F473366

General Info

Members Datasets Scaffolds Average Seq Length
660 333 628 150

Family's Representative Sequence

Representative Sequence 3300049669|Ga0501235_078221|Ga0501235_078221_152_700
Length 182
Sequence MLVTHSLGGFAPRLSARRKTSRSNKSRRRNIMVDILHRVGIKAPLEKVYQALATREGVAGWWTTDTQGESKVGGMLKTLFTVDGKLLGGFDLEVLALEPKKRVLWQVVEGPPEWIGTKIGFELRQEGEYSIVLFKHEGWKEPVEFMHHCSTKWAIYLMSLKSLVETGQGQPTPNDVAIGDFH

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
3 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
6 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
7 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
8 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
9 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
10 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
11 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
12 2858882152 Micromonospora noduli MED15 Isolate Nodule
13 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
14 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
17 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
18 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
19 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
20 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
21 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
22 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
23 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
24 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
25 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
26 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
27 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
28 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
29 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
190 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
195 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
226 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
229 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
327 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
331 8002775197 Frankia nepalensis CN7 Isolate Nodule
332 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
333 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0.15
Isolates 4.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0.76
Rhizoplane 3.79
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10028062 3300003316 Bacteria 1341
2 rootH1_10164810 3300003316 Bacteria 1062
3 rootL2_10036088 3300003322 Bacteria 1243
4 rootL2_10095498 3300003322 Bacteria 1289
5 rootH1_10093008 3300003323 Bacteria 2473
6 Ga0058860_11875516 3300004801 Bacteria 883
7 Ga0065707_10090976 3300005295 Bacteria 4028
8 Ga0065707_10331271 3300005295 Bacteria 949
9 Ga0065707_10458892 3300005295 Bacteria 793
10 Ga0065707_10615757 3300005295 Bacteria 681
11 Ga0070658_10072099 3300005327 Bacteria 2830
12 Ga0070676_10349333 3300005328 Bacteria 1016
13 Ga0070690_100039548 3300005330 Bacteria 2979
14 Ga0070690_100254826 3300005330 Bacteria 1243
15 Ga0070690_100366280 3300005330 Bacteria 1050
16 Ga0070670_100124738 3300005331 Bacteria 2223
17 Ga0070670_100192877 3300005331 Bacteria 1770
18 Ga0070670_100308088 3300005331 Bacteria 1386
19 Ga0070670_100351371 3300005331 Bacteria 1295
20 Ga0070677_10125813 3300005333 Bacteria 1163
21 Ga0068869_100072425 3300005334 Bacteria 2553
22 Ga0068869_100410278 3300005334 Bacteria 1116
23 Ga0068869_101351273 3300005334 Bacteria 630
24 Ga0070666_10027019 3300005335 Bacteria 3755
25 Ga0070666_10070759 3300005335 Bacteria 2374
26 Ga0070680_100097398 3300005336 Bacteria 2439
27 Ga0070680_101156773 3300005336 Bacteria 669
28 Ga0068868_100015816 3300005338 Bacteria 5589
29 Ga0068868_100024655 3300005338 Bacteria 4567
30 Ga0068868_100031398 3300005338 Bacteria 4080
31 Ga0070689_100008791 3300005340 Bacteria 7132
32 Ga0070689_100476496 3300005340 Bacteria 1066
33 Ga0070689_100498655 3300005340 Bacteria 1043
34 Ga0070689_101160449 3300005340 Bacteria 692
35 Ga0070689_101810445 3300005340 Bacteria 557
36 Ga0070687_100130827 3300005343 Bacteria 1449
37 Ga0070661_100024682 3300005344 Bacteria 4313
38 Ga0070661_101071193 3300005344 Bacteria 671
39 Ga0070668_100003237 3300005347 Bacteria 12002
40 Ga0070668_100236313 3300005347 Bacteria 1512
41 Ga0070668_100479463 3300005347 Bacteria 1074
42 Ga0070668_101123846 3300005347 Bacteria 710
43 Ga0070669_100006719 3300005353 Bacteria 8282
44 Ga0070669_100034347 3300005353 Bacteria 3671
45 Ga0070669_100180654 3300005353 Bacteria 1650
46 Ga0070669_100234660 3300005353 Bacteria 1455
47 Ga0070675_100261465 3300005354 Bacteria 1517
48 Ga0070675_101552661 3300005354 Bacteria 611
49 Ga0070671_100507392 3300005355 Bacteria 1038
50 Ga0070671_100538918 3300005355 Bacteria 1006
51 Ga0070674_100467705 3300005356 Bacteria 1044
52 Ga0070674_100811773 3300005356 Bacteria 809
53 Ga0070674_101096477 3300005356 Bacteria 703
54 Ga0070673_100157840 3300005364 Bacteria 1927
55 Ga0070673_101127251 3300005364 Bacteria 733
56 Ga0070673_101657902 3300005364 Bacteria 605
57 Ga0070688_100065271 3300005365 Bacteria 2313
58 Ga0070688_100351667 3300005365 Bacteria 1079
59 Ga0070688_100370142 3300005365 Bacteria 1054
60 Ga0070688_100619758 3300005365 Bacteria 830
61 Ga0070659_100855559 3300005366 Bacteria 793
62 Ga0070667_100000705 3300005367 Bacteria 32287
63 Ga0070667_100014479 3300005367 Bacteria 6516
64 Ga0070667_100058393 3300005367 Bacteria 3262
65 Ga0070667_100202502 3300005367 Bacteria 1762
66 Ga0070667_100257893 3300005367 Bacteria 1560
67 Ga0070667_100375237 3300005367 Bacteria 1291
68 Ga0070667_100620757 3300005367 Bacteria 997
69 Ga0070703_10123796 3300005406 Bacteria 941
70 Ga0070703_10170993 3300005406 Bacteria 832
71 Ga0070709_10616377 3300005434 Bacteria 837
72 Ga0070714_100005738 3300005435 Bacteria 9519
73 Ga0070713_100496585 3300005436 Bacteria 1151
74 Ga0070713_100720529 3300005436 Bacteria 953
75 Ga0070701_10627189 3300005438 Bacteria 715
76 Ga0070705_100001468 3300005440 Bacteria 12477
77 Ga0070705_100371121 3300005440 Bacteria 1050
78 Ga0070700_100510035 3300005441 Bacteria 927
79 Ga0070700_101198424 3300005441 Bacteria 634
80 Ga0070694_100012918 3300005444 Bacteria 5208
81 Ga0070694_100117665 3300005444 Bacteria 1903
82 Ga0070694_100540614 3300005444 Bacteria 932
83 Ga0070708_101191909 3300005445 Bacteria 712
84 Ga0070678_100108230 3300005456 Bacteria 2169
85 Ga0070678_100313026 3300005456 Bacteria 1338
86 Ga0070678_101597729 3300005456 Bacteria 612
87 Ga0070681_10021867 3300005458 Bacteria 6416
88 Ga0068867_100079121 3300005459 Bacteria 2474
89 Ga0068867_100383634 3300005459 Bacteria 1181
90 Ga0070685_10146062 3300005466 Bacteria 1494
91 Ga0070685_10210822 3300005466 Bacteria 1268
92 Ga0070685_10612211 3300005466 Bacteria 785
93 Ga0070685_10631159 3300005466 Bacteria 774
94 Ga0070685_10810270 3300005466 Bacteria 691
95 Ga0070698_100698027 3300005471 Bacteria 957
96 Ga0070679_100152313 3300005530 Bacteria 2289
97 Ga0070684_100033562 3300005535 Bacteria 4383
98 Ga0070684_100157043 3300005535 Bacteria 2063
99 Ga0070684_101649697 3300005535 Bacteria 605
100 Ga0070672_100210060 3300005543 Bacteria 1630
101 Ga0070672_100818825 3300005543 Bacteria 820
102 Ga0070686_100001557 3300005544 Bacteria 12882
103 Ga0070686_100035054 3300005544 Bacteria 3097
104 Ga0070695_100125219 3300005545 Bacteria 1764
105 Ga0070696_100268300 3300005546 Bacteria 1297
106 Ga0070693_100000154 3300005547 Bacteria 31511
107 Ga0070665_100013296 3300005548 Bacteria 8286
108 Ga0070665_100086099 3300005548 Bacteria 3148
109 Ga0070665_100087623 3300005548 Bacteria 3119
110 Ga0070665_100124266 3300005548 Bacteria 2582
111 Ga0070665_100137823 3300005548 Bacteria 2443
112 Ga0070665_100760510 3300005548 Bacteria 982
113 Ga0070665_101361525 3300005548 Bacteria 719
114 Ga0068855_100292934 3300005563 Bacteria 1804
115 Ga0070664_100025792 3300005564 Bacteria 4872
116 Ga0068854_100495379 3300005578 Bacteria 1028
117 Ga0068854_100677911 3300005578 Bacteria 888
118 Ga0068856_100380884 3300005614 Bacteria 1430
119 Ga0068856_100995013 3300005614 Bacteria 857
120 Ga0068852_100490800 3300005616 Bacteria 1222
121 Ga0068859_100029793 3300005617 Bacteria 5476
122 Ga0068859_100928486 3300005617 Bacteria 954
123 Ga0068864_100005699 3300005618 Bacteria 10212
124 Ga0068864_100030734 3300005618 Bacteria 4554
125 Ga0068864_100088604 3300005618 Bacteria 2726
126 Ga0068864_100273008 3300005618 Bacteria 1576
127 Ga0068864_100484425 3300005618 Bacteria 1188
128 Ga0068861_100007761 3300005719 Bacteria 7371
129 Ga0068861_100034591 3300005719 Bacteria 3737
130 Ga0068861_100109063 3300005719 Bacteria 2215
131 Ga0068861_100214265 3300005719 Bacteria 1624
132 Ga0068861_100493972 3300005719 Bacteria 1105
133 Ga0068861_100586770 3300005719 Bacteria 1021
134 Ga0068870_10040692 3300005840 Bacteria 2412
135 Ga0068870_10097649 3300005840 Bacteria 1654
136 Ga0068870_10377991 3300005840 Bacteria 916
137 Ga0068870_10990553 3300005840 Bacteria 599
138 Ga0068863_100010108 3300005841 Bacteria 9177
139 Ga0068863_100318244 3300005841 Bacteria 1511
140 Ga0068863_100698865 3300005841 Bacteria 1008
141 Ga0068860_100036269 3300005843 Bacteria 4725
142 Ga0068860_100091956 3300005843 Bacteria 2891
143 Ga0068860_100092574 3300005843 Bacteria 2881
144 Ga0068860_100097921 3300005843 Bacteria 2797
145 Ga0068860_100117711 3300005843 Bacteria 2542
146 Ga0068860_100282316 3300005843 Bacteria 1623
147 Ga0068860_100404293 3300005843 Bacteria 1351
148 Ga0068860_100504600 3300005843 Bacteria 1208
149 Ga0068860_101356909 3300005843 Bacteria 732
150 Ga0068860_101813949 3300005843 Bacteria 632
151 Ga0068862_100025306 3300005844 Bacteria 4983
152 Ga0068862_100029031 3300005844 Bacteria 4659
153 Ga0068862_100071389 3300005844 Bacteria 2998
154 Ga0068862_100139527 3300005844 Bacteria 2150
155 Ga0068862_100444379 3300005844 Bacteria 1221
156 Ga0068862_100929455 3300005844 Bacteria 857
157 Ga0081455_10003566 3300005937 Bacteria 17857
158 Ga0081455_10034300 3300005937 Bacteria 4549
159 Ga0081455_10078930 3300005937 Bacteria 2704
160 Ga0081538_10214563 3300005981 Bacteria 771
161 Ga0081540_1076160 3300005983 Bacteria 1530
162 Ga0081539_10002135 3300005985 Bacteria 29216
163 Ga0070717_10169159 3300006028 Bacteria 1900
164 Ga0075365_10464733 3300006038 Bacteria 894
165 Ga0075365_10569517 3300006038 Bacteria 801
166 Ga0075363_100007959 3300006048 Bacteria 4910
167 Ga0075363_100252818 3300006048 Bacteria 1015
168 Ga0075363_100276618 3300006048 Bacteria 970
169 Ga0075364_10045520 3300006051 Bacteria 2856
170 Ga0075362_10147263 3300006177 Bacteria 1128
171 Ga0075367_10619971 3300006178 Bacteria 688
172 Ga0075366_10032569 3300006195 Bacteria 3068
173 Ga0075366_10066613 3300006195 Bacteria 2143
174 Ga0075366_10133477 3300006195 Bacteria 1499
175 Ga0075366_10238710 3300006195 Bacteria 1108
176 Ga0075366_10309548 3300006195 Bacteria 967
177 Ga0097621_100389633 3300006237 Bacteria 1246
178 Ga0097621_100801449 3300006237 Bacteria 873
179 Ga0097621_101251010 3300006237 Bacteria 700
180 Ga0075370_10048649 3300006353 Bacteria 2402
181 Ga0068871_100012374 3300006358 Bacteria 6287
182 Ga0068871_100052049 3300006358 Bacteria 3315
183 Ga0068871_100189199 3300006358 Bacteria 1772
184 Ga0068871_100845186 3300006358 Bacteria 846
185 Ga0075428_100015367 3300006844 Bacteria 8489
186 Ga0075428_100248011 3300006844 Bacteria 1919
187 Ga0075428_100272684 3300006844 Bacteria 1820
188 Ga0075428_100443436 3300006844 Bacteria 1391
189 Ga0075428_100449169 3300006844 Bacteria 1381
190 Ga0075428_100542304 3300006844 Bacteria 1243
191 Ga0075428_100819246 3300006844 Bacteria 989
192 Ga0075428_101130915 3300006844 Bacteria 827
193 Ga0075430_100030229 3300006846 Bacteria 4599
194 Ga0075430_100042137 3300006846 Bacteria 3861
195 Ga0075430_100315140 3300006846 Bacteria 1293
196 Ga0075430_100340170 3300006846 Bacteria 1239
197 Ga0075430_100412747 3300006846 Bacteria 1114
198 Ga0075431_100012461 3300006847 Bacteria 8581
199 Ga0075431_100022698 3300006847 Bacteria 6414
200 Ga0075431_100025017 3300006847 Bacteria 6120
201 Ga0075431_100048795 3300006847 Bacteria 4366
202 Ga0075431_100108461 3300006847 Bacteria 2865
203 Ga0075431_100598223 3300006847 Bacteria 1087
204 Ga0075434_100242236 3300006871 Bacteria 1823
205 Ga0075434_101110719 3300006871 Bacteria 804
206 Ga0075429_100000076 3300006880 Bacteria 49832
207 Ga0075429_100023263 3300006880 Bacteria 5374
208 Ga0075429_100314138 3300006880 Bacteria 1371
209 Ga0075429_100323543 3300006880 Bacteria 1349
210 Ga0068865_100038500 3300006881 Bacteria 3237
211 Ga0068865_100430313 3300006881 Bacteria 1087
212 Ga0075436_100039815 3300006914 Bacteria 3243
213 Ga0097620_100029793 3300006931 Bacteria 5476
214 Ga0097620_100778344 3300006931 Bacteria 1045
215 Ga0097620_100928574 3300006931 Bacteria 954
216 Ga0075435_100020986 3300007076 Bacteria 5018
217 Ga0075435_100389057 3300007076 Bacteria 1198
218 Ga0075435_101294897 3300007076 Bacteria 638
219 Ga0099794_10132115 3300007265 Bacteria 1261
220 Ga0099795_10005512 3300007788 Bacteria 3374
221 Ga0111539_10010757 3300009094 Bacteria 11517
222 Ga0111539_10022910 3300009094 Bacteria 7669
223 Ga0111539_10025280 3300009094 Bacteria 7279
224 Ga0111539_10072216 3300009094 Bacteria 4070
225 Ga0111539_10112595 3300009094 Bacteria 3192
226 Ga0105245_10051126 3300009098 Bacteria 3705
227 Ga0105245_10085271 3300009098 Bacteria 2895
228 Ga0105245_10961592 3300009098 Bacteria 897
229 Ga0105247_10012124 3300009101 Bacteria 5182
230 Ga0105247_10160954 3300009101 Bacteria 1486
231 Ga0114129_10000791 3300009147 Bacteria 40561
232 Ga0114129_10039464 3300009147 Bacteria 6656
233 Ga0114129_10235239 3300009147 Bacteria 2465
234 Ga0114129_11027911 3300009147 Bacteria 1036
235 Ga0114129_11280053 3300009147 Bacteria 910
236 Ga0114129_11471477 3300009147 Bacteria 838
237 Ga0105243_10002015 3300009148 Bacteria 17271
238 Ga0105241_10414356 3300009174 Bacteria 1184
239 Ga0105241_11163091 3300009174 Bacteria 729
240 Ga0105242_10351324 3300009176 Bacteria 1362
241 Ga0105248_10175010 3300009177 Bacteria 2419
242 Ga0105248_10196243 3300009177 Bacteria 2274
243 Ga0105248_11666499 3300009177 Bacteria 723
244 Ga0105248_11872608 3300009177 Bacteria 681
245 Ga0105238_10027142 3300009551 Bacteria 5836
246 Ga0105238_10851199 3300009551 Bacteria 929
247 Ga0105249_10008874 3300009553 Bacteria 8782
248 Ga0105249_10024555 3300009553 Bacteria 5418
249 Ga0105249_10076432 3300009553 Bacteria 3104
250 Ga0105249_10744092 3300009553 Bacteria 1042
251 Ga0105249_10960369 3300009553 Bacteria 923
252 Ga0105249_11862391 3300009553 Bacteria 674
253 Ga0099796_10034040 3300010159 Bacteria 1680
254 Ga0105239_10018290 3300010375 Bacteria 7748
255 Ga0105246_10011573 3300011119 Bacteria 5476
256 Ga0105246_10063131 3300011119 Bacteria 2582
257 Ga0105246_10319590 3300011119 Bacteria 1261
258 Ga0105246_10569373 3300011119 Bacteria 974
259 Ga0105246_10695237 3300011119 Unclassified 891
260 Ga0157374_10014182 3300013296 Bacteria 6968
261 Ga0157374_11019606 3300013296 Bacteria 847
262 Ga0157378_10344261 3300013297 Bacteria 1455
263 Ga0157378_10466819 3300013297 Bacteria 1255
264 Ga0157378_10618782 3300013297 Bacteria 1096
265 Ga0157378_10822855 3300013297 Bacteria 956
266 Ga0163162_10007161 3300013306 Bacteria 10829
267 Ga0163162_10911324 3300013306 Bacteria 992
268 Ga0157372_11777467 3300013307 Bacteria 709
269 Ga0157375_10060113 3300013308 Bacteria 3767
270 Ga0157375_10140914 3300013308 Bacteria 2538
271 Ga0157375_10163655 3300013308 Bacteria 2368
272 Ga0157375_10485389 3300013308 Bacteria 1400
273 Ga0157375_11221852 3300013308 Bacteria 882
274 Ga0163163_10131646 3300014325 Bacteria 2541
275 Ga0163163_11332243 3300014325 Bacteria 780
276 Ga0163163_11451241 3300014325 Bacteria 748
277 Ga0163163_11610983 3300014325 Bacteria 710
278 Ga0163163_12243904 3300014325 Bacteria 605
279 Ga0157380_10530696 3300014326 Bacteria 1150
280 Ga0157377_10010946 3300014745 Bacteria 4509
281 Ga0157377_10783861 3300014745 Bacteria 701
282 Ga0157379_10087031 3300014968 Bacteria 2801
283 Ga0157379_10095627 3300014968 Bacteria 2665
284 Ga0157376_10696816 3300014969 Bacteria 1020
285 Ga0157376_12424735 3300014969 Bacteria 564
286 Ga0183367_1015 3300015688 Bacteria 298435
287 Ga0163161_10171856 3300017792 Bacteria 1657
288 Ga0163161_11943127 3300017792 Bacteria 523
289 Ga0207697_10223339 3300025315 Bacteria 831
290 Ga0207653_10388533 3300025885 Bacteria 547
291 Ga0207682_10040929 3300025893 Bacteria 1890
292 Ga0207710_10043447 3300025900 Bacteria 1999
293 Ga0207710_10309870 3300025900 Bacteria 799
294 Ga0207680_10045482 3300025903 Bacteria 2588
295 Ga0207680_10046779 3300025903 Bacteria 2560
296 Ga0207645_10523367 3300025907 Bacteria 804
297 Ga0207643_10042285 3300025908 Bacteria 2569
298 Ga0207643_10169252 3300025908 Bacteria 1318
299 Ga0207643_10314761 3300025908 Bacteria 976
300 Ga0207643_10323565 3300025908 Bacteria 963
301 Ga0207705_10098936 3300025909 Bacteria 2144
302 Ga0207654_10175597 3300025911 Bacteria 1394
303 Ga0207707_10482201 3300025912 Bacteria 1059
304 Ga0207693_10610435 3300025915 Bacteria 849
305 Ga0207693_10903341 3300025915 Bacteria 678
306 Ga0207660_10033166 3300025917 Bacteria 3569
307 Ga0207662_10002400 3300025918 Bacteria 9397
308 Ga0207649_10041029 3300025920 Bacteria 2816
309 Ga0207652_10534742 3300025921 Bacteria 1054
310 Ga0207681_10004367 3300025923 Bacteria 8718
311 Ga0207681_10159817 3300025923 Bacteria 1697
312 Ga0207681_10374114 3300025923 Bacteria 1145
313 Ga0207681_10417328 3300025923 Bacteria 1087
314 Ga0207650_10064780 3300025925 Bacteria 2736
315 Ga0207650_10356570 3300025925 Bacteria 1204
316 Ga0207650_10542822 3300025925 Bacteria 974
317 Ga0207650_10916414 3300025925 Bacteria 744
318 Ga0207650_11537059 3300025925 Bacteria 565
319 Ga0207659_10375608 3300025926 Bacteria 1184
320 Ga0207687_10016447 3300025927 Bacteria 4859
321 Ga0207687_10025347 3300025927 Bacteria 3968
322 Ga0207664_10003993 3300025929 Bacteria 9939
323 Ga0207644_10030943 3300025931 Bacteria 3726
324 Ga0207644_10217104 3300025931 Bacteria 1514
325 Ga0207690_11227615 3300025932 Bacteria 626
326 Ga0207706_10519254 3300025933 Bacteria 1027
327 Ga0207686_10157330 3300025934 Bacteria 1589
328 Ga0207709_10195651 3300025935 Bacteria 1440
329 Ga0207670_10081397 3300025936 Bacteria 2266
330 Ga0207670_10090055 3300025936 Bacteria 2166
331 Ga0207670_10579462 3300025936 Bacteria 920
332 Ga0207669_10861512 3300025937 Bacteria 755
333 Ga0207704_10952375 3300025938 Bacteria 724
334 Ga0207691_10325274 3300025940 Bacteria 1318
335 Ga0207711_10167770 3300025941 Bacteria 1990
336 Ga0207711_10430231 3300025941 Bacteria 1228
337 Ga0207711_11547052 3300025941 Bacteria 606
338 Ga0207689_10002939 3300025942 Bacteria 15741
339 Ga0207689_10006916 3300025942 Bacteria 9977
340 Ga0207689_10047332 3300025942 Bacteria 3552
341 Ga0207689_10078731 3300025942 Bacteria 2709
342 Ga0207689_10138580 3300025942 Bacteria 2004
343 Ga0207689_10737209 3300025942 Bacteria 831
344 Ga0207689_11052702 3300025942 Bacteria 686
345 Ga0207679_10476141 3300025945 Bacteria 1111
346 Ga0207679_11703771 3300025945 Bacteria 577
347 Ga0207667_10295439 3300025949 Bacteria 1655
348 Ga0207667_10478328 3300025949 Bacteria 1265
349 Ga0207651_10140746 3300025960 Bacteria 1863
350 Ga0207712_10003403 3300025961 Bacteria 10055
351 Ga0207712_10108852 3300025961 Bacteria 2074
352 Ga0207712_10194614 3300025961 Bacteria 1603
353 Ga0207668_10002007 3300025972 Bacteria 11879
354 Ga0207668_10006919 3300025972 Bacteria 6730
355 Ga0207668_10073171 3300025972 Bacteria 2455
356 Ga0207668_10267265 3300025972 Bacteria 1397
357 Ga0207640_10515949 3300025981 Bacteria 998
358 Ga0207658_10118596 3300025986 Bacteria 2105
359 Ga0207658_10216849 3300025986 Bacteria 1607
360 Ga0207658_10459509 3300025986 Bacteria 1128
361 Ga0207677_10075709 3300026023 Bacteria 2393
362 Ga0207677_10140638 3300026023 Bacteria 1847
363 Ga0207708_10115229 3300026075 Bacteria 2090
364 Ga0207708_11095608 3300026075 Bacteria 694
365 Ga0207708_11152618 3300026075 Bacteria 677
366 Ga0207702_10403491 3300026078 Bacteria 1319
367 Ga0207641_10027446 3300026088 Bacteria 4701
368 Ga0207641_10425048 3300026088 Bacteria 1280
369 Ga0207641_10436742 3300026088 Bacteria 1263
370 Ga0207641_10548127 3300026088 Bacteria 1127
371 Ga0207648_10207504 3300026089 Bacteria 1739
372 Ga0207648_10648241 3300026089 Bacteria 976
373 Ga0207648_10800960 3300026089 Bacteria 877
374 Ga0207648_11525321 3300026089 Bacteria 628
375 Ga0207676_10043379 3300026095 Bacteria 3462
376 Ga0207676_10124318 3300026095 Bacteria 2181
377 Ga0207676_10783259 3300026095 Bacteria 929
378 Ga0207674_10355646 3300026116 Bacteria 1416
379 Ga0207675_100002127 3300026118 Bacteria 19640
380 Ga0207675_100040991 3300026118 Bacteria 4324
381 Ga0207675_100112684 3300026118 Bacteria 2568
382 Ga0207675_100315242 3300026118 Bacteria 1526
383 Ga0207683_10047124 3300026121 Bacteria 3774
384 Ga0207683_10177776 3300026121 Bacteria 1929
385 Ga0207683_11526289 3300026121 Bacteria 617
386 Ga0207683_11785781 3300026121 Bacteria 564
387 Ga0207698_10385854 3300026142 Bacteria 1334
388 Ga0207428_10008419 3300027907 Bacteria 9313
389 Ga0207428_10014397 3300027907 Bacteria 6875
390 Ga0207428_10050362 3300027907 Bacteria 3333
391 Ga0265354_1021620 3300028016 Bacteria 612
392 Ga0265355_1001558 3300028036 Bacteria 1508
393 Ga0268266_10054887 3300028379 Bacteria 3424
394 Ga0268266_10058537 3300028379 Bacteria 3318
395 Ga0268266_10920252 3300028379 Bacteria 846
396 Ga0268265_10391193 3300028380 Bacteria 1282
397 Ga0268265_10479842 3300028380 Bacteria 1167
398 Ga0268265_10883977 3300028380 Bacteria 876
399 Ga0268264_10005460 3300028381 Bacteria 10774
400 Ga0268264_10379795 3300028381 Bacteria 1353
401 Ga0268264_10474476 3300028381 Bacteria 1216
402 Ga0268264_11457173 3300028381 Bacteria 695
403 Ga0265319_1106929 3300028563 Bacteria 876
404 Ga0265334_10202895 3300028573 Bacteria 689
405 Ga0307517_10210001 3300028786 Bacteria 1201
406 Ga0307515_10000038 3300028794 Bacteria 331376
407 Ga0307515_10057087 3300028794 Bacteria 5657
408 Ga0265338_10217700 3300028800 Bacteria 1428
409 Ga0265338_10244088 3300028800 Bacteria 1328
410 Ga0265330_10154537 3300031235 Bacteria 975
411 Ga0265325_10100540 3300031241 Bacteria 1416
412 Ga0265325_10168020 3300031241 Bacteria 1028
413 Ga0265339_10071518 3300031249 Bacteria 1848
414 Ga0265316_10006348 3300031344 Bacteria 11306
415 Ga0307513_10000001 3300031456 Bacteria 1660464
416 Ga0307513_10001365 3300031456 Bacteria 35245
417 Ga0307513_10001895 3300031456 Bacteria 29712
418 Ga0307513_10004600 3300031456 Bacteria 18380
419 Ga0307513_10032379 3300031456 Bacteria 5897
420 Ga0307513_10293538 3300031456 Bacteria 1396
421 Ga0265313_10001954 3300031595 Bacteria 18641
422 Ga0265314_10010506 3300031711 Bacteria 7715
423 Ga0265342_10046823 3300031712 Bacteria 2598
424 Ga0307410_10029993 3300031852 Bacteria 3471
425 Ga0307410_10285553 3300031852 Bacteria 1297
426 Ga0326468_10020064 3300031889 Bacteria 789
427 Ga0307409_100048855 3300031995 Bacteria 3223
428 Ga0307416_100898681 3300032002 Bacteria 986
429 Ga0307411_10349806 3300032005 Bacteria 1204
430 Ga0307411_11799298 3300032005 Bacteria 569
431 Ga0373959_0042380 3300034820 Bacteria 959
432 Ga0373928_0001224 3300035084 Bacteria 5054
433 Ga0373949_0125357 3300035090 Bacteria 724
434 Ga0373941_0017811 3300035115 Bacteria 1953
435 Ga0373946_0736420 3300035171 Bacteria 517
436 Ga0373955_0230059 3300035172 Bacteria 1109
437 Ga0373942_0161513 3300035207 Bacteria 725
438 Ga0373961_0194864 3300035241 Bacteria 712
439 Ga0373931_0000382 3300035691 Bacteria 18245
440 Ga0373931_0113595 3300035691 Bacteria 1540
441 Ga0373937_0304242 3300036401 Bacteria 1507
442 Ga0373937_0481356 3300036401 Bacteria 1179
443 Ga0373925_0049515 3300037068 Bacteria 3132
444 Ga0373925_0064958 3300037068 Bacteria 2748
445 Ga0395900_1207452 3300037418 Bacteria 672
446 Ga0395905_0002016 3300037471 Bacteria 23213
447 Ga0439447_095227 3300041407 Bacteria 684
448 Ga0451789_1005102 3300041443 Bacteria 637
449 Ga0451789_1201068 3300041443 Bacteria 584
450 Ga0451793_1912977 3300041452 Bacteria 997
451 Ga0451795_0648233 3300041456 Bacteria 1185
452 Ga0451798_1144670 3300041458 Bacteria 832
453 Ga0451800_0426012 3300041459 Bacteria 1185
454 Ga0451800_0809926 3300041459 Bacteria 1251
455 Ga0451807_0537413 3300041486 Bacteria 1308
456 Ga0451807_1205355 3300041486 Bacteria 673
457 Ga0451807_1355410 3300041486 Bacteria 935
458 Ga0451845_0084914 3300041501 Bacteria 534
459 Ga0451853_2328193 3300041512 Bacteria 2660
460 Ga0439431_0062457 3300041997 Bacteria 982
461 Ga0439446_0004412 3300042156 Bacteria 3570
462 Ga0439434_0006231 3300042435 Bacteria 3479
463 Ga0439434_0087775 3300042435 Bacteria 992
464 Ga0450918_093667 3300042531 Bacteria 583
465 Ga0451577_0026851 3300042876 Bacteria 5213
466 Ga0451577_0312875 3300042876 Bacteria 1423
467 Ga0466961_0417387 3300044693 Bacteria 813
468 Ga0466963_0006875 3300044694 Bacteria 6767
469 Ga0466964_0347689 3300044706 Bacteria 761
470 Ga0453684_0219397 3300044712 Bacteria 2204
471 Ga0466971_0186051 3300044719 Bacteria 977
472 Ga0466968_0257062 3300044735 Bacteria 831
473 Ga0466970_0177360 3300044765 Bacteria 1182
474 Ga0451576_0007110 3300045051 Bacteria 13517
475 Ga0451576_0015697 3300045051 Bacteria 8384
476 Ga0451576_0448232 3300045051 Bacteria 1355
477 Ga0495603_0328555 3300046455 Bacteria 878
478 Ga0495580_0245568 3300046472 Bacteria 1226
479 Ga0495582_0477575 3300046473 Bacteria 720
480 Ga0495594_0438299 3300046499 Bacteria 743
481 Ga0495630_0340550 3300046517 Bacteria 1147
482 Ga0495632_0185622 3300046519 Bacteria 951
483 Ga0495643_0198961 3300046522 Bacteria 963
484 Ga0495648_0231524 3300046524 Bacteria 904
485 Ga0495648_0302270 3300046524 Bacteria 749
486 Ga0495652_0536809 3300046529 Bacteria 806
487 Ga0495586_0638191 3300046535 Unclassified 615
488 Ga0495587_0750450 3300046536 Bacteria 534
489 Ga0495645_0189097 3300046543 Bacteria 1405
490 Ga0495667_0483446 3300046559 Unclassified 776
491 Ga0495667_0549551 3300046559 Bacteria 722
492 Ga0495668_0053018 3300046616 Bacteria 2244
493 Ga0495623_0204113 3300046679 Bacteria 1135
494 Ga0495623_0469988 3300046679 Bacteria 667
495 Ga0495658_0073987 3300046683 Bacteria 1984
496 Ga0495624_0035461 3300046690 Bacteria 3221
497 Ga0495671_0465229 3300046692 Bacteria 604
498 Ga0495649_0162445 3300046694 Bacteria 1171
499 Ga0495589_0577996 3300046794 Bacteria 512
500 Ga0495604_0128175 3300047317 Bacteria 1827
501 Ga0495604_0177509 3300047317 Bacteria 1492
502 Ga0495604_0227794 3300047317 Bacteria 1280
503 Ga0495636_0039253 3300047318 Bacteria 1960
504 Ga0495674_0296256 3300047319 Bacteria 1322
505 Ga0495674_0980772 3300047319 Bacteria 649
506 Ga0495672_0001992 3300047320 Bacteria 19304
507 Ga0495672_0303679 3300047320 Bacteria 755
508 Ga0495672_0535778 3300047320 Bacteria 515
509 Ga0495685_015009 3300047447 Bacteria 2638
510 Ga0495685_042079 3300047447 Bacteria 1560
511 Ga0496103_0780713 3300048906 Bacteria 603
512 Ga0496108_0533584 3300048911 Bacteria 1024
513 Ga0496109_0446928 3300048912 Bacteria 1221
514 Ga0496109_0592087 3300048912 Bacteria 1045
515 Ga0496109_0802904 3300048912 Bacteria 879
516 Ga0496110_0366481 3300048913 Bacteria 1313
517 Ga0496111_0363689 3300048914 Bacteria 1071
518 Ga0496111_0546768 3300048914 Bacteria 850
519 Ga0496112_0045127 3300048915 Bacteria 4320
520 Ga0496112_0296353 3300048915 Bacteria 1563
521 Ga0496113_0460243 3300048916 Bacteria 1022
522 Ga0496113_0779293 3300048916 Bacteria 760
523 Ga0496114_0088141 3300048917 Bacteria 2632
524 Ga0496114_0160396 3300048917 Bacteria 1955
525 Ga0496115_0255146 3300048918 Bacteria 1443
526 Ga0496116_0261467 3300048919 Bacteria 853
527 Ga0496126_0032668 3300048929 Bacteria 4901
528 Ga0496126_0394996 3300048929 Bacteria 1123
529 Ga0501031_0138261 3300049568 Bacteria 1592
530 Ga0501031_0992613 3300049568 Bacteria 537
531 Ga0501033_0217241 3300049570 Bacteria 1362
532 Ga0501034_0080155 3300049571 Bacteria 3268
533 Ga0501036_0335141 3300049572 Bacteria 1264
534 Ga0501036_1363836 3300049572 Bacteria 575
535 Ga0501037_0068760 3300049573 Bacteria 2579
536 Ga0501038_0251987 3300049574 Bacteria 1398
537 Ga0501038_0337733 3300049574 Bacteria 1175
538 Ga0501039_0035680 3300049575 Bacteria 3838
539 Ga0501039_0251282 3300049575 Bacteria 1390
540 Ga0501039_0274707 3300049575 Bacteria 1325
541 Ga0501040_0194379 3300049576 Bacteria 1440
542 Ga0501040_0203027 3300049576 Bacteria 1408
543 Ga0501040_0220740 3300049576 Bacteria 1348
544 Ga0501040_0557804 3300049576 Bacteria 827
545 Ga0501041_0013271 3300049577 Bacteria 4881
546 Ga0501041_0034824 3300049577 Bacteria 3049
547 Ga0501041_0585197 3300049577 Bacteria 712
548 Ga0501068_0020934 3300049584 Bacteria 3817
549 Ga0501068_0081875 3300049584 Bacteria 1982
550 Ga0501068_0314364 3300049584 Bacteria 1004
551 Ga0501068_0662191 3300049584 Bacteria 682
552 Ga0501068_0883067 3300049584 Bacteria 588
553 Ga0501070_0103939 3300049586 Bacteria 2349
554 Ga0501070_0117683 3300049586 Bacteria 2195
555 Ga0501071_0001799 3300049587 Bacteria 12667
556 Ga0501071_0047370 3300049587 Bacteria 3088
557 Ga0501071_0231868 3300049587 Bacteria 1391
558 Ga0501072_0020170 3300049588 Bacteria 5162
559 Ga0501072_0384339 3300049588 Bacteria 1114
560 Ga0501072_1094129 3300049588 Bacteria 620
561 Ga0501073_0022360 3300049589 Bacteria 4555
562 Ga0501073_0121275 3300049589 Bacteria 1812
563 Ga0501074_0077398 3300049590 Bacteria 2387
564 Ga0501075_0006563 3300049591 Bacteria 8012
565 Ga0501075_0304999 3300049591 Bacteria 1213
566 Ga0501076_0032218 3300049592 Bacteria 4090
567 Ga0501076_0092273 3300049592 Bacteria 2436
568 Ga0501235_078221 3300049669 Bacteria 788
569 Ga0501079_0104599 3300049741 Bacteria 2196
570 Ga0501079_0237312 3300049741 Bacteria 1424
571 Ga0501079_0423847 3300049741 Bacteria 1045
572 Ga0501080_0008180 3300049742 Bacteria 9474
573 Ga0501081_0005916 3300049743 Bacteria 7914
574 Ga0501081_0131965 3300049743 Bacteria 1785
575 Ga0501035_0596888 3300049822 Bacteria 900
576 Ga0501044_0469760 3300049823 Bacteria 1162
577 Ga0501045_0164745 3300049824 Bacteria 1651
578 Ga0501045_0312207 3300049824 Bacteria 1170
579 Ga0501045_0480169 3300049824 Bacteria 923
580 nmdc:mga03n38_504782_c1 3300050490 Bacteria 679
581 nmdc:mga03n38_546319_c1 3300050490 Bacteria 655
582 nmdc:mga0yw44_285738_c1 3300050492 Bacteria 1103
583 nmdc:mga0k408_113632_c1 3300050493 Bacteria 1601
584 nmdc:mga0k408_392658_c1 3300050493 Bacteria 826
585 nmdc:mga0k408_71882_c1 3300050493 Bacteria 2020
586 nmdc:mga06z11_555071_c1 3300050494 Bacteria 697
587 nmdc:mga07m45_47934_c1 3300050496 Bacteria 2402
588 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
589 nmdc:mga09592_23529_c1 3300050508 Bacteria 5089
590 nmdc:mga09592_573767_c1 3300050508 Bacteria 968
591 nmdc:mga09592_65101_c1 3300050508 Bacteria 3087
592 nmdc:mga09592_833350_c1 3300050508 Bacteria 779
593 nmdc:mga0qj67_116442_c1 3300050509 Bacteria 2160
594 nmdc:mga0qj67_333042_c1 3300050509 Bacteria 1228
595 nmdc:mga0qj67_472149_c1 3300050509 Bacteria 1010
596 nmdc:mga0qj67_540017_c1 3300050509 Bacteria 936
597 nmdc:mga0qj67_55912_c1 3300050509 Bacteria 3127
598 nmdc:mga06r32_1047806_c1 3300050510 Bacteria 767
599 nmdc:mga06r32_184499_c1 3300050510 Bacteria 2073
600 nmdc:mga06r32_635259_c1 3300050510 Bacteria 1037
601 nmdc:mga06r32_714922_c1 3300050510 Bacteria 967
602 nmdc:mga06r32_851204_c1 3300050510 Bacteria 870
603 nmdc:mga08y16_1292_c1 3300050511 Bacteria 24852
604 nmdc:mga08y16_250335_c1 3300050511 Bacteria 1831
605 nmdc:mga08y16_5195_c1 3300050511 Bacteria 13599
606 nmdc:mga08y16_530695_c1 3300050511 Bacteria 1193
607 nmdc:mga08y16_64970_c1 3300050511 Bacteria 3809
608 nmdc:mga08y16_8483_c1 3300050511 Bacteria 10764
609 nmdc:mga0n895_340253_c1 3300050512 Bacteria 1520
610 nmdc:mga0rr50_1227653_c1 3300050513 Bacteria 637
611 nmdc:mga0rr50_84234_c1 3300050513 Bacteria 2461
612 nmdc:mga08x19_64236_c1 3300050514 Bacteria 2383
613 nmdc:mga0a205_37767_c1 3300050515 Bacteria 4644
614 nmdc:mga0a205_441482_c1 3300050515 Bacteria 1162
615 Ga0495601_0104602 3300053077 Bacteria 1830
616 Ga0495595_0352805 3300053084 Bacteria 743
617 Ga0500594_0087829 3300053118 Bacteria 940
618 Ga0500594_0261915 3300053118 Bacteria 576
619 Ga0500559_0134133 3300053136 Bacteria 1157
620 Ga0500568_0196058 3300053139 Bacteria 740
621 Ga0500573_0005994 3300053140 Bacteria 6543
622 Ga0500577_0433203 3300053142 Bacteria 575
623 Ga0501084_1354069 3300054114 Bacteria 596
624 Ga0501082_0435927 3300060353 Bacteria 1144
625 Ga0501082_0752774 3300060353 Bacteria 853
626 Ga0530510_0107072 3300061734 Bacteria 2046
627 Ga0530510_0139220 3300061734 Bacteria 1787
628 Ga0530510_0443267 3300061734 Bacteria 981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10217700 Ga0265338_102177002 126
2 3300031235 Ga0265330_10154537 Ga0265330_101545371 126
3 3300031241 Ga0265325_10100540 Ga0265325_101005402 126
4 3300031249 Ga0265339_10071518 Ga0265339_100715182 126
5 3300031595 Ga0265313_10001954 Ga0265313_100019543 126
6 3300031712 Ga0265342_10046823 Ga0265342_100468232 126
7 3300049584 Ga0501068_0662191 Ga0501068_0662191_16_408 128
8 3300049588 Ga0501072_0384339 Ga0501072_0384339_709_1101 130
9 3300005843 Ga0068860_100282316 Ga0068860_1002823163 140
10 3300014969 Ga0157376_12424735 Ga0157376_124247351 140
11 3300025915 Ga0207693_10903341 Ga0207693_109033411 140
12 3300026088 Ga0207641_10436742 Ga0207641_104367422 140
13 3300048917 Ga0496114_0088141 Ga0496114_0088141_104_553 140
14 3300028800 Ga0265338_10244088 Ga0265338_102440883 142
15 iso_pu_bacteria 2515154088 2515495334 142
16 iso_pu_bacteria 2515154137 2515759386 142
17 iso_pu_bacteria 2515154203 2516092240 142
18 iso_pu_bacteria 2582581313 2585307953 142
19 iso_pu_bacteria 2687453743 2689990606 142
20 iso_pu_bacteria 2738543011 2739240228 142
21 iso_pu_bacteria 2862281513 2862286501 142
22 iso_pu_bacteria 2889300758 2889302858 142
23 iso_pu_bacteria 2891554331 2891561410 142
24 iso_pu_bacteria 2939743619 2939749062 142
25 iso_pu_bacteria 2945956166 2945959429 142
26 iso_pu_bacteria 2954711539 2954719397 142
27 iso_pu_bacteria 2954721474 2954729377 142
28 iso_pu_bacteria 2954731030 2954732431 142
29 iso_pu_bacteria 2954740390 2954748280 142
30 iso_pu_bacteria 2954749733 2954751319 142
31 iso_pu_bacteria 2954759201 2954767403 142
32 iso_pu_bacteria 8002775197 8002782960 142
33 iso_pu_bacteria 8054913762 8054916427 142
34 iso_pu_bacteria 8057568493 8057574214 142
35 iso_pu_bacteria 2675903059 2676485789 143
36 iso_pu_bacteria 2855670206 2855674703 143
37 iso_pu_bacteria 2855676851 2855680152 143
38 iso_pu_bacteria 2857288857 2857289268 143
39 iso_pu_bacteria 2858848962 2858854794 143
40 iso_pu_bacteria 2858882152 2858887343 143
41 iso_pu_bacteria 2858888857 2858890242 143
42 iso_pu_bacteria 2858895516 2858902206 143
43 iso_pu_bacteria 2869048445 2869050016 143
44 iso_pu_bacteria 2869061728 2869066406 143
45 iso_pu_bacteria 2869068681 2869070449 143
46 iso_pu_bacteria 2880495981 2880496949 143
47 3300005344 Ga0070661_101071193 Ga0070661_1010711931 144
48 3300005356 Ga0070674_101096477 Ga0070674_1010964771 144
49 3300005367 Ga0070667_100257893 Ga0070667_1002578932 144
50 3300005535 Ga0070684_101649697 Ga0070684_1016496971 144
51 3300005548 Ga0070665_100760510 Ga0070665_1007605102 144
52 3300005578 Ga0068854_100495379 Ga0068854_1004953792 144
53 3300005616 Ga0068852_100490800 Ga0068852_1004908002 144
54 3300005719 Ga0068861_100034591 Ga0068861_1000345913 144
55 3300005843 Ga0068860_100404293 Ga0068860_1004042932 144
56 3300005844 Ga0068862_100071389 Ga0068862_1000713893 144
57 3300005937 Ga0081455_10034300 Ga0081455_100343004 144
58 3300006844 Ga0075428_100272684 Ga0075428_1002726842 144
59 3300006844 Ga0075428_101130915 Ga0075428_1011309151 144
60 3300006846 Ga0075430_100315140 Ga0075430_1003151402 144
61 3300006846 Ga0075430_100340170 Ga0075430_1003401702 144
62 3300006847 Ga0075431_100108461 Ga0075431_1001084613 144
63 3300006880 Ga0075429_100314138 Ga0075429_1003141382 144
64 3300006880 Ga0075429_100323543 Ga0075429_1003235432 144
65 3300009094 Ga0111539_10072216 Ga0111539_100722164 144
66 3300009147 Ga0114129_11027911 Ga0114129_110279112 144
67 3300009147 Ga0114129_11471477 Ga0114129_114714772 144
68 3300009551 Ga0105238_10851199 Ga0105238_108511991 144
69 3300009553 Ga0105249_10076432 Ga0105249_100764324 144
70 3300011119 Ga0105246_10319590 Ga0105246_103195902 144
71 3300013307 Ga0157372_11777467 Ga0157372_117774672 144
72 3300014325 Ga0163163_11610983 Ga0163163_116109831 144
73 3300025931 Ga0207644_10217104 Ga0207644_102171042 144
74 3300025961 Ga0207712_10194614 Ga0207712_101946142 144
75 3300025986 Ga0207658_10459509 Ga0207658_104595092 144
76 3300026118 Ga0207675_100002127 Ga0207675_1000021279 144
77 3300026142 Ga0207698_10385854 Ga0207698_103858542 144
78 3300027907 Ga0207428_10050362 Ga0207428_100503622 144
79 3300028380 Ga0268265_10391193 Ga0268265_103911931 144
80 3300028381 Ga0268264_10379795 Ga0268264_103797952 144
81 3300041459 Ga0451800_0809926 Ga0451800_0809926_293_733 144
82 3300041501 Ga0451845_0084914 Ga0451845_0084914_15_455 144
83 3300042531 Ga0450918_093667 Ga0450918_093667_68_511 144
84 3300048912 Ga0496109_0446928 Ga0496109_0446928_513_956 144
85 3300048913 Ga0496110_0366481 Ga0496110_0366481_454_903 144
86 3300048914 Ga0496111_0546768 Ga0496111_0546768_348_791 144
87 3300048916 Ga0496113_0460243 Ga0496113_0460243_223_666 144
88 3300048917 Ga0496114_0160396 Ga0496114_0160396_1089_1538 144
89 3300049571 Ga0501034_0080155 Ga0501034_0080155_1892_2335 144
90 3300049572 Ga0501036_1363836 Ga0501036_1363836_34_477 144
91 3300049574 Ga0501038_0337733 Ga0501038_0337733_105_548 144
92 3300049575 Ga0501039_0274707 Ga0501039_0274707_175_618 144
93 3300049576 Ga0501040_0203027 Ga0501040_0203027_303_746 144
94 3300049577 Ga0501041_0585197 Ga0501041_0585197_247_690 144
95 3300049586 Ga0501070_0103939 Ga0501070_0103939_1082_1546 144
96 3300049586 Ga0501070_0117683 Ga0501070_0117683_1005_1469 144
97 3300049592 Ga0501076_0092273 Ga0501076_0092273_1784_2227 144
98 3300049741 Ga0501079_0423847 Ga0501079_0423847_52_495 144
99 3300049823 Ga0501044_0469760 Ga0501044_0469760_54_497 144
100 3300049824 Ga0501045_0164745 Ga0501045_0164745_853_1296 144
101 3300050508 nmdc:mga09592_573767_c1 nmdc:mga09592_573767_c1_447_890 144
102 3300050509 nmdc:mga0qj67_116442_c1 nmdc:mga0qj67_116442_c1_679_1122 144
103 3300050509 nmdc:mga0qj67_55912_c1 nmdc:mga0qj67_55912_c1_1053_1496 144
104 3300050510 nmdc:mga06r32_635259_c1 nmdc:mga06r32_635259_c1_73_516 144
105 3300053139 Ga0500568_0196058 Ga0500568_0196058_118_561 144
106 3300053140 Ga0500573_0005994 Ga0500573_0005994_2553_2996 144
107 3300060353 Ga0501082_0752774 Ga0501082_0752774_230_673 144
108 3300046529 Ga0495652_0536809 Ga0495652_0536809_65_502 145
109 3300048918 Ga0496115_0255146 Ga0496115_0255146_523_960 145
110 3300003316 rootH1_10164810 rootH1_101648102 146
111 3300003322 rootL2_10036088 rootL2_100360883 146
112 3300003323 rootH1_10093008 rootH1_100930083 146
113 3300005295 Ga0065707_10458892 Ga0065707_104588922 146
114 3300005295 Ga0065707_10615757 Ga0065707_106157571 146
115 3300005331 Ga0070670_100124738 Ga0070670_1001247383 146
116 3300005340 Ga0070689_101160449 Ga0070689_1011604491 146
117 3300005353 Ga0070669_100234660 Ga0070669_1002346603 146
118 3300005618 Ga0068864_100273008 Ga0068864_1002730083 146
119 3300005840 Ga0068870_10990553 Ga0068870_109905531 146
120 3300005937 Ga0081455_10078930 Ga0081455_100789303 146
121 3300005983 Ga0081540_1076160 Ga0081540_10761603 146
122 3300005985 Ga0081539_10002135 Ga0081539_100021356 146
123 3300006048 Ga0075363_100007959 Ga0075363_1000079593 146
124 3300006048 Ga0075363_100252818 Ga0075363_1002528182 146
125 3300006051 Ga0075364_10045520 Ga0075364_100455202 146
126 3300006195 Ga0075366_10238710 Ga0075366_102387103 146
127 3300006353 Ga0075370_10048649 Ga0075370_100486494 146
128 3300006844 Ga0075428_100015367 Ga0075428_1000153675 146
129 3300006844 Ga0075428_100443436 Ga0075428_1004434362 146
130 3300006846 Ga0075430_100030229 Ga0075430_1000302292 146
131 3300006847 Ga0075431_100012461 Ga0075431_1000124618 146
132 3300006847 Ga0075431_100022698 Ga0075431_1000226982 146
133 3300006847 Ga0075431_100048795 Ga0075431_1000487953 146
134 3300006880 Ga0075429_100023263 Ga0075429_1000232635 146
135 3300007788 Ga0099795_10005512 Ga0099795_100055124 146
136 3300009094 Ga0111539_10022910 Ga0111539_100229104 146
137 3300009147 Ga0114129_10039464 Ga0114129_100394642 146
138 3300009147 Ga0114129_10235239 Ga0114129_102352394 146
139 3300009148 Ga0105243_10002015 Ga0105243_100020159 146
140 3300009177 Ga0105248_11666499 Ga0105248_116664991 146
141 3300009177 Ga0105248_11872608 Ga0105248_118726082 146
142 3300010159 Ga0099796_10034040 Ga0099796_100340402 146
143 3300013308 Ga0157375_10140914 Ga0157375_101409142 146
144 3300014325 Ga0163163_11332243 Ga0163163_113322431 146
145 3300015688 Ga0183367_1015 Ga0183367_1015193 146
146 3300025925 Ga0207650_10542822 Ga0207650_105428222 146
147 3300025936 Ga0207670_10579462 Ga0207670_105794621 146
148 3300027907 Ga0207428_10014397 Ga0207428_100143971 146
149 3300028016 Ga0265354_1021620 Ga0265354_10216202 146
150 3300028563 Ga0265319_1106929 Ga0265319_11069292 146
151 3300028573 Ga0265334_10202895 Ga0265334_102028951 146
152 3300028794 Ga0307515_10000038 Ga0307515_10000038267 146
153 3300028794 Ga0307515_10057087 Ga0307515_100570873 146
154 3300031241 Ga0265325_10168020 Ga0265325_101680201 146
155 3300031344 Ga0265316_10006348 Ga0265316_100063483 146
156 3300031456 Ga0307513_10000001 Ga0307513_10000001567 146
157 3300031456 Ga0307513_10001895 Ga0307513_1000189510 146
158 3300032002 Ga0307416_100898681 Ga0307416_1008986812 146
159 3300037418 Ga0395900_1207452 Ga0395900_1207452_55_495 146
160 3300041452 Ga0451793_1912977 Ga0451793_1912977_315_761 146
161 3300041512 Ga0451853_2328193 Ga0451853_2328193_1335_1778 146
162 3300044693 Ga0466961_0417387 Ga0466961_0417387_278_718 146
163 3300044694 Ga0466963_0006875 Ga0466963_0006875_634_1074 146
164 3300044706 Ga0466964_0347689 Ga0466964_0347689_207_647 146
165 3300044719 Ga0466971_0186051 Ga0466971_0186051_171_611 146
166 3300044735 Ga0466968_0257062 Ga0466968_0257062_79_519 146
167 3300044765 Ga0466970_0177360 Ga0466970_0177360_577_1017 146
168 3300046522 Ga0495643_0198961 Ga0495643_0198961_413_853 146
169 3300046536 Ga0495587_0750450 Ga0495587_0750450_56_502 146
170 3300046559 Ga0495667_0549551 Ga0495667_0549551_73_516 146
171 3300046679 Ga0495623_0469988 Ga0495623_0469988_30_473 146
172 3300046694 Ga0495649_0162445 Ga0495649_0162445_168_608 146
173 3300047317 Ga0495604_0177509 Ga0495604_0177509_118_561 146
174 3300047318 Ga0495636_0039253 Ga0495636_0039253_658_1101 146
175 3300047320 Ga0495672_0001992 Ga0495672_0001992_1935_2378 146
176 3300047447 Ga0495685_015009 Ga0495685_015009_132_575 146
177 3300047447 Ga0495685_042079 Ga0495685_042079_761_1201 146
178 3300049570 Ga0501033_0217241 Ga0501033_0217241_639_1082 146
179 3300049572 Ga0501036_0335141 Ga0501036_0335141_201_644 146
180 3300049574 Ga0501038_0251987 Ga0501038_0251987_205_648 146
181 3300049575 Ga0501039_0035680 Ga0501039_0035680_1328_1771 146
182 3300049576 Ga0501040_0220740 Ga0501040_0220740_781_1224 146
183 3300049577 Ga0501041_0034824 Ga0501041_0034824_24_467 146
184 3300049584 Ga0501068_0020934 Ga0501068_0020934_941_1384 146
185 3300049587 Ga0501071_0047370 Ga0501071_0047370_1854_2300 146
186 3300049588 Ga0501072_1094129 Ga0501072_1094129_102_548 146
187 3300049590 Ga0501074_0077398 Ga0501074_0077398_1739_2182 146
188 3300049591 Ga0501075_0006563 Ga0501075_0006563_769_1212 146
189 3300049741 Ga0501079_0237312 Ga0501079_0237312_545_988 146
190 3300049822 Ga0501035_0596888 Ga0501035_0596888_281_724 146
191 3300049824 Ga0501045_0480169 Ga0501045_0480169_272_712 146
192 3300050490 nmdc:mga03n38_504782_c1 nmdc:mga03n38_504782_c1_169_612 146
193 3300050490 nmdc:mga03n38_546319_c1 nmdc:mga03n38_546319_c1_32_475 146
194 3300050494 nmdc:mga06z11_555071_c1 nmdc:mga06z11_555071_c1_32_475 146
195 3300050496 nmdc:mga07m45_47934_c1 nmdc:mga07m45_47934_c1_1030_1470 146
196 3300050508 nmdc:mga09592_65101_c1 nmdc:mga09592_65101_c1_1113_1556 146
197 3300050508 nmdc:mga09592_833350_c1 nmdc:mga09592_833350_c1_58_501 146
198 3300050509 nmdc:mga0qj67_472149_c1 nmdc:mga0qj67_472149_c1_227_670 146
199 3300050509 nmdc:mga0qj67_540017_c1 nmdc:mga0qj67_540017_c1_265_708 146
200 3300050510 nmdc:mga06r32_1047806_c1 nmdc:mga06r32_1047806_c1_96_539 146
201 3300050510 nmdc:mga06r32_714922_c1 nmdc:mga06r32_714922_c1_364_807 146
202 3300050510 nmdc:mga06r32_851204_c1 nmdc:mga06r32_851204_c1_172_615 146
203 3300050511 nmdc:mga08y16_5195_c1 nmdc:mga08y16_5195_c1_1404_1847 146
204 3300061734 Ga0530510_0107072 Ga0530510_0107072_1523_1966 146
205 3300061734 Ga0530510_0139220 Ga0530510_0139220_1329_1772 146
206 3300005330 Ga0070690_100254826 Ga0070690_1002548262 147
207 3300005335 Ga0070666_10027019 Ga0070666_100270192 147
208 3300005338 Ga0068868_100024655 Ga0068868_1000246552 147
209 3300005340 Ga0070689_100008791 Ga0070689_1000087917 147
210 3300005344 Ga0070661_100024682 Ga0070661_1000246821 147
211 3300005347 Ga0070668_100003237 Ga0070668_10000323714 147
212 3300005347 Ga0070668_100479463 Ga0070668_1004794632 147
213 3300005354 Ga0070675_101552661 Ga0070675_1015526611 147
214 3300005364 Ga0070673_100157840 Ga0070673_1001578402 147
215 3300005365 Ga0070688_100065271 Ga0070688_1000652711 147
216 3300005367 Ga0070667_100014479 Ga0070667_1000144795 147
217 3300005406 Ga0070703_10123796 Ga0070703_101237962 147
218 3300005435 Ga0070714_100005738 Ga0070714_1000057386 147
219 3300005436 Ga0070713_100720529 Ga0070713_1007205292 147
220 3300005440 Ga0070705_100371121 Ga0070705_1003711212 147
221 3300005441 Ga0070700_100510035 Ga0070700_1005100352 147
222 3300005441 Ga0070700_101198424 Ga0070700_1011984242 147
223 3300005444 Ga0070694_100012918 Ga0070694_1000129187 147
224 3300005444 Ga0070694_100540614 Ga0070694_1005406141 147
225 3300005456 Ga0070678_100313026 Ga0070678_1003130261 147
226 3300005466 Ga0070685_10612211 Ga0070685_106122111 147
227 3300005466 Ga0070685_10810270 Ga0070685_108102701 147
228 3300005535 Ga0070684_100157043 Ga0070684_1001570431 147
229 3300005543 Ga0070672_100818825 Ga0070672_1008188252 147
230 3300005544 Ga0070686_100035054 Ga0070686_1000350543 147
231 3300005545 Ga0070695_100125219 Ga0070695_1001252192 147
232 3300005546 Ga0070696_100268300 Ga0070696_1002683002 147
233 3300005548 Ga0070665_100124266 Ga0070665_1001242663 147
234 3300005563 Ga0068855_100292934 Ga0068855_1002929343 147
235 3300005564 Ga0070664_100025792 Ga0070664_1000257926 147
236 3300005614 Ga0068856_100380884 Ga0068856_1003808842 147
237 3300005618 Ga0068864_100005699 Ga0068864_10000569910 147
238 3300005719 Ga0068861_100109063 Ga0068861_1001090633 147
239 3300005840 Ga0068870_10097649 Ga0068870_100976492 147
240 3300005840 Ga0068870_10377991 Ga0068870_103779912 147
241 3300005841 Ga0068863_100010108 Ga0068863_10001010810 147
242 3300005843 Ga0068860_100091956 Ga0068860_1000919561 147
243 3300005843 Ga0068860_100504600 Ga0068860_1005046002 147
244 3300005843 Ga0068860_101356909 Ga0068860_1013569092 147
245 3300005844 Ga0068862_100139527 Ga0068862_1001395273 147
246 3300005844 Ga0068862_100444379 Ga0068862_1004443792 147
247 3300006028 Ga0070717_10169159 Ga0070717_101691594 147
248 3300006038 Ga0075365_10464733 Ga0075365_104647332 147
249 3300006038 Ga0075365_10569517 Ga0075365_105695171 147
250 3300006048 Ga0075363_100276618 Ga0075363_1002766181 147
251 3300006178 Ga0075367_10619971 Ga0075367_106199711 147
252 3300006358 Ga0068871_100052049 Ga0068871_1000520492 147
253 3300006358 Ga0068871_100189199 Ga0068871_1001891993 147
254 3300006844 Ga0075428_100248011 Ga0075428_1002480111 147
255 3300006844 Ga0075428_100542304 Ga0075428_1005423042 147
256 3300006844 Ga0075428_100819246 Ga0075428_1008192462 147
257 3300006846 Ga0075430_100412747 Ga0075430_1004127472 147
258 3300006931 Ga0097620_100778344 Ga0097620_1007783442 147
259 3300007076 Ga0075435_101294897 Ga0075435_1012948972 147
260 3300009094 Ga0111539_10010757 Ga0111539_100107576 147
261 3300009094 Ga0111539_10112595 Ga0111539_101125952 147
262 3300009098 Ga0105245_10051126 Ga0105245_100511261 147
263 3300009101 Ga0105247_10012124 Ga0105247_100121241 147
264 3300009177 Ga0105248_10196243 Ga0105248_101962432 147
265 3300009551 Ga0105238_10027142 Ga0105238_100271425 147
266 3300009553 Ga0105249_10024555 Ga0105249_100245555 147
267 3300009553 Ga0105249_10960369 Ga0105249_109603691 147
268 3300009553 Ga0105249_11862391 Ga0105249_118623911 147
269 3300010375 Ga0105239_10018290 Ga0105239_100182907 147
270 3300011119 Ga0105246_10011573 Ga0105246_100115737 147
271 3300013296 Ga0157374_10014182 Ga0157374_100141826 147
272 3300013306 Ga0163162_10007161 Ga0163162_100071615 147
273 3300013308 Ga0157375_10060113 Ga0157375_100601132 147
274 3300014325 Ga0163163_12243904 Ga0163163_122439041 147
275 3300014326 Ga0157380_10530696 Ga0157380_105306961 147
276 3300014745 Ga0157377_10010946 Ga0157377_100109465 147
277 3300014968 Ga0157379_10087031 Ga0157379_100870311 147
278 3300014969 Ga0157376_10696816 Ga0157376_106968162 147
279 3300017792 Ga0163161_11943127 Ga0163161_119431271 147
280 3300025885 Ga0207653_10388533 Ga0207653_103885331 147
281 3300025900 Ga0207710_10043447 Ga0207710_100434472 147
282 3300025903 Ga0207680_10045482 Ga0207680_100454822 147
283 3300025908 Ga0207643_10169252 Ga0207643_101692522 147
284 3300025915 Ga0207693_10610435 Ga0207693_106104351 147
285 3300025920 Ga0207649_10041029 Ga0207649_100410292 147
286 3300025927 Ga0207687_10016447 Ga0207687_100164476 147
287 3300025929 Ga0207664_10003993 Ga0207664_100039938 147
288 3300025931 Ga0207644_10030943 Ga0207644_100309432 147
289 3300025936 Ga0207670_10090055 Ga0207670_100900552 147
290 3300025940 Ga0207691_10325274 Ga0207691_103252741 147
291 3300025941 Ga0207711_10167770 Ga0207711_101677702 147
292 3300025942 Ga0207689_10737209 Ga0207689_107372091 147
293 3300025945 Ga0207679_10476141 Ga0207679_104761411 147
294 3300025949 Ga0207667_10478328 Ga0207667_104783281 147
295 3300025960 Ga0207651_10140746 Ga0207651_101407462 147
296 3300025961 Ga0207712_10108852 Ga0207712_101088523 147
297 3300025972 Ga0207668_10002007 Ga0207668_100020074 147
298 3300026075 Ga0207708_11095608 Ga0207708_110956082 147
299 3300026075 Ga0207708_11152618 Ga0207708_111526182 147
300 3300026088 Ga0207641_10027446 Ga0207641_100274465 147
301 3300026089 Ga0207648_10800960 Ga0207648_108009602 147
302 3300026095 Ga0207676_10043379 Ga0207676_100433792 147
303 3300026118 Ga0207675_100040991 Ga0207675_1000409913 147
304 3300026121 Ga0207683_10177776 Ga0207683_101777762 147
305 3300028380 Ga0268265_10479842 Ga0268265_104798422 147
306 3300028381 Ga0268264_10474476 Ga0268264_104744763 147
307 3300031711 Ga0265314_10010506 Ga0265314_100105066 147
308 3300035691 Ga0373931_0113595 Ga0373931_0113595_705_1154 147
309 3300041407 Ga0439447_095227 Ga0439447_095227_210_656 147
310 3300041443 Ga0451789_1201068 Ga0451789_1201068_50_493 147
311 3300041486 Ga0451807_1205355 Ga0451807_1205355_54_500 147
312 3300041997 Ga0439431_0062457 Ga0439431_0062457_154_600 147
313 3300042156 Ga0439446_0004412 Ga0439446_0004412_3054_3500 147
314 3300042435 Ga0439434_0006231 Ga0439434_0006231_17_463 147
315 3300042435 Ga0439434_0087775 Ga0439434_0087775_18_464 147
316 3300046455 Ga0495603_0328555 Ga0495603_0328555_49_498 147
317 3300046499 Ga0495594_0438299 Ga0495594_0438299_19_468 147
318 3300046519 Ga0495632_0185622 Ga0495632_0185622_477_926 147
319 3300046535 Ga0495586_0638191 Ga0495586_0638191_132_581 147
320 3300046794 Ga0495589_0577996 Ga0495589_0577996_14_460 147
321 3300047319 Ga0495674_0296256 Ga0495674_0296256_295_744 147
322 3300047320 Ga0495672_0303679 Ga0495672_0303679_132_578 147
323 3300048906 Ga0496103_0780713 Ga0496103_0780713_147_590 147
324 3300048911 Ga0496108_0533584 Ga0496108_0533584_393_839 147
325 3300048912 Ga0496109_0592087 Ga0496109_0592087_403_852 147
326 3300048914 Ga0496111_0363689 Ga0496111_0363689_81_530 147
327 3300048915 Ga0496112_0045127 Ga0496112_0045127_3783_4232 147
328 3300048915 Ga0496112_0296353 Ga0496112_0296353_95_541 147
329 3300048916 Ga0496113_0779293 Ga0496113_0779293_70_519 147
330 3300048929 Ga0496126_0032668 Ga0496126_0032668_1554_1997 147
331 3300048929 Ga0496126_0394996 Ga0496126_0394996_198_641 147
332 3300049568 Ga0501031_0138261 Ga0501031_0138261_380_823 147
333 3300049568 Ga0501031_0992613 Ga0501031_0992613_67_513 147
334 3300049575 Ga0501039_0251282 Ga0501039_0251282_386_832 147
335 3300049576 Ga0501040_0557804 Ga0501040_0557804_96_539 147
336 3300049577 Ga0501041_0013271 Ga0501041_0013271_828_1274 147
337 3300049584 Ga0501068_0314364 Ga0501068_0314364_357_800 147
338 3300049584 Ga0501068_0883067 Ga0501068_0883067_29_571 147
339 3300049587 Ga0501071_0231868 Ga0501071_0231868_271_714 147
340 3300049743 Ga0501081_0005916 Ga0501081_0005916_4289_4735 147
341 3300049824 Ga0501045_0312207 Ga0501045_0312207_18_464 147
342 3300050492 nmdc:mga0yw44_285738_c1 nmdc:mga0yw44_285738_c1_119_562 147
343 3300050509 nmdc:mga0qj67_333042_c1 nmdc:mga0qj67_333042_c1_110_556 147
344 3300050511 nmdc:mga08y16_250335_c1 nmdc:mga08y16_250335_c1_60_506 147
345 3300050511 nmdc:mga08y16_8483_c1 nmdc:mga08y16_8483_c1_8983_9429 147
346 3300050513 nmdc:mga0rr50_1227653_c1 nmdc:mga0rr50_1227653_c1_143_589 147
347 3300053077 Ga0495601_0104602 Ga0495601_0104602_971_1420 147
348 3300053118 Ga0500594_0087829 Ga0500594_0087829_36_485 147
349 3300053142 Ga0500577_0433203 Ga0500577_0433203_68_514 147
350 3300054114 Ga0501084_1354069 Ga0501084_1354069_96_542 147
351 3300061734 Ga0530510_0443267 Ga0530510_0443267_102_545 147
352 3300005458 Ga0070681_10021867 Ga0070681_100218676 149
353 3300005530 Ga0070679_100152313 Ga0070679_1001523132 149
354 3300025921 Ga0207652_10534742 Ga0207652_105347422 149
355 3300005327 Ga0070658_10072099 Ga0070658_100720992 150
356 3300005328 Ga0070676_10349333 Ga0070676_103493332 150
357 3300005331 Ga0070670_100308088 Ga0070670_1003080882 150
358 3300005331 Ga0070670_100351371 Ga0070670_1003513712 150
359 3300005333 Ga0070677_10125813 Ga0070677_101258133 150
360 3300005334 Ga0068869_100410278 Ga0068869_1004102781 150
361 3300005335 Ga0070666_10070759 Ga0070666_100707592 150
362 3300005336 Ga0070680_101156773 Ga0070680_1011567731 150
363 3300005338 Ga0068868_100031398 Ga0068868_1000313983 150
364 3300005347 Ga0070668_100236313 Ga0070668_1002363132 150
365 3300005347 Ga0070668_101123846 Ga0070668_1011238461 150
366 3300005353 Ga0070669_100034347 Ga0070669_1000343472 150
367 3300005355 Ga0070671_100538918 Ga0070671_1005389182 150
368 3300005356 Ga0070674_100467705 Ga0070674_1004677052 150
369 3300005356 Ga0070674_100811773 Ga0070674_1008117732 150
370 3300005364 Ga0070673_101127251 Ga0070673_1011272511 150
371 3300005366 Ga0070659_100855559 Ga0070659_1008555591 150
372 3300005367 Ga0070667_100375237 Ga0070667_1003752371 150
373 3300005367 Ga0070667_100620757 Ga0070667_1006207571 150
374 3300005456 Ga0070678_100108230 Ga0070678_1001082302 150
375 3300005459 Ga0068867_100383634 Ga0068867_1003836343 150
376 3300005466 Ga0070685_10631159 Ga0070685_106311591 150
377 3300005548 Ga0070665_100013296 Ga0070665_1000132963 150
378 3300005617 Ga0068859_100928486 Ga0068859_1009284861 150
379 3300005840 Ga0068870_10040692 Ga0068870_100406922 150
380 3300006358 Ga0068871_100845186 Ga0068871_1008451861 150
381 3300006881 Ga0068865_100430313 Ga0068865_1004303132 150
382 3300006931 Ga0097620_100928574 Ga0097620_1009285741 150
383 3300013297 Ga0157378_10466819 Ga0157378_104668192 150
384 3300025315 Ga0207697_10223339 Ga0207697_102233392 150
385 3300025893 Ga0207682_10040929 Ga0207682_100409292 150
386 3300025903 Ga0207680_10046779 Ga0207680_100467792 150
387 3300025907 Ga0207645_10523367 Ga0207645_105233672 150
388 3300025908 Ga0207643_10042285 Ga0207643_100422852 150
389 3300025908 Ga0207643_10314761 Ga0207643_103147612 150
390 3300025909 Ga0207705_10098936 Ga0207705_100989361 150
391 3300025923 Ga0207681_10374114 Ga0207681_103741141 150
392 3300025923 Ga0207681_10417328 Ga0207681_104173282 150
393 3300025925 Ga0207650_10356570 Ga0207650_103565702 150
394 3300025925 Ga0207650_10916414 Ga0207650_109164141 150
395 3300025932 Ga0207690_11227615 Ga0207690_112276151 150
396 3300025933 Ga0207706_10519254 Ga0207706_105192542 150
397 3300025937 Ga0207669_10861512 Ga0207669_108615122 150
398 3300025942 Ga0207689_10047332 Ga0207689_100473322 150
399 3300025972 Ga0207668_10073171 Ga0207668_100731715 150
400 3300025972 Ga0207668_10267265 Ga0207668_102672653 150
401 3300025986 Ga0207658_10216849 Ga0207658_102168492 150
402 3300026023 Ga0207677_10075709 Ga0207677_100757092 150
403 3300026089 Ga0207648_10207504 Ga0207648_102075041 150
404 3300026121 Ga0207683_10047124 Ga0207683_100471243 150
405 3300046524 Ga0495648_0302270 Ga0495648_0302270_230_682 150
406 3300046692 Ga0495671_0465229 Ga0495671_0465229_34_486 150
407 3300004801 Ga0058860_11875516 Ga0058860_118755161 151
408 3300005295 Ga0065707_10090976 Ga0065707_100909763 151
409 3300005295 Ga0065707_10331271 Ga0065707_103312712 151
410 3300005330 Ga0070690_100039548 Ga0070690_1000395483 151
411 3300005330 Ga0070690_100366280 Ga0070690_1003662801 151
412 3300005331 Ga0070670_100192877 Ga0070670_1001928773 151
413 3300005334 Ga0068869_100072425 Ga0068869_1000724254 151
414 3300005334 Ga0068869_101351273 Ga0068869_1013512731 151
415 3300005336 Ga0070680_100097398 Ga0070680_1000973983 151
416 3300005338 Ga0068868_100015816 Ga0068868_1000158165 151
417 3300005340 Ga0070689_100476496 Ga0070689_1004764962 151
418 3300005340 Ga0070689_100498655 Ga0070689_1004986552 151
419 3300005340 Ga0070689_101810445 Ga0070689_1018104451 151
420 3300005343 Ga0070687_100130827 Ga0070687_1001308272 151
421 3300005353 Ga0070669_100180654 Ga0070669_1001806542 151
422 3300005354 Ga0070675_100261465 Ga0070675_1002614651 151
423 3300005355 Ga0070671_100507392 Ga0070671_1005073921 151
424 3300005365 Ga0070688_100351667 Ga0070688_1003516672 151
425 3300005365 Ga0070688_100370142 Ga0070688_1003701421 151
426 3300005365 Ga0070688_100619758 Ga0070688_1006197582 151
427 3300005367 Ga0070667_100000705 Ga0070667_1000007055 151
428 3300005367 Ga0070667_100058393 Ga0070667_1000583934 151
429 3300005367 Ga0070667_100202502 Ga0070667_1002025022 151
430 3300005406 Ga0070703_10170993 Ga0070703_101709932 151
431 3300005434 Ga0070709_10616377 Ga0070709_106163771 151
432 3300005436 Ga0070713_100496585 Ga0070713_1004965852 151
433 3300005438 Ga0070701_10627189 Ga0070701_106271891 151
434 3300005440 Ga0070705_100001468 Ga0070705_1000014682 151
435 3300005444 Ga0070694_100117665 Ga0070694_1001176651 151
436 3300005445 Ga0070708_101191909 Ga0070708_1011919091 151
437 3300005456 Ga0070678_101597729 Ga0070678_1015977291 151
438 3300005459 Ga0068867_100079121 Ga0068867_1000791213 151
439 3300005466 Ga0070685_10146062 Ga0070685_101460623 151
440 3300005466 Ga0070685_10210822 Ga0070685_102108222 151
441 3300005471 Ga0070698_100698027 Ga0070698_1006980271 151
442 3300005543 Ga0070672_100210060 Ga0070672_1002100601 151
443 3300005544 Ga0070686_100001557 Ga0070686_1000015572 151
444 3300005547 Ga0070693_100000154 Ga0070693_10000015431 151
445 3300005548 Ga0070665_100086099 Ga0070665_1000860992 151
446 3300005548 Ga0070665_100087623 Ga0070665_1000876232 151
447 3300005548 Ga0070665_101361525 Ga0070665_1013615252 151
448 3300005578 Ga0068854_100677911 Ga0068854_1006779112 151
449 3300005614 Ga0068856_100995013 Ga0068856_1009950132 151
450 3300005617 Ga0068859_100029793 Ga0068859_1000297932 151
451 3300005618 Ga0068864_100030734 Ga0068864_1000307348 151
452 3300005618 Ga0068864_100088604 Ga0068864_1000886042 151
453 3300005618 Ga0068864_100484425 Ga0068864_1004844252 151
454 3300005719 Ga0068861_100007761 Ga0068861_1000077619 151
455 3300005719 Ga0068861_100214265 Ga0068861_1002142652 151
456 3300005719 Ga0068861_100493972 Ga0068861_1004939722 151
457 3300005719 Ga0068861_100586770 Ga0068861_1005867703 151
458 3300005841 Ga0068863_100318244 Ga0068863_1003182442 151
459 3300005841 Ga0068863_100698865 Ga0068863_1006988652 151
460 3300005843 Ga0068860_100036269 Ga0068860_1000362694 151
461 3300005843 Ga0068860_100092574 Ga0068860_1000925744 151
462 3300005843 Ga0068860_100097921 Ga0068860_1000979214 151
463 3300005843 Ga0068860_100117711 Ga0068860_1001177112 151
464 3300005843 Ga0068860_101813949 Ga0068860_1018139491 151
465 3300005844 Ga0068862_100025306 Ga0068862_1000253063 151
466 3300005844 Ga0068862_100029031 Ga0068862_1000290314 151
467 3300005844 Ga0068862_100929455 Ga0068862_1009294551 151
468 3300005937 Ga0081455_10003566 Ga0081455_1000356612 151
469 3300005981 Ga0081538_10214563 Ga0081538_102145632 151
470 3300006177 Ga0075362_10147263 Ga0075362_101472632 151
471 3300006195 Ga0075366_10032569 Ga0075366_100325693 151
472 3300006195 Ga0075366_10066613 Ga0075366_100666135 151
473 3300006195 Ga0075366_10133477 Ga0075366_101334772 151
474 3300006195 Ga0075366_10309548 Ga0075366_103095482 151
475 3300006237 Ga0097621_100389633 Ga0097621_1003896332 151
476 3300006237 Ga0097621_100801449 Ga0097621_1008014492 151
477 3300006237 Ga0097621_101251010 Ga0097621_1012510101 151
478 3300006358 Ga0068871_100012374 Ga0068871_1000123741 151
479 3300006844 Ga0075428_100449169 Ga0075428_1004491693 151
480 3300006846 Ga0075430_100042137 Ga0075430_1000421372 151
481 3300006847 Ga0075431_100025017 Ga0075431_1000250175 151
482 3300006847 Ga0075431_100598223 Ga0075431_1005982232 151
483 3300006871 Ga0075434_100242236 Ga0075434_1002422362 151
484 3300006871 Ga0075434_101110719 Ga0075434_1011107192 151
485 3300006880 Ga0075429_100000076 Ga0075429_10000007629 151
486 3300006881 Ga0068865_100038500 Ga0068865_1000385003 151
487 3300006914 Ga0075436_100039815 Ga0075436_1000398153 151
488 3300006931 Ga0097620_100029793 Ga0097620_10002979310 151
489 3300007076 Ga0075435_100389057 Ga0075435_1003890572 151
490 3300007265 Ga0099794_10132115 Ga0099794_101321151 151
491 3300009094 Ga0111539_10025280 Ga0111539_100252807 151
492 3300009098 Ga0105245_10085271 Ga0105245_100852712 151
493 3300009098 Ga0105245_10961592 Ga0105245_109615921 151
494 3300009101 Ga0105247_10160954 Ga0105247_101609543 151
495 3300009147 Ga0114129_10000791 Ga0114129_1000079118 151
496 3300009147 Ga0114129_11280053 Ga0114129_112800532 151
497 3300009174 Ga0105241_10414356 Ga0105241_104143562 151
498 3300009174 Ga0105241_11163091 Ga0105241_111630912 151
499 3300009176 Ga0105242_10351324 Ga0105242_103513242 151
500 3300009177 Ga0105248_10175010 Ga0105248_101750102 151
501 3300009553 Ga0105249_10008874 Ga0105249_100088742 151
502 3300009553 Ga0105249_10744092 Ga0105249_107440922 151
503 3300011119 Ga0105246_10063131 Ga0105246_100631311 151
504 3300011119 Ga0105246_10569373 Ga0105246_105693731 151
505 3300011119 Ga0105246_10695237 Ga0105246_106952372 151
506 3300013296 Ga0157374_11019606 Ga0157374_110196061 151
507 3300013297 Ga0157378_10618782 Ga0157378_106187821 151
508 3300013297 Ga0157378_10822855 Ga0157378_108228552 151
509 3300013306 Ga0163162_10911324 Ga0163162_109113242 151
510 3300013308 Ga0157375_10163655 Ga0157375_101636552 151
511 3300013308 Ga0157375_10485389 Ga0157375_104853893 151
512 3300013308 Ga0157375_11221852 Ga0157375_112218522 151
513 3300014325 Ga0163163_10131646 Ga0163163_101316463 151
514 3300014325 Ga0163163_11451241 Ga0163163_114512411 151
515 3300014745 Ga0157377_10783861 Ga0157377_107838612 151
516 3300014968 Ga0157379_10095627 Ga0157379_100956273 151
517 3300017792 Ga0163161_10171856 Ga0163161_101718561 151
518 3300025900 Ga0207710_10309870 Ga0207710_103098701 151
519 3300025908 Ga0207643_10323565 Ga0207643_103235651 151
520 3300025911 Ga0207654_10175597 Ga0207654_101755973 151
521 3300025912 Ga0207707_10482201 Ga0207707_104822012 151
522 3300025917 Ga0207660_10033166 Ga0207660_100331662 151
523 3300025918 Ga0207662_10002400 Ga0207662_100024003 151
524 3300025923 Ga0207681_10159817 Ga0207681_101598172 151
525 3300025925 Ga0207650_10064780 Ga0207650_100647802 151
526 3300025925 Ga0207650_11537059 Ga0207650_115370591 151
527 3300025926 Ga0207659_10375608 Ga0207659_103756082 151
528 3300025927 Ga0207687_10025347 Ga0207687_100253473 151
529 3300025934 Ga0207686_10157330 Ga0207686_101573302 151
530 3300025935 Ga0207709_10195651 Ga0207709_101956512 151
531 3300025936 Ga0207670_10081397 Ga0207670_100813971 151
532 3300025938 Ga0207704_10952375 Ga0207704_109523752 151
533 3300025941 Ga0207711_10430231 Ga0207711_104302312 151
534 3300025941 Ga0207711_11547052 Ga0207711_115470522 151
535 3300025942 Ga0207689_10002939 Ga0207689_100029393 151
536 3300025942 Ga0207689_10006916 Ga0207689_100069165 151
537 3300025942 Ga0207689_10078731 Ga0207689_100787316 151
538 3300025942 Ga0207689_10138580 Ga0207689_101385801 151
539 3300025942 Ga0207689_11052702 Ga0207689_110527022 151
540 3300025945 Ga0207679_11703771 Ga0207679_117037711 151
541 3300025949 Ga0207667_10295439 Ga0207667_102954392 151
542 3300025961 Ga0207712_10003403 Ga0207712_1000340312 151
543 3300025972 Ga0207668_10006919 Ga0207668_100069194 151
544 3300025981 Ga0207640_10515949 Ga0207640_105159492 151
545 3300025986 Ga0207658_10118596 Ga0207658_101185962 151
546 3300026023 Ga0207677_10140638 Ga0207677_101406383 151
547 3300026075 Ga0207708_10115229 Ga0207708_101152292 151
548 3300026078 Ga0207702_10403491 Ga0207702_104034912 151
549 3300026088 Ga0207641_10425048 Ga0207641_104250481 151
550 3300026088 Ga0207641_10548127 Ga0207641_105481272 151
551 3300026089 Ga0207648_10648241 Ga0207648_106482411 151
552 3300026089 Ga0207648_11525321 Ga0207648_115253212 151
553 3300026095 Ga0207676_10124318 Ga0207676_101243183 151
554 3300026095 Ga0207676_10783259 Ga0207676_107832592 151
555 3300026116 Ga0207674_10355646 Ga0207674_103556461 151
556 3300026118 Ga0207675_100112684 Ga0207675_1001126842 151
557 3300026118 Ga0207675_100315242 Ga0207675_1003152422 151
558 3300026121 Ga0207683_11526289 Ga0207683_115262891 151
559 3300026121 Ga0207683_11785781 Ga0207683_117857811 151
560 3300027907 Ga0207428_10008419 Ga0207428_100084199 151
561 3300028036 Ga0265355_1001558 Ga0265355_10015582 151
562 3300028379 Ga0268266_10054887 Ga0268266_100548872 151
563 3300028379 Ga0268266_10920252 Ga0268266_109202521 151
564 3300028380 Ga0268265_10883977 Ga0268265_108839771 151
565 3300028381 Ga0268264_10005460 Ga0268264_100054606 151
566 3300028381 Ga0268264_11457173 Ga0268264_114571731 151
567 3300028786 Ga0307517_10210001 Ga0307517_102100013 151
568 3300031456 Ga0307513_10001365 Ga0307513_1000136517 151
569 3300031456 Ga0307513_10004600 Ga0307513_1000460011 151
570 3300031456 Ga0307513_10032379 Ga0307513_100323797 151
571 3300031456 Ga0307513_10293538 Ga0307513_102935383 151
572 3300031852 Ga0307410_10285553 Ga0307410_102855533 151
573 3300032005 Ga0307411_11799298 Ga0307411_117992981 151
574 3300034820 Ga0373959_0042380 Ga0373959_0042380_433_945 151
575 3300035084 Ga0373928_0001224 Ga0373928_0001224_1945_2457 151
576 3300035090 Ga0373949_0125357 Ga0373949_0125357_57_512 151
577 3300035115 Ga0373941_0017811 Ga0373941_0017811_278_790 151
578 3300035171 Ga0373946_0736420 Ga0373946_0736420_29_484 151
579 3300035172 Ga0373955_0230059 Ga0373955_0230059_574_1035 151
580 3300035207 Ga0373942_0161513 Ga0373942_0161513_116_628 151
581 3300035241 Ga0373961_0194864 Ga0373961_0194864_184_699 151
582 3300035691 Ga0373931_0000382 Ga0373931_0000382_12057_12569 151
583 3300036401 Ga0373937_0304242 Ga0373937_0304242_443_940 151
584 3300036401 Ga0373937_0481356 Ga0373937_0481356_531_992 151
585 3300037068 Ga0373925_0049515 Ga0373925_0049515_443_940 151
586 3300037068 Ga0373925_0064958 Ga0373925_0064958_179_634 151
587 3300041443 Ga0451789_1005102 Ga0451789_1005102_28_483 151
588 3300041456 Ga0451795_0648233 Ga0451795_0648233_292_747 151
589 3300041458 Ga0451798_1144670 Ga0451798_1144670_321_776 151
590 3300041459 Ga0451800_0426012 Ga0451800_0426012_94_549 151
591 3300041486 Ga0451807_0537413 Ga0451807_0537413_824_1279 151
592 3300042876 Ga0451577_0026851 Ga0451577_0026851_602_1057 151
593 3300045051 Ga0451576_0007110 Ga0451576_0007110_8538_8993 151
594 3300045051 Ga0451576_0015697 Ga0451576_0015697_318_830 151
595 3300046472 Ga0495580_0245568 Ga0495580_0245568_560_1072 151
596 3300046473 Ga0495582_0477575 Ga0495582_0477575_187_642 151
597 3300046517 Ga0495630_0340550 Ga0495630_0340550_550_1047 151
598 3300046524 Ga0495648_0231524 Ga0495648_0231524_172_627 151
599 3300046543 Ga0495645_0189097 Ga0495645_0189097_248_745 151
600 3300046559 Ga0495667_0483446 Ga0495667_0483446_118_573 151
601 3300046616 Ga0495668_0053018 Ga0495668_0053018_759_1214 151
602 3300046679 Ga0495623_0204113 Ga0495623_0204113_404_901 151
603 3300046683 Ga0495658_0073987 Ga0495658_0073987_498_995 151
604 3300046690 Ga0495624_0035461 Ga0495624_0035461_1389_1844 151
605 3300047317 Ga0495604_0128175 Ga0495604_0128175_445_942 151
606 3300047317 Ga0495604_0227794 Ga0495604_0227794_252_707 151
607 3300047319 Ga0495674_0980772 Ga0495674_0980772_18_473 151
608 3300047320 Ga0495672_0535778 Ga0495672_0535778_15_470 151
609 3300048912 Ga0496109_0802904 Ga0496109_0802904_211_708 151
610 3300048919 Ga0496116_0261467 Ga0496116_0261467_295_762 151
611 3300049589 Ga0501073_0022360 Ga0501073_0022360_2916_3371 151
612 3300049669 Ga0501235_078221 Ga0501235_078221_152_700 151
613 3300050493 nmdc:mga0k408_113632_c1 nmdc:mga0k408_113632_c1_761_1222 151
614 3300050493 nmdc:mga0k408_392658_c1 nmdc:mga0k408_392658_c1_43_498 151
615 3300050493 nmdc:mga0k408_71882_c1 nmdc:mga0k408_71882_c1_292_798 151
616 3300050507 nmdc:mga05p37_72_c1 nmdc:mga05p37_72_c1_39926_40381 151
617 3300050508 nmdc:mga09592_23529_c1 nmdc:mga09592_23529_c1_3053_3508 151
618 3300050510 nmdc:mga06r32_184499_c1 nmdc:mga06r32_184499_c1_657_1112 151
619 3300050511 nmdc:mga08y16_1292_c1 nmdc:mga08y16_1292_c1_9386_9841 151
620 3300050511 nmdc:mga08y16_530695_c1 nmdc:mga08y16_530695_c1_431_943 151
621 3300050511 nmdc:mga08y16_64970_c1 nmdc:mga08y16_64970_c1_2405_2860 151
622 3300050512 nmdc:mga0n895_340253_c1 nmdc:mga0n895_340253_c1_347_802 151
623 3300050514 nmdc:mga08x19_64236_c1 nmdc:mga08x19_64236_c1_1529_1984 151
624 3300050515 nmdc:mga0a205_37767_c1 nmdc:mga0a205_37767_c1_374_829 151
625 3300050515 nmdc:mga0a205_441482_c1 nmdc:mga0a205_441482_c1_478_933 151
626 3300053084 Ga0495595_0352805 Ga0495595_0352805_117_572 151
627 3300053118 Ga0500594_0261915 Ga0500594_0261915_110_565 151
628 3300053136 Ga0500559_0134133 Ga0500559_0134133_77_532 151
629 3300005353 Ga0070669_100006719 Ga0070669_1000067195 152
630 3300005364 Ga0070673_101657902 Ga0070673_1016579021 152
631 3300005535 Ga0070684_100033562 Ga0070684_1000335623 152
632 3300005548 Ga0070665_100137823 Ga0070665_1001378232 152
633 3300007076 Ga0075435_100020986 Ga0075435_1000209867 152
634 3300013297 Ga0157378_10344261 Ga0157378_103442612 152
635 3300025923 Ga0207681_10004367 Ga0207681_100043676 152
636 3300028379 Ga0268266_10058537 Ga0268266_100585373 152
637 3300031852 Ga0307410_10029993 Ga0307410_100299932 152
638 3300031889 Ga0326468_10020064 Ga0326468_100200642 152
639 3300031995 Ga0307409_100048855 Ga0307409_1000488553 152
640 3300032005 Ga0307411_10349806 Ga0307411_103498062 152
641 3300037471 Ga0395905_0002016 Ga0395905_0002016_7289_7747 152
642 3300041486 Ga0451807_1355410 Ga0451807_1355410_206_667 152
643 3300042876 Ga0451577_0312875 Ga0451577_0312875_39_497 152
644 3300044712 Ga0453684_0219397 Ga0453684_0219397_1233_1691 152
645 3300045051 Ga0451576_0448232 Ga0451576_0448232_517_975 152
646 3300049573 Ga0501037_0068760 Ga0501037_0068760_926_1384 152
647 3300049576 Ga0501040_0194379 Ga0501040_0194379_10_468 152
648 3300049584 Ga0501068_0081875 Ga0501068_0081875_1178_1636 152
649 3300049587 Ga0501071_0001799 Ga0501071_0001799_1265_1723 152
650 3300049588 Ga0501072_0020170 Ga0501072_0020170_3277_3735 152
651 3300049589 Ga0501073_0121275 Ga0501073_0121275_1181_1639 152
652 3300049591 Ga0501075_0304999 Ga0501075_0304999_376_834 152
653 3300049592 Ga0501076_0032218 Ga0501076_0032218_3059_3517 152
654 3300049741 Ga0501079_0104599 Ga0501079_0104599_857_1315 152
655 3300049742 Ga0501080_0008180 Ga0501080_0008180_8441_8899 152
656 3300049743 Ga0501081_0131965 Ga0501081_0131965_1249_1707 152
657 3300050513 nmdc:mga0rr50_84234_c1 nmdc:mga0rr50_84234_c1_1616_2074 152
658 3300060353 Ga0501082_0435927 Ga0501082_0435927_315_773 152
659 3300003316 rootH1_10028062 rootH1_100280621 153
660 3300003322 rootL2_10095498 rootL2_100954982 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

42

165

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.9028 1 140
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8965 1 140
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8635 3 140
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8592 2 140
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8541 3 144
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9028 1 140 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8965 1 140 3.30.530.20
4f6aA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.848 44 67 3.40.630.30
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8478 4 140 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.825 3 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A537IEZ4-F1-model_v4 SRPBCC domain-containing protein 0.9966 1 153
AF-A0A519VL08-F1-model_v4 SRPBCC domain-containing protein 0.9933 1 153
AF-A0A537IEZ4-F1-model_v4 SRPBCC domain-containing protein 0.9901 1 153
AF-A0A519VL08-F1-model_v4 SRPBCC domain-containing protein 0.9869 1 153
AF-A0A4R9GQP1-F1-model_v4 SRPBCC domain-containing protein 0.9832 1 151

Feature Viewer

pLDDT pTM Quality
96.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map