592_23529_c1_3053_3508 | 151 |
| 618 | 3300050510 | nmdc:mga06r32_184499_c1 | nmdc:mga06r32_184499_c1_657_1112 | 151 |
| 619 | 3300050511 | nmdc:mga08y16_1292_c1 | nmdc:mga08y16_1292_c1_9386_9841 | 151 |
| 620 | 3300050511 | nmdc:mga08y16_530695_c1 | nmdc:mga08y16_530695_c1_431_943 | 151 |
| 621 | 3300050511 | nmdc:mga08y16_64970_c1 | nmdc:mga08y16_64970_c1_2405_2860 | 151 |
| 622 | 3300050512 | nmdc:mga0n895_340253_c1 | nmdc:mga0n895_340253_c1_347_802 | 151 |
| 623 | 3300050514 | nmdc:mga08x19_64236_c1 | nmdc:mga08x19_64236_c1_1529_1984 | 151 |
| 624 | 3300050515 | nmdc:mga0a205_37767_c1 | nmdc:mga0a205_37767_c1_374_829 | 151 |
| 625 | 3300050515 | nmdc:mga0a205_441482_c1 | nmdc:mga0a205_441482_c1_478_933 | 151 |
| 626 | 3300053084 | Ga0495595_0352805 | Ga0495595_0352805_117_572 | 151 |
| 627 | 3300053118 | Ga0500594_0261915 | Ga0500594_0261915_110_565 | 151 |
| 628 | 3300053136 | Ga0500559_0134133 | Ga0500559_0134133_77_532 | 151 |
| 629 | 3300005353 | Ga0070669_100006719 | Ga0070669_1000067195 | 152 |
| 630 | 3300005364 | Ga0070673_101657902 | Ga0070673_1016579021 | 152 |
| 631 | 3300005535 | Ga0070684_100033562 | Ga0070684_1000335623 | 152 |
| 632 | 3300005548 | Ga0070665_100137823 | Ga0070665_1001378232 | 152 |
| 633 | 3300007076 | Ga0075435_100020986 | Ga0075435_1000209867 | 152 |
| 634 | 3300013297 | Ga0157378_10344261 | Ga0157378_103442612 | 152 |
| 635 | 3300025923 | Ga0207681_10004367 | Ga0207681_100043676 | 152 |
| 636 | 3300028379 | Ga0268266_10058537 | Ga0268266_100585373 | 152 |
| 637 | 3300031852 | Ga0307410_10029993 | Ga0307410_100299932 | 152 |
| 638 | 3300031889 | Ga0326468_10020064 | Ga0326468_100200642 | 152 |
| 639 | 3300031995 | Ga0307409_100048855 | Ga0307409_1000488553 | 152 |
| 640 | 3300032005 | Ga0307411_10349806 | Ga0307411_103498062 | 152 |
| 641 | 3300037471 | Ga0395905_0002016 | Ga0395905_0002016_7289_7747 | 152 |
| 642 | 3300041486 | Ga0451807_1355410 | Ga0451807_1355410_206_667 | 152 |
| 643 | 3300042876 | Ga0451577_0312875 | Ga0451577_0312875_39_497 | 152 |
| 644 | 3300044712 | Ga0453684_0219397 | Ga0453684_0219397_1233_1691 | 152 |
| 645 | 3300045051 | Ga0451576_0448232 | Ga0451576_0448232_517_975 | 152 |
| 646 | 3300049573 | Ga0501037_0068760 | Ga0501037_0068760_926_1384 | 152 |
| 647 | 3300049576 | Ga0501040_0194379 | Ga0501040_0194379_10_468 | 152 |
| 648 | 3300049584 | Ga0501068_0081875 | Ga0501068_0081875_1178_1636 | 152 |
| 649 | 3300049587 | Ga0501071_0001799 | Ga0501071_0001799_1265_1723 | 152 |
| 650 | 3300049588 | Ga0501072_0020170 | Ga0501072_0020170_3277_3735 | 152 |
| 651 | 3300049589 | Ga0501073_0121275 | Ga0501073_0121275_1181_1639 | 152 |
| 652 | 3300049591 | Ga0501075_0304999 | Ga0501075_0304999_376_834 | 152 |
| 653 | 3300049592 | Ga0501076_0032218 | Ga0501076_0032218_3059_3517 | 152 |
| 654 | 3300049741 | Ga0501079_0104599 | Ga0501079_0104599_857_1315 | 152 |
| 655 | 3300049742 | Ga0501080_0008180 | Ga0501080_0008180_8441_8899 | 152 |
| 656 | 3300049743 | Ga0501081_0131965 | Ga0501081_0131965_1249_1707 | 152 |
| 657 | 3300050513 | nmdc:mga0rr50_84234_c1 | nmdc:mga0rr50_84234_c1_1616_2074 | 152 |
| 658 | 3300060353 | Ga0501082_0435927 | Ga0501082_0435927_315_773 | 152 |
| 659 | 3300003316 | rootH1_10028062 | rootH1_100280621 | 153 |
| 660 | 3300003322 | rootL2_10095498 | rootL2_100954982 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2m89-assembly1.cif.gz_B | solution structure of the aha1 dimer from colwellia psychrerythraea | 0.9028 | 1 | 140 |
| 2m89-assembly1.cif.gz_B | solution structure of the aha1 dimer from colwellia psychrerythraea | 0.8965 | 1 | 140 |
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.8635 | 3 | 140 |
| 3q6a-assembly1.cif.gz_A | x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 | 0.8592 | 2 | 140 |
| 4fpw-assembly3.cif.gz_B | crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. | 0.8541 | 3 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9028 | 1 | 140 | 3.30.530.20 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8965 | 1 | 140 | 3.30.530.20 |
| 4f6aA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.848 | 44 | 67 | 3.40.630.30 |
| 3q6aA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8478 | 4 | 140 | 3.30.530.20 |
| 2luzA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.825 | 3 | 144 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537IEZ4-F1-model_v4 | SRPBCC domain-containing protein | 0.9966 | 1 | 153 |
|
| AF-A0A519VL08-F1-model_v4 | SRPBCC domain-containing protein | 0.9933 | 1 | 153 |
|
| AF-A0A537IEZ4-F1-model_v4 | SRPBCC domain-containing protein | 0.9901 | 1 | 153 |
|
| AF-A0A519VL08-F1-model_v4 | SRPBCC domain-containing protein | 0.9869 | 1 | 153 |
|
| AF-A0A4R9GQP1-F1-model_v4 | SRPBCC domain-containing protein | 0.9832 | 1 | 151 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar