F473340

General Info

Members Datasets Scaffolds Average Seq Length
660 332 1320 407

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10156783|Ga0207698_101567832
Length 435
Sequence MTSKTISDSERNPSQSAGSAQSQTRAAVDRLAGLLPPEALEDALKGLEPEEITGPGGLLTQLAGRVIETALGAELTEHLGHPPGGVTQGPNVRNGAGRKTVKTELGAVEVRTPRDRNGSFEPKIVGKHQRRFTGFDDKILSMYARGMSTREIQGHLAEIYQVEISPSLISEVTDAVLEEVKAWQSRPLESLYPVLFLDALMVKMRHEGRVENRAVYVAIGIDSQGQKDVLGLWTSANEGAKFWLQVLTDLKNRGVKDVFIACVDGLKGFPQAIETVFPQAQVQLCIVHLTRASLNYVTWKDRKAVAADLKTIYRADTVEQAEQELENLSKKWGTRYPTVALIWSRNWNQVTPFFAFPAEIRRIIYTTNAVESLNMSLRKIIKTRGAFPSEEVGIKLLYLALSNVVKKWETVQHWRQAMARFTLLWDDPIQAAAQR

Samples

Sample ID Description Type Environment
1 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
174 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
222 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
325 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 2643221621 Achromobacter sp. Root83 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0.15
Rhizoplane 3.33
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207698_10156783 3300026142 Bacteria 1985
2 JGI24741J21665_1014103 3300001915 Bacteria 1342
3 JGI24743J22301_10011957 3300001991 Bacteria 1571
4 JGI24735J21928_10033346 3300002067 Bacteria 1521
5 JGI24738J21930_10021809 3300002075 Bacteria 1326
6 rootL2_10012909 3300003322 Bacteria 1464
7 rootH1_10068339 3300003323 Bacteria 5364
8 Ga0065704_10077942 3300005289 Bacteria 4576
9 Ga0065715_10160914 3300005293 Bacteria 1558
10 Ga0065707_10082119 3300005295 Bacteria 21429
11 Ga0070658_10093772 3300005327 Bacteria 2476
12 Ga0070676_10069573 3300005328 Bacteria 2110
13 Ga0070683_100248313 3300005329 Bacteria 1692
14 Ga0070683_100259714 3300005329 Bacteria 1652
15 Ga0070683_100396833 3300005329 Bacteria 1315
16 Ga0070690_100111006 3300005330 Bacteria 1830
17 Ga0070690_100136371 3300005330 Bacteria 1662
18 Ga0070690_100160113 3300005330 Bacteria 1542
19 Ga0070670_100057403 3300005331 Bacteria 3342
20 Ga0070670_100174429 3300005331 Unclassified 1866
21 Ga0070670_100268975 3300005331 Bacteria 1487
22 Ga0070670_100314301 3300005331 Bacteria 1372
23 Ga0068869_100121297 3300005334 Unclassified 2000
24 Ga0068869_100190888 3300005334 Bacteria 1611
25 Ga0070666_10056101 3300005335 Bacteria 2659
26 Ga0070666_10068003 3300005335 Bacteria 2419
27 Ga0070666_10084683 3300005335 Bacteria 2170
28 Ga0070680_100161278 3300005336 Bacteria 1884
29 Ga0070682_100088613 3300005337 Bacteria 2020
30 Ga0068868_100127713 3300005338 Bacteria 2078
31 Ga0070660_100171390 3300005339 Bacteria 1753
32 Ga0070660_100243809 3300005339 Bacteria 1464
33 Ga0070689_100076125 3300005340 Unclassified 2628
34 Ga0070689_100148984 3300005340 Bacteria 1886
35 Ga0070689_100215239 3300005340 Bacteria 1574
36 Ga0070687_100106718 3300005343 Bacteria 1578
37 Ga0070687_100126144 3300005343 Bacteria 1471
38 Ga0070661_100187102 3300005344 Bacteria 1578
39 Ga0070692_10103769 3300005345 Bacteria 1562
40 Ga0070668_100277921 3300005347 Bacteria 1398
41 Ga0070675_100159301 3300005354 Bacteria 1940
42 Ga0070671_100150617 3300005355 Bacteria 1964
43 Ga0070673_100109705 3300005364 Bacteria 2286
44 Ga0070673_100183239 3300005364 Bacteria 1794
45 Ga0070673_100244750 3300005364 Bacteria 1561
46 Ga0070688_100040817 3300005365 Unclassified 2845
47 Ga0070659_100203619 3300005366 Bacteria 1630
48 Ga0070659_100242465 3300005366 Bacteria 1492
49 Ga0070667_100120165 3300005367 Bacteria 2285
50 Ga0070667_100130492 3300005367 Bacteria 2193
51 Ga0070667_100155452 3300005367 Bacteria 2011
52 Ga0070667_100326229 3300005367 Bacteria 1386
53 Ga0070714_100179472 3300005435 Unclassified 1926
54 Ga0070714_100254662 3300005435 Bacteria 1624
55 Ga0070713_100183474 3300005436 Bacteria 1882
56 Ga0070710_10049316 3300005437 Bacteria 2355
57 Ga0070711_100065302 3300005439 Bacteria 2545
58 Ga0070694_100210419 3300005444 Bacteria 1454
59 Ga0070678_100136153 3300005456 Bacteria 1959
60 Ga0070678_100249495 3300005456 Bacteria 1488
61 Ga0070681_10112792 3300005458 Bacteria 2658
62 Ga0070681_10211616 3300005458 Bacteria 1855
63 Ga0068867_100166416 3300005459 Bacteria 1743
64 Ga0070685_10089677 3300005466 Bacteria 1859
65 Ga0070685_10104527 3300005466 Unclassified 1734
66 Ga0070698_100226345 3300005471 Bacteria 1803
67 Ga0070698_100263502 3300005471 Bacteria 1656
68 Ga0070699_100188697 3300005518 Bacteria 1831
69 Ga0070679_100402631 3300005530 Bacteria 1314
70 Ga0070684_100173657 3300005535 Bacteria 1958
71 Ga0070684_100191873 3300005535 Bacteria 1859
72 Ga0070684_100229535 3300005535 Bacteria 1695
73 Ga0070684_100241711 3300005535 Bacteria 1650
74 Ga0070684_100243884 3300005535 Unclassified 1642
75 Ga0070684_100298920 3300005535 Bacteria 1477
76 Ga0070697_100094132 3300005536 Bacteria 2482
77 Ga0068853_100121199 3300005539 Bacteria 2333
78 Ga0068853_100205624 3300005539 Bacteria 1793
79 Ga0068853_100262641 3300005539 Bacteria 1588
80 Ga0068853_100388056 3300005539 Bacteria 1305
81 Ga0070672_100205999 3300005543 Bacteria 1646
82 Ga0070686_100045845 3300005544 Bacteria 2755
83 Ga0070686_100210309 3300005544 Bacteria 1400
84 Ga0070686_100237980 3300005544 Bacteria 1324
85 Ga0070696_100206748 3300005546 Bacteria 1468
86 Ga0070693_100120854 3300005547 Bacteria 1624
87 Ga0070665_100303566 3300005548 Bacteria 1599
88 Ga0070665_100341349 3300005548 Bacteria 1503
89 Ga0070704_100025663 3300005549 Bacteria 3883
90 Ga0070704_100241892 3300005549 Unclassified 1477
91 Ga0068855_100114940 3300005563 Bacteria 3085
92 Ga0068855_100227959 3300005563 Bacteria 2087
93 Ga0068855_100280230 3300005563 Bacteria 1851
94 Ga0068855_100396296 3300005563 Bacteria 1513
95 Ga0070664_100104335 3300005564 Bacteria 2468
96 Ga0070664_100125825 3300005564 Bacteria 2248
97 Ga0070664_100259590 3300005564 Bacteria 1563
98 Ga0070664_100347721 3300005564 Bacteria 1348
99 Ga0068857_100079873 3300005577 Bacteria 2920
100 Ga0068857_100193821 3300005577 Bacteria 1851
101 Ga0068857_100206866 3300005577 Bacteria 1790
102 Ga0068857_100253291 3300005577 Bacteria 1614
103 Ga0068857_100319329 3300005577 Bacteria 1434
104 Ga0068854_100173193 3300005578 Bacteria 1681
105 Ga0068854_100201110 3300005578 Bacteria 1566
106 Ga0068856_100050878 3300005614 Bacteria 4085
107 Ga0068856_100279996 3300005614 Bacteria 1684
108 Ga0070702_100087083 3300005615 Unclassified 1885
109 Ga0070702_100141328 3300005615 Bacteria 1534
110 Ga0068852_100158080 3300005616 Bacteria 2113
111 Ga0068852_100221985 3300005616 Bacteria 1798
112 Ga0068852_100250595 3300005616 Bacteria 1696
113 Ga0068859_100159135 3300005617 Unclassified 2337
114 Ga0068859_100260607 3300005617 Bacteria 1825
115 Ga0068859_100313357 3300005617 Bacteria 1663
116 Ga0068859_100319460 3300005617 Bacteria 1647
117 Ga0068859_100377412 3300005617 Bacteria 1513
118 Ga0068859_100441184 3300005617 Bacteria 1398
119 Ga0068864_100089640 3300005618 Bacteria 2710
120 Ga0068864_100275239 3300005618 Bacteria 1570
121 Ga0068866_10154784 3300005718 Bacteria 1331
122 Ga0068861_100185841 3300005719 Bacteria 1733
123 Ga0068870_10133254 3300005840 Bacteria 1446
124 Ga0068863_100063597 3300005841 Bacteria 3490
125 Ga0068863_100069809 3300005841 Bacteria 3321
126 Ga0068863_100256829 3300005841 Bacteria 1689
127 Ga0068858_100112101 3300005842 Unclassified 2547
128 Ga0068858_100159827 3300005842 Bacteria 2121
129 Ga0068858_100160689 3300005842 Bacteria 2115
130 Ga0068858_100238626 3300005842 Bacteria 1724
131 Ga0068860_100182062 3300005843 Bacteria 2031
132 Ga0068860_100233062 3300005843 Bacteria 1789
133 Ga0068862_100280913 3300005844 Bacteria 1526
134 Ga0068862_100349590 3300005844 Bacteria 1371
135 Ga0081455_10000065 3300005937 Bacteria 115239
136 Ga0081455_10208409 3300005937 Bacteria 1458
137 Ga0081540_1029918 3300005983 Bacteria 3025
138 Ga0070717_10072606 3300006028 Bacteria 2874
139 Ga0070717_10147564 3300006028 Unclassified 2033
140 Ga0070715_10029798 3300006163 Bacteria 2200
141 Ga0070715_10067096 3300006163 Bacteria 1592
142 Ga0070716_100076955 3300006173 Unclassified 1979
143 Ga0070716_100090853 3300006173 Bacteria 1848
144 Ga0070716_100123414 3300006173 Bacteria 1625
145 Ga0070712_100118978 3300006175 Bacteria 1985
146 Ga0097621_100065653 3300006237 Bacteria 2987
147 Ga0097621_100184157 3300006237 Bacteria 1806
148 Ga0097621_100213044 3300006237 Bacteria 1681
149 Ga0068871_100128711 3300006358 Bacteria 2145
150 Ga0068871_100170503 3300006358 Bacteria 1865
151 Ga0068871_100204830 3300006358 Bacteria 1705
152 Ga0068871_100264994 3300006358 Bacteria 1500
153 Ga0075428_100258586 3300006844 Unclassified 1875
154 Ga0075433_10289600 3300006852 Bacteria 1451
155 Ga0075434_100098587 3300006871 Bacteria 2928
156 Ga0075434_100217381 3300006871 Bacteria 1931
157 Ga0068865_100199404 3300006881 Bacteria 1553
158 Ga0097620_100159136 3300006931 Unclassified 2337
159 Ga0097620_100260596 3300006931 Bacteria 1825
160 Ga0097620_100313337 3300006931 Bacteria 1663
161 Ga0097620_100319458 3300006931 Bacteria 1647
162 Ga0097620_100377394 3300006931 Bacteria 1513
163 Ga0097620_100441133 3300006931 Bacteria 1398
164 Ga0099826_10089341 3300006948 Bacteria 1889
165 Ga0075435_100135657 3300007076 Bacteria 2061
166 Ga0105240_10199968 3300009093 Bacteria 2343
167 Ga0105240_10326040 3300009093 Bacteria 1749
168 Ga0105240_10343556 3300009093 Bacteria 1695
169 Ga0105240_10468144 3300009093 Bacteria 1407
170 Ga0111539_10341733 3300009094 Bacteria 1742
171 Ga0105245_10125532 3300009098 Bacteria 2402
172 Ga0105245_10164894 3300009098 Bacteria 2105
173 Ga0105245_10238659 3300009098 Bacteria 1761
174 Ga0105247_10043279 3300009101 Bacteria 2758
175 Ga0105243_10072013 3300009148 Bacteria 2796
176 Ga0105243_10080391 3300009148 Bacteria 2658
177 Ga0105243_10312761 3300009148 Bacteria 1428
178 Ga0105241_10094328 3300009174 Bacteria 2366
179 Ga0105241_10197767 3300009174 Bacteria 1677
180 Ga0105241_10200557 3300009174 Bacteria 1666
181 Ga0105241_10218725 3300009174 Bacteria 1600
182 Ga0105241_10227760 3300009174 Bacteria 1570
183 Ga0105242_10129016 3300009176 Bacteria 2180
184 Ga0105242_10170429 3300009176 Bacteria 1913
185 Ga0105242_10225488 3300009176 Bacteria 1677
186 Ga0105242_10266413 3300009176 Bacteria 1550
187 Ga0105248_10083276 3300009177 Bacteria 3598
188 Ga0105248_10283928 3300009177 Unclassified 1864
189 Ga0105248_10354287 3300009177 Bacteria 1652
190 Ga0105248_10393430 3300009177 Bacteria 1561
191 Ga0105248_10540345 3300009177 Unclassified 1315
192 Ga0105237_10052425 3300009545 Bacteria 4095
193 Ga0105237_10196887 3300009545 Bacteria 2015
194 Ga0105237_10233244 3300009545 Bacteria 1841
195 Ga0105237_10250710 3300009545 Unclassified 1772
196 Ga0105237_10291876 3300009545 Bacteria 1633
197 Ga0105238_10047519 3300009551 Bacteria 4326
198 Ga0105238_10243409 3300009551 Bacteria 1776
199 Ga0105238_10289623 3300009551 Bacteria 1620
200 Ga0105238_10289748 3300009551 Bacteria 1619
201 Ga0105249_10291757 3300009553 Bacteria 1633
202 Ga0105239_10130859 3300010375 Bacteria 2791
203 Ga0105239_10359314 3300010375 Bacteria 1645
204 Ga0105239_10394572 3300010375 Bacteria 1565
205 Ga0105239_10405071 3300010375 Bacteria 1544
206 Ga0105246_10091584 3300011119 Bacteria 2192
207 Ga0105246_10129554 3300011119 Bacteria 1882
208 Ga0105246_10158870 3300011119 Bacteria 1720
209 Ga0157373_10152496 3300013100 Bacteria 1625
210 Ga0157370_10372762 3300013104 Bacteria 1315
211 Ga0157369_10306709 3300013105 Bacteria 1651
212 Ga0157374_10090184 3300013296 Bacteria 2922
213 Ga0157374_10247404 3300013296 Bacteria 1754
214 Ga0157374_10294834 3300013296 Bacteria 1604
215 Ga0157378_10154600 3300013297 Bacteria 2140
216 Ga0157378_10178288 3300013297 Bacteria 1997
217 Ga0157378_10219479 3300013297 Bacteria 1807
218 Ga0163162_10076946 3300013306 Bacteria 3399
219 Ga0163162_10184195 3300013306 Bacteria 2215
220 Ga0163162_10241915 3300013306 Bacteria 1936
221 Ga0163162_10349084 3300013306 Bacteria 1612
222 Ga0163162_10360273 3300013306 Bacteria 1587
223 Ga0157372_10134519 3300013307 Bacteria 2846
224 Ga0157372_10263623 3300013307 Bacteria 2001
225 Ga0157372_10365929 3300013307 Bacteria 1680
226 Ga0157375_10390773 3300013308 Unclassified 1558
227 Ga0163163_10166490 3300014325 Unclassified 2250
228 Ga0163163_10230365 3300014325 Bacteria 1902
229 Ga0163163_10235427 3300014325 Unclassified 1880
230 Ga0163163_10342754 3300014325 Bacteria 1550
231 Ga0163163_10358765 3300014325 Bacteria 1514
232 Ga0157380_10234998 3300014326 Unclassified 1649
233 Ga0157377_10058032 3300014745 Bacteria 2203
234 Ga0157377_10081934 3300014745 Bacteria 1888
235 Ga0157377_10119078 3300014745 Bacteria 1598
236 Ga0157379_10149178 3300014968 Bacteria 2109
237 Ga0157379_10188311 3300014968 Bacteria 1865
238 Ga0157379_10211295 3300014968 Unclassified 1757
239 Ga0157379_10247410 3300014968 Bacteria 1618
240 Ga0157376_10194978 3300014969 Bacteria 1860
241 Ga0157376_10218622 3300014969 Bacteria 1763
242 Ga0163161_10038312 3300017792 Unclassified 3438
243 Ga0163161_10093944 3300017792 Unclassified 2223
244 Ga0213872_10046760 3300021361 Bacteria 1969
245 Ga0213874_10033957 3300021377 Unclassified 1490
246 Ga0213875_10062582 3300021388 Bacteria 1740
247 Ga0207697_10031562 3300025315 Bacteria 2167
248 Ga0207692_10074681 3300025898 Bacteria 1797
249 Ga0207642_10114709 3300025899 Bacteria 1378
250 Ga0207710_10053822 3300025900 Bacteria 1812
251 Ga0207688_10202721 3300025901 Bacteria 1190
252 Ga0207680_10053102 3300025903 Bacteria 2432
253 Ga0207680_10067966 3300025903 Bacteria 2197
254 Ga0207680_10106673 3300025903 Bacteria 1809
255 Ga0207680_10141880 3300025903 Bacteria 1593
256 Ga0207685_10050918 3300025905 Bacteria 1597
257 Ga0207685_10080933 3300025905 Unclassified 1344
258 Ga0207645_10112782 3300025907 Bacteria 1761
259 Ga0207645_10138125 3300025907 Bacteria 1587
260 Ga0207645_10175735 3300025907 Bacteria 1404
261 Ga0207643_10133503 3300025908 Unclassified 1479
262 Ga0207705_10179962 3300025909 Bacteria 1595
263 Ga0207654_10168506 3300025911 Bacteria 1420
264 Ga0207654_10178929 3300025911 Bacteria 1382
265 Ga0207707_10146805 3300025912 Bacteria 2062
266 Ga0207707_10278915 3300025912 Bacteria 1448
267 Ga0207695_10190267 3300025913 Bacteria 1970
268 Ga0207695_10254036 3300025913 Bacteria 1657
269 Ga0207695_10289970 3300025913 Bacteria 1529
270 Ga0207695_10346236 3300025913 Bacteria 1374
271 Ga0207671_10199165 3300025914 Bacteria 1564
272 Ga0207671_10234970 3300025914 Bacteria 1439
273 Ga0207693_10058523 3300025915 Bacteria 3019
274 Ga0207693_10106873 3300025915 Bacteria 2195
275 Ga0207663_10035166 3300025916 Bacteria 3003
276 Ga0207663_10168384 3300025916 Bacteria 1554
277 Ga0207663_10169516 3300025916 Bacteria 1549
278 Ga0207660_10171399 3300025917 Bacteria 1680
279 Ga0207662_10133874 3300025918 Bacteria 1565
280 Ga0207662_10153260 3300025918 Bacteria 1467
281 Ga0207657_10136652 3300025919 Bacteria 2005
282 Ga0207657_10176157 3300025919 Bacteria 1731
283 Ga0207657_10225318 3300025919 Bacteria 1501
284 Ga0207649_10045433 3300025920 Bacteria 2693
285 Ga0207649_10104301 3300025920 Bacteria 1882
286 Ga0207649_10192417 3300025920 Bacteria 1436
287 Ga0207652_10153955 3300025921 Bacteria 2059
288 Ga0207694_10175161 3300025924 Bacteria 1738
289 Ga0207694_10214082 3300025924 Bacteria 1570
290 Ga0207694_10243417 3300025924 Bacteria 1470
291 Ga0207650_10120825 3300025925 Bacteria 2039
292 Ga0207650_10143211 3300025925 Bacteria 1881
293 Ga0207650_10216434 3300025925 Unclassified 1540
294 Ga0207650_10236669 3300025925 Bacteria 1474
295 Ga0207659_10165578 3300025926 Bacteria 1740
296 Ga0207687_10075448 3300025927 Bacteria 2420
297 Ga0207687_10262782 3300025927 Bacteria 1377
298 Ga0207700_10206744 3300025928 Bacteria 1657
299 Ga0207700_10249701 3300025928 Bacteria 1515
300 Ga0207664_10233078 3300025929 Bacteria 1601
301 Ga0207644_10180849 3300025931 Bacteria 1652
302 Ga0207644_10235746 3300025931 Bacteria 1455
303 Ga0207690_10171460 3300025932 Bacteria 1626
304 Ga0207690_10258976 3300025932 Bacteria 1347
305 Ga0207686_10110035 3300025934 Bacteria 1856
306 Ga0207686_10157942 3300025934 Bacteria 1586
307 Ga0207686_10199499 3300025934 Bacteria 1432
308 Ga0207709_10137514 3300025935 Bacteria 1675
309 Ga0207670_10157828 3300025936 Bacteria 1690
310 Ga0207704_10201513 3300025938 Bacteria 1457
311 Ga0207704_10203544 3300025938 Bacteria 1451
312 Ga0207665_10132620 3300025939 Bacteria 1770
313 Ga0207711_10139974 3300025941 Bacteria 2176
314 Ga0207711_10255413 3300025941 Bacteria 1610
315 Ga0207689_10080905 3300025942 Unclassified 2670
316 Ga0207689_10116730 3300025942 Bacteria 2194
317 Ga0207661_10113149 3300025944 Bacteria 2299
318 Ga0207661_10131674 3300025944 Bacteria 2143
319 Ga0207661_10162006 3300025944 Bacteria 1941
320 Ga0207661_10172464 3300025944 Bacteria 1883
321 Ga0207661_10261287 3300025944 Bacteria 1542
322 Ga0207661_10324116 3300025944 Bacteria 1385
323 Ga0207679_10203811 3300025945 Bacteria 1654
324 Ga0207667_10280648 3300025949 Bacteria 1702
325 Ga0207667_10310944 3300025949 Bacteria 1609
326 Ga0207667_10372994 3300025949 Bacteria 1454
327 Ga0207667_10375798 3300025949 Bacteria 1448
328 Ga0207651_10246078 3300025960 Unclassified 1460
329 Ga0207651_10285431 3300025960 Bacteria 1366
330 Ga0207658_10171762 3300025986 Bacteria 1786
331 Ga0207658_10224673 3300025986 Bacteria 1581
332 Ga0207658_10276630 3300025986 Bacteria 1437
333 Ga0207677_10194148 3300026023 Bacteria 1608
334 Ga0207677_10276136 3300026023 Bacteria 1377
335 Ga0207703_10174971 3300026035 Unclassified 1891
336 Ga0207703_10253566 3300026035 Bacteria 1587
337 Ga0207703_10358173 3300026035 Bacteria 1345
338 Ga0207639_10200214 3300026041 Bacteria 1712
339 Ga0207639_10203830 3300026041 Bacteria 1698
340 Ga0207639_10231353 3300026041 Bacteria 1602
341 Ga0207639_10336284 3300026041 Bacteria 1345
342 Ga0207702_10065905 3300026078 Bacteria 3103
343 Ga0207702_10334886 3300026078 Bacteria 1444
344 Ga0207641_10235800 3300026088 Bacteria 1702
345 Ga0207641_10269716 3300026088 Bacteria 1596
346 Ga0207641_10281840 3300026088 Bacteria 1563
347 Ga0207648_10069604 3300026089 Bacteria 3066
348 Ga0207648_10097301 3300026089 Bacteria 2576
349 Ga0207676_10085707 3300026095 Bacteria 2571
350 Ga0207676_10294374 3300026095 Bacteria 1479
351 Ga0207674_10079251 3300026116 Bacteria 3289
352 Ga0207674_10138832 3300026116 Bacteria 2391
353 Ga0207674_10161890 3300026116 Bacteria 2192
354 Ga0207674_10225691 3300026116 Unclassified 1821
355 Ga0207674_10237905 3300026116 Bacteria 1768
356 Ga0207675_100140742 3300026118 Bacteria 2292
357 Ga0207683_10073452 3300026121 Plasmid 3026
358 Ga0207683_10189273 3300026121 Bacteria 1868
359 Ga0207698_10174354 3300026142 Bacteria 1897
360 Ga0207698_10181363 3300026142 Bacteria 1865
361 Ga0207698_10378874 3300026142 Bacteria 1345
362 Ga0268266_10183876 3300028379 Bacteria 1905
363 Ga0268266_10217571 3300028379 Bacteria 1754
364 Ga0268266_10267318 3300028379 Bacteria 1586
365 Ga0268265_10324751 3300028380 Bacteria 1395
366 Ga0268264_10233917 3300028381 Bacteria 1698
367 Ga0268264_10287267 3300028381 Bacteria 1543
368 Ga0268264_10322056 3300028381 Bacteria 1462
369 Ga0265326_10033391 3300028558 Bacteria 1464
370 Ga0265319_1045032 3300028563 Bacteria 1476
371 Ga0265334_10048565 3300028573 Bacteria 1634
372 Ga0265318_10055071 3300028577 Unclassified 1489
373 Ga0265323_10027546 3300028653 Bacteria 2135
374 Ga0265322_10031821 3300028654 Bacteria 1506
375 Ga0265338_10185155 3300028800 Bacteria 1583
376 Ga0265338_10188886 3300028800 Bacteria 1563
377 Ga0265324_10046602 3300029957 Bacteria 1491
378 Ga0265330_10041824 3300031235 Bacteria 2031
379 Ga0265332_10070218 3300031238 Bacteria 1492
380 Ga0265320_10081274 3300031240 Bacteria 1512
381 Ga0265325_10093491 3300031241 Bacteria 1479
382 Ga0265329_10040335 3300031242 Bacteria 1498
383 Ga0265329_10041582 3300031242 Bacteria 1473
384 Ga0265340_10085060 3300031247 Bacteria 1484
385 Ga0265339_10117443 3300031249 Bacteria 1370
386 Ga0265331_10070404 3300031250 Bacteria 1637
387 Ga0265316_10064121 3300031344 Bacteria 2846
388 Ga0265316_10139551 3300031344 Bacteria 1821
389 Ga0265316_10168140 3300031344 Bacteria 1637
390 Ga0307513_10198922 3300031456 Bacteria 1847
391 Ga0307408_100184138 3300031548 Bacteria 1677
392 Ga0265313_10078646 3300031595 Bacteria 1503
393 Ga0265314_10101531 3300031711 Bacteria 1848
394 Ga0265314_10140355 3300031711 Bacteria 1494
395 Ga0265342_10089977 3300031712 Bacteria 1760
396 Ga0307406_10049477 3300031901 Bacteria 2660
397 Ga0307406_10187013 3300031901 Bacteria 1513
398 Ga0307416_100330126 3300032002 Bacteria 1532
399 Ga0373926_0037841 3300035083 Bacteria 1717
400 Ga0373929_0011178 3300035085 Bacteria 1688
401 Ga0373934_0032716 3300035086 Bacteria 2040
402 Ga0373934_0039856 3300035086 Bacteria 1852
403 Ga0373923_0060619 3300035111 Bacteria 1606
404 Ga0373923_0065884 3300035111 Unclassified 1547
405 Ga0373932_0019512 3300035112 Bacteria 1768
406 Ga0373936_0009564 3300035113 Bacteria 3653
407 Ga0373936_0047872 3300035113 Bacteria 1725
408 Ga0373936_0067194 3300035113 Bacteria 1473
409 Ga0373945_0000987 3300035116 Bacteria 8487
410 Ga0373945_0026416 3300035116 Bacteria 2022
411 Ga0373945_0029376 3300035116 Bacteria 1931
412 Ga0373945_0039813 3300035116 Bacteria 1695
413 Ga0373953_0007621 3300035117 Bacteria 3634
414 Ga0373953_0051450 3300035117 Bacteria 1665
415 Ga0373953_0063331 3300035117 Bacteria 1515
416 Ga0373954_0039893 3300035118 Bacteria 2186
417 Ga0373954_0076272 3300035118 Bacteria 1597
418 Ga0373954_0080841 3300035118 Bacteria 1552
419 Ga0373956_0003135 3300035119 Bacteria 6685
420 Ga0373956_0009228 3300035119 Bacteria 4004
421 Ga0373956_0068585 3300035119 Bacteria 1615
422 Ga0373957_0019161 3300035120 Bacteria 2404
423 Ga0373957_0032571 3300035120 Bacteria 1920
424 Ga0373957_0038703 3300035120 Bacteria 1786
425 Ga0373943_0055635 3300035170 Bacteria 1960
426 Ga0373943_0072355 3300035170 Bacteria 1748
427 Ga0373943_0104222 3300035170 Bacteria 1488
428 Ga0373946_0040095 3300035171 Bacteria 1914
429 Ga0373946_0042439 3300035171 Bacteria 1869
430 Ga0373946_0065469 3300035171 Bacteria 1556
431 Ga0373955_0061204 3300035172 Bacteria 2078
432 Ga0373955_0082980 3300035172 Bacteria 1814
433 Ga0373955_0140585 3300035172 Unclassified 1415
434 Ga0373961_0040016 3300035241 Bacteria 1349
435 Ga0373924_0017351 3300035410 Unclassified 2760
436 Ga0373924_0026042 3300035410 Bacteria 2316
437 Ga0373924_0066294 3300035410 Bacteria 1517
438 Ga0373931_0079790 3300035691 Bacteria 1803
439 Ga0373931_0089103 3300035691 Bacteria 1716
440 Ga0373935_0033673 3300035692 Unclassified 3190
441 Ga0373935_0106626 3300035692 Bacteria 1854
442 Ga0373935_0127633 3300035692 Unclassified 1705
443 Ga0373935_0147583 3300035692 Bacteria 1593
444 Ga0373935_0186007 3300035692 Bacteria 1428
445 Ga0373927_0120712 3300035695 Bacteria 1710
446 Ga0373927_0139272 3300035695 Bacteria 1586
447 Ga0373927_0206633 3300035695 Bacteria 1289
448 Ga0373933_0003803 3300035724 Bacteria 8345
449 Ga0373933_0020833 3300035724 Bacteria 3718
450 Ga0373933_0060894 3300035724 Bacteria 2276
451 Ga0373947_0075167 3300035725 Bacteria 2079
452 Ga0373947_0087331 3300035725 Bacteria 1939
453 Ga0373947_0133841 3300035725 Bacteria 1585
454 Ga0373947_0134953 3300035725 Bacteria 1578
455 Ga0373947_0171122 3300035725 Bacteria 1409
456 Ga0373937_0082509 3300036401 Bacteria 2974
457 Ga0373937_0169931 3300036401 Bacteria 2046
458 Ga0373925_0016172 3300037068 Bacteria 5401
459 Ga0373925_0088154 3300037068 Bacteria 2369
460 Ga0373925_0155147 3300037068 Bacteria 1800
461 Ga0373925_0179848 3300037068 Unclassified 1673
462 Ga0373925_0231507 3300037068 Bacteria 1477
463 Ga0395900_0453382 3300037418 Bacteria 1238
464 Ga0395898_0222684 3300037466 Unclassified 1799
465 Ga0316581_0039703 3300037588 Bacteria 1433
466 Ga0436364_0204662 3300037853 Bacteria 1905
467 Ga0436364_0440491 3300037853 Bacteria 1659
468 Ga0436364_1208221 3300037853 Bacteria 5126
469 Ga0436364_1554448 3300037853 Bacteria 11409
470 Ga0395901_0198528 3300038443 Bacteria 2103
471 Ga0395901_0381723 3300038443 Bacteria 1450
472 Ga0242419_001257 3300038698 Bacteria 1539
473 Ga0242420_005085 3300038996 Bacteria 2020
474 Ga0242420_011656 3300038996 Bacteria 1478
475 Ga0436365_0469483 3300039437 Unclassified 2590
476 Ga0436360_0464691 3300039438 Bacteria 2534
477 Ga0436360_1091598 3300039438 Unclassified 1371
478 Ga0436360_1184589 3300039438 Bacteria 2058
479 Ga0436361_0228305 3300039447 Bacteria 1829
480 Ga0436361_0888187 3300039447 Bacteria 2672
481 Ga0436363_0172554 3300039450 Bacteria 1583
482 Ga0436362_0554849 3300039453 Bacteria 1885
483 Ga0439464_0050350 3300042439 Bacteria 1203
484 Ga0451577_0190630 3300042876 Bacteria 1849
485 Ga0451577_0197643 3300042876 Bacteria 1815
486 Ga0451577_0215867 3300042876 Bacteria 1733
487 Ga0451577_0266450 3300042876 Bacteria 1551
488 Ga0453683_0136227 3300044673 Bacteria 1548
489 Ga0453683_0157630 3300044673 Bacteria 1435
490 Ga0453683_0165548 3300044673 Bacteria 1399
491 Ga0466966_0129756 3300044684 Bacteria 1544
492 Ga0466961_0092976 3300044693 Bacteria 1903
493 Ga0466963_0147398 3300044694 Bacteria 1633
494 Ga0453684_0280023 3300044712 Bacteria 1902
495 Ga0453684_0333259 3300044712 Bacteria 1715
496 Ga0453684_0385165 3300044712 Bacteria 1573
497 Ga0453684_0494233 3300044712 Bacteria 1355
498 Ga0466971_0070005 3300044719 Bacteria 1592
499 Ga0466968_0023697 3300044735 Bacteria 2503
500 Ga0466970_0055537 3300044765 Bacteria 2115
501 Ga0466957_0062551 3300044842 Bacteria 2286
502 Ga0466960_0069109 3300044901 Bacteria 1754
503 Ga0466959_0171378 3300045049 Bacteria 1522
504 Ga0451576_0251476 3300045051 Unclassified 1847
505 Ga0451576_0261665 3300045051 Unclassified 1808
506 Ga0451576_0391390 3300045051 Bacteria 1457
507 Ga0466967_0230413 3300045976 Bacteria 1763
508 Ga0466967_0308868 3300045976 Bacteria 1523
509 Ga0466967_0331206 3300045976 Bacteria 1470
510 Ga0495592_0070752 3300046454 Bacteria 2540
511 Ga0495592_0096702 3300046454 Bacteria 2110
512 Ga0495592_0160445 3300046454 Bacteria 1547
513 Ga0495629_0105163 3300046459 Bacteria 1969
514 Ga0495629_0164104 3300046459 Bacteria 1543
515 Ga0495638_0109358 3300046460 Bacteria 1643
516 Ga0495651_0043111 3300046462 Bacteria 3501
517 Ga0495651_0103506 3300046462 Bacteria 2115
518 Ga0495653_0122754 3300046463 Bacteria 1848
519 Ga0495653_0154009 3300046463 Bacteria 1603
520 Ga0495580_0073598 3300046472 Bacteria 2385
521 Ga0495580_0127890 3300046472 Bacteria 1763
522 Ga0495580_0137905 3300046472 Bacteria 1691
523 Ga0495580_0242840 3300046472 Bacteria 1234
524 Ga0495582_0080288 3300046473 Bacteria 1811
525 Ga0495582_0089169 3300046473 Bacteria 1718
526 Ga0495582_0120596 3300046473 Bacteria 1477
527 Ga0495639_0048854 3300046475 Bacteria 1919
528 Ga0495662_0090102 3300046476 Bacteria 1495
529 Ga0495662_0110656 3300046476 Bacteria 1346
530 Ga0495664_0043836 3300046477 Unclassified 2651
531 Ga0495664_0146207 3300046477 Bacteria 1433
532 Ga0495594_0018679 3300046499 Bacteria 3675
533 Ga0495583_0063183 3300046506 Bacteria 1646
534 Ga0495608_0097193 3300046511 Bacteria 1901
535 Ga0495608_0112904 3300046511 Bacteria 1746
536 Ga0495608_0115737 3300046511 Bacteria 1721
537 Ga0495618_0068405 3300046514 Bacteria 2258
538 Ga0495628_0166249 3300046516 Bacteria 1674
539 Ga0495630_0042002 3300046517 Bacteria 3415
540 Ga0495630_0110168 3300046517 Bacteria 2085
541 Ga0495666_0057454 3300046526 Unclassified 1862
542 Ga0495652_0119987 3300046529 Bacteria 2099
543 Ga0495652_0129978 3300046529 Bacteria 1995
544 Ga0495652_0140219 3300046529 Bacteria 1902
545 Ga0495665_0050102 3300046531 Bacteria 2214
546 Ga0495665_0061276 3300046531 Bacteria 1986
547 Ga0495665_0094320 3300046531 Unclassified 1572
548 Ga0495640_0056846 3300046533 Unclassified 2671
549 Ga0495640_0097773 3300046533 Bacteria 1930
550 Ga0495640_0137766 3300046533 Bacteria 1575
551 Ga0495586_0074111 3300046535 Unclassified 1862
552 Ga0495587_0038821 3300046536 Bacteria 2852
553 Ga0495587_0044137 3300046536 Bacteria 2652
554 Ga0495587_0089806 3300046536 Bacteria 1775
555 Ga0495587_0128009 3300046536 Bacteria 1452
556 Ga0495645_0095550 3300046543 Bacteria 2118
557 Ga0495645_0145099 3300046543 Bacteria 1653
558 Ga0495667_0076953 3300046559 Bacteria 2170
559 Ga0495667_0112399 3300046559 Bacteria 1760
560 Ga0495634_0099858 3300046642 Bacteria 1876
561 Ga0495625_0196247 3300046660 Bacteria 1334
562 Ga0495635_0171258 3300046663 Bacteria 1476
563 Ga0495588_0149576 3300046674 Bacteria 1234
564 Ga0495657_0126439 3300046675 Bacteria 1605
565 Ga0495599_0112130 3300046678 Bacteria 1698
566 Ga0495599_0134306 3300046678 Bacteria 1536
567 Ga0495623_0085314 3300046679 Bacteria 1947
568 Ga0495623_0096805 3300046679 Bacteria 1803
569 Ga0495623_0126635 3300046679 Bacteria 1533
570 Ga0495646_0087858 3300046680 Bacteria 1801
571 Ga0495669_0067577 3300046684 Unclassified 1625
572 Ga0495613_0149500 3300046689 Bacteria 1666
573 Ga0495624_0101387 3300046690 Bacteria 1772
574 Ga0495600_0070186 3300046809 Bacteria 2289
575 Ga0495600_0153148 3300046809 Bacteria 1492
576 Ga0495604_0119510 3300047317 Bacteria 1909
577 Ga0495604_0136373 3300047317 Bacteria 1758
578 Ga0495604_0154274 3300047317 Bacteria 1628
579 Ga0495604_0196541 3300047317 Bacteria 1402
580 Ga0495674_0140721 3300047319 Bacteria 2028
581 Ga0495674_0162581 3300047319 Bacteria 1867
582 Ga0495674_0194754 3300047319 Bacteria 1683
583 Ga0495680_0046296 3300047322 Bacteria 3430
584 Ga0495675_0033592 3300047444 Bacteria 3274
585 Ga0495675_0129034 3300047444 Bacteria 1572
586 Ga0495675_0140815 3300047444 Bacteria 1495
587 Ga0495684_0032147 3300047471 Bacteria 4027
588 Ga0495684_0062332 3300047471 Bacteria 2836
589 Ga0495684_0089759 3300047471 Bacteria 2328
590 Ga0495684_0146615 3300047471 Bacteria 1767
591 Ga0495602_0057676 3300048088 Bacteria 3404
592 Ga0495602_0186549 3300048088 Bacteria 1594
593 Ga0496100_0205627 3300048903 Bacteria 1437
594 Ga0496101_0245382 3300048904 Bacteria 1394
595 Ga0496104_0147256 3300048907 Unclassified 2261
596 Ga0496104_0179335 3300048907 Unclassified 2028
597 Ga0496104_0221242 3300048907 Bacteria 1805
598 Ga0496104_0281536 3300048907 Bacteria 1576
599 Ga0496105_0117898 3300048908 Unclassified 2189
600 Ga0496105_0210142 3300048908 Bacteria 1586
601 Ga0496106_0150525 3300048909 Bacteria 1835
602 Ga0496106_0165105 3300048909 Bacteria 1752
603 Ga0496106_0258074 3300048909 Bacteria 1394
604 Ga0496107_0216787 3300048910 Bacteria 1423
605 Ga0496108_0139612 3300048911 Bacteria 2087
606 Ga0496109_0375206 3300048912 Bacteria 1343
607 Ga0496110_0157379 3300048913 Bacteria 2058
608 Ga0496111_0076945 3300048914 Unclassified 2432
609 Ga0496112_0248581 3300048915 Unclassified 1730
610 Ga0496112_0300124 3300048915 Bacteria 1552
611 Ga0496113_0098272 3300048916 Bacteria 2266
612 Ga0496113_0244969 3300048916 Bacteria 1430
613 Ga0496115_0128482 3300048918 Bacteria 2088
614 Ga0496115_0257379 3300048918 Unclassified 1436
615 Ga0501031_0134512 3300049568 Bacteria 1615
616 Ga0501032_0064489 3300049569 Bacteria 2452
617 Ga0501033_0041080 3300049570 Bacteria 3452
618 Ga0501034_0258843 3300049571 Bacteria 1683
619 Ga0501034_0352167 3300049571 Bacteria 1400
620 Ga0501036_0187834 3300049572 Bacteria 1739
621 Ga0501037_0173462 3300049573 Bacteria 1532
622 Ga0501038_0069478 3300049574 Bacteria 2992
623 Ga0501043_0194881 3300049579 Bacteria 1574
624 Ga0501043_0241034 3300049579 Bacteria 1394
625 Ga0501046_0190692 3300049580 Bacteria 1529
626 Ga0501047_0302614 3300049581 Bacteria 1441
627 Ga0501048_0143014 3300049582 Bacteria 1691
628 Ga0501048_0143596 3300049582 Bacteria 1688
629 Ga0501070_0162733 3300049586 Bacteria 1839
630 Ga0501074_0175016 3300049590 Bacteria 1531
631 Ga0501079_0160600 3300049741 Bacteria 1752
632 Ga0501080_0172905 3300049742 Bacteria 1991
633 Ga0501080_0181154 3300049742 Bacteria 1938
634 Ga0501035_0277086 3300049822 Bacteria 1418
635 Ga0501035_0283814 3300049822 Bacteria 1399
636 Ga0501045_0027287 3300049824 Bacteria 4113
637 nmdc:mga0n895_219449_c1 3300050512 Bacteria 1931
638 nmdc:mga0n895_243129_c1 3300050512 Bacteria 1827
639 nmdc:mga0rr50_118203_c1 3300050513 Bacteria 2106
640 nmdc:mga08x19_194404_c1 3300050514 Bacteria 1389
641 nmdc:mga0a205_295108_c1 3300050515 Bacteria 1495
642 Ga0495601_0107198 3300053077 Bacteria 1807
643 Ga0495612_0038798 3300053078 Unclassified 1936
644 Ga0495612_0050741 3300053078 Bacteria 1704
645 Ga0495595_0067266 3300053084 Bacteria 1688
646 Ga0495595_0085590 3300053084 Bacteria 1507
647 Ga0495619_0085949 3300053085 Bacteria 2125
648 Ga0495619_0146003 3300053085 Bacteria 1631
649 Ga0495619_0161744 3300053085 Bacteria 1546
650 Ga0500593_080841 3300053117 Bacteria 1393
651 Ga0500594_0015027 3300053118 Bacteria 1862
652 Ga0500617_088661 3300053124 Bacteria 1328
653 Ga0500658_0068143 3300053134 Bacteria 1495
654 Ga0500568_0024724 3300053139 Bacteria 2541
655 Ga0500588_0008660 3300053146 Bacteria 2387
656 Ga0500616_0010868 3300053153 Bacteria 5424
657 Ga0501084_0195795 3300054114 Bacteria 1705
658 Ga0501082_0143211 3300060353 Unclassified 2074
659 Ga0501082_0179143 3300060353 Bacteria 1843
660 2644123779 2643221621 Bacteria 6212786
661 Ga0207698_10156783
662 JGI24741J21665_1014103
663 JGI24743J22301_10011957
664 JGI24735J21928_10033346
665 JGI24738J21930_10021809
666 rootL2_10012909
667 rootH1_10068339
668 Ga0065704_10077942
669 Ga0065715_10160914
670 Ga0065707_10082119
671 Ga0070658_10093772
672 Ga0070676_10069573
673 Ga0070683_100248313
674 Ga0070683_100259714
675 Ga0070683_100396833
676 Ga0070690_100111006
677 Ga0070690_100136371
678 Ga0070690_100160113
679 Ga0070670_100057403
680 Ga0070670_100174429
681 Ga0070670_100268975
682 Ga0070670_100314301
683 Ga0068869_100121297
684 Ga0068869_100190888
685 Ga0070666_10056101
686 Ga0070666_10068003
687 Ga0070666_10084683
688 Ga0070680_100161278
689 Ga0070682_100088613
690 Ga0068868_100127713
691 Ga0070660_100171390
692 Ga0070660_100243809
693 Ga0070689_100076125
694 Ga0070689_100148984
695 Ga0070689_100215239
696 Ga0070687_100106718
697 Ga0070687_100126144
698 Ga0070661_100187102
699 Ga0070692_10103769
700 Ga0070668_100277921
701 Ga0070675_100159301
702 Ga0070671_100150617
703 Ga0070673_100109705
704 Ga0070673_100183239
705 Ga0070673_100244750
706 Ga0070688_100040817
707 Ga0070659_100203619
708 Ga0070659_100242465
709 Ga0070667_100120165
710 Ga0070667_100130492
711 Ga0070667_100155452
712 Ga0070667_100326229
713 Ga0070714_100179472
714 Ga0070714_100254662
715 Ga0070713_100183474
716 Ga0070710_10049316
717 Ga0070711_100065302
718 Ga0070694_100210419
719 Ga0070678_100136153
720 Ga0070678_100249495
721 Ga0070681_10112792
722 Ga0070681_10211616
723 Ga0068867_100166416
724 Ga0070685_10089677
725 Ga0070685_10104527
726 Ga0070698_100226345
727 Ga0070698_100263502
728 Ga0070699_100188697
729 Ga0070679_100402631
730 Ga0070684_100173657
731 Ga0070684_100191873
732 Ga0070684_100229535
733 Ga0070684_100241711
734 Ga0070684_100243884
735 Ga0070684_100298920
736 Ga0070697_100094132
737 Ga0068853_100121199
738 Ga0068853_100205624
739 Ga0068853_100262641
740 Ga0068853_100388056
741 Ga0070672_100205999
742 Ga0070686_100045845
743 Ga0070686_100210309
744 Ga0070686_100237980
745 Ga0070696_100206748
746 Ga0070693_100120854
747 Ga0070665_100303566
748 Ga0070665_100341349
749 Ga0070704_100025663
750 Ga0070704_100241892
751 Ga0068855_100114940
752 Ga0068855_100227959
753 Ga0068855_100280230
754 Ga0068855_100396296
755 Ga0070664_100104335
756 Ga0070664_100125825
757 Ga0070664_100259590
758 Ga0070664_100347721
759 Ga0068857_100079873
760 Ga0068857_100193821
761 Ga0068857_100206866
762 Ga0068857_100253291
763 Ga0068857_100319329
764 Ga0068854_100173193
765 Ga0068854_100201110
766 Ga0068856_100050878
767 Ga0068856_100279996
768 Ga0070702_100087083
769 Ga0070702_100141328
770 Ga0068852_100158080
771 Ga0068852_100221985
772 Ga0068852_100250595
773 Ga0068859_100159135
774 Ga0068859_100260607
775 Ga0068859_100313357
776 Ga0068859_100319460
777 Ga0068859_100377412
778 Ga0068859_100441184
779 Ga0068864_100089640
780 Ga0068864_100275239
781 Ga0068866_10154784
782 Ga0068861_100185841
783 Ga0068870_10133254
784 Ga0068863_100063597
785 Ga0068863_100069809
786 Ga0068863_100256829
787 Ga0068858_100112101
788 Ga0068858_100159827
789 Ga0068858_100160689
790 Ga0068858_100238626
791 Ga0068860_100182062
792 Ga0068860_100233062
793 Ga0068862_100280913
794 Ga0068862_100349590
795 Ga0081455_10000065
796 Ga0081455_10208409
797 Ga0081540_1029918
798 Ga0070717_10072606
799 Ga0070717_10147564
800 Ga0070715_10029798
801 Ga0070715_10067096
802 Ga0070716_100076955
803 Ga0070716_100090853
804 Ga0070716_100123414
805 Ga0070712_100118978
806 Ga0097621_100065653
807 Ga0097621_100184157
808 Ga0097621_100213044
809 Ga0068871_100128711
810 Ga0068871_100170503
811 Ga0068871_100204830
812 Ga0068871_100264994
813 Ga0075428_100258586
814 Ga0075433_10289600
815 Ga0075434_100098587
816 Ga0075434_100217381
817 Ga0068865_100199404
818 Ga0097620_100159136
819 Ga0097620_100260596
820 Ga0097620_100313337
821 Ga0097620_100319458
822 Ga0097620_100377394
823 Ga0097620_100441133
824 Ga0099826_10089341
825 Ga0075435_100135657
826 Ga0105240_10199968
827 Ga0105240_10326040
828 Ga0105240_10343556
829 Ga0105240_10468144
830 Ga0111539_10341733
831 Ga0105245_10125532
832 Ga0105245_10164894
833 Ga0105245_10238659
834 Ga0105247_10043279
835 Ga0105243_10072013
836 Ga0105243_10080391
837 Ga0105243_10312761
838 Ga0105241_10094328
839 Ga0105241_10197767
840 Ga0105241_10200557
841 Ga0105241_10218725
842 Ga0105241_10227760
843 Ga0105242_10129016
844 Ga0105242_10170429
845 Ga0105242_10225488
846 Ga0105242_10266413
847 Ga0105248_10083276
848 Ga0105248_10283928
849 Ga0105248_10354287
850 Ga0105248_10393430
851 Ga0105248_10540345
852 Ga0105237_10052425
853 Ga0105237_10196887
854 Ga0105237_10233244
855 Ga0105237_10250710
856 Ga0105237_10291876
857 Ga0105238_10047519
858 Ga0105238_10243409
859 Ga0105238_10289623
860 Ga0105238_10289748
861 Ga0105249_10291757
862 Ga0105239_10130859
863 Ga0105239_10359314
864 Ga0105239_10394572
865 Ga0105239_10405071
866 Ga0105246_10091584
867 Ga0105246_10129554
868 Ga0105246_10158870
869 Ga0157373_10152496
870 Ga0157370_10372762
871 Ga0157369_10306709
872 Ga0157374_10090184
873 Ga0157374_10247404
874 Ga0157374_10294834
875 Ga0157378_10154600
876 Ga0157378_10178288
877 Ga0157378_10219479
878 Ga0163162_10076946
879 Ga0163162_10184195
880 Ga0163162_10241915
881 Ga0163162_10349084
882 Ga0163162_10360273
883 Ga0157372_10134519
884 Ga0157372_10263623
885 Ga0157372_10365929
886 Ga0157375_10390773
887 Ga0163163_10166490
888 Ga0163163_10230365
889 Ga0163163_10235427
890 Ga0163163_10342754
891 Ga0163163_10358765
892 Ga0157380_10234998
893 Ga0157377_10058032
894 Ga0157377_10081934
895 Ga0157377_10119078
896 Ga0157379_10149178
897 Ga0157379_10188311
898 Ga0157379_10211295
899 Ga0157379_10247410
900 Ga0157376_10194978
901 Ga0157376_10218622
902 Ga0163161_10038312
903 Ga0163161_10093944
904 Ga0213872_10046760
905 Ga0213874_10033957
906 Ga0213875_10062582
907 Ga0207697_10031562
908 Ga0207692_10074681
909 Ga0207642_10114709
910 Ga0207710_10053822
911 Ga0207688_10202721
912 Ga0207680_10053102
913 Ga0207680_10067966
914 Ga0207680_10106673
915 Ga0207680_10141880
916 Ga0207685_10050918
917 Ga0207685_10080933
918 Ga0207645_10112782
919 Ga0207645_10138125
920 Ga0207645_10175735
921 Ga0207643_10133503
922 Ga0207705_10179962
923 Ga0207654_10168506
924 Ga0207654_10178929
925 Ga0207707_10146805
926 Ga0207707_10278915
927 Ga0207695_10190267
928 Ga0207695_10254036
929 Ga0207695_10289970
930 Ga0207695_10346236
931 Ga0207671_10199165
932 Ga0207671_10234970
933 Ga0207693_10058523
934 Ga0207693_10106873
935 Ga0207663_10035166
936 Ga0207663_10168384
937 Ga0207663_10169516
938 Ga0207660_10171399
939 Ga0207662_10133874
940 Ga0207662_10153260
941 Ga0207657_10136652
942 Ga0207657_10176157
943 Ga0207657_10225318
944 Ga0207649_10045433
945 Ga0207649_10104301
946 Ga0207649_10192417
947 Ga0207652_10153955
948 Ga0207694_10175161
949 Ga0207694_10214082
950 Ga0207694_10243417
951 Ga0207650_10120825
952 Ga0207650_10143211
953 Ga0207650_10216434
954 Ga0207650_10236669
955 Ga0207659_10165578
956 Ga0207687_10075448
957 Ga0207687_10262782
958 Ga0207700_10206744
959 Ga0207700_10249701
960 Ga0207664_10233078
961 Ga0207644_10180849
962 Ga0207644_10235746
963 Ga0207690_10171460
964 Ga0207690_10258976
965 Ga0207686_10110035
966 Ga0207686_10157942
967 Ga0207686_10199499
968 Ga0207709_10137514
969 Ga0207670_10157828
970 Ga0207704_10201513
971 Ga0207704_10203544
972 Ga0207665_10132620
973 Ga0207711_10139974
974 Ga0207711_10255413
975 Ga0207689_10080905
976 Ga0207689_10116730
977 Ga0207661_10113149
978 Ga0207661_10131674
979 Ga0207661_10162006
980 Ga0207661_10172464
981 Ga0207661_10261287
982 Ga0207661_10324116
983 Ga0207679_10203811
984 Ga0207667_10280648
985 Ga0207667_10310944
986 Ga0207667_10372994
987 Ga0207667_10375798
988 Ga0207651_10246078
989 Ga0207651_10285431
990 Ga0207658_10171762
991 Ga0207658_10224673
992 Ga0207658_10276630
993 Ga0207677_10194148
994 Ga0207677_10276136
995 Ga0207703_10174971
996 Ga0207703_10253566
997 Ga0207703_10358173
998 Ga0207639_10200214
999 Ga0207639_10203830
1000 Ga0207639_10231353
1001 Ga0207639_10336284
1002 Ga0207702_10065905
1003 Ga0207702_10334886
1004 Ga0207641_10235800
1005 Ga0207641_10269716
1006 Ga0207641_10281840
1007 Ga0207648_10069604
1008 Ga0207648_10097301
1009 Ga0207676_10085707
1010 Ga0207676_10294374
1011 Ga0207674_10079251
1012 Ga0207674_10138832
1013 Ga0207674_10161890
1014 Ga0207674_10225691
1015 Ga0207674_10237905
1016 Ga0207675_100140742
1017 Ga0207683_10073452
1018 Ga0207683_10189273
1019 Ga0207698_10174354
1020 Ga0207698_10181363
1021 Ga0207698_10378874
1022 Ga0268266_10183876
1023 Ga0268266_10217571
1024 Ga0268266_10267318
1025 Ga0268265_10324751
1026 Ga0268264_10233917
1027 Ga0268264_10287267
1028 Ga0268264_10322056
1029 Ga0265326_10033391
1030 Ga0265319_1045032
1031 Ga0265334_10048565
1032 Ga0265318_10055071
1033 Ga0265323_10027546
1034 Ga0265322_10031821
1035 Ga0265338_10185155
1036 Ga0265338_10188886
1037 Ga0265324_10046602
1038 Ga0265330_10041824
1039 Ga0265332_10070218
1040 Ga0265320_10081274
1041 Ga0265325_10093491
1042 Ga0265329_10040335
1043 Ga0265329_10041582
1044 Ga0265340_10085060
1045 Ga0265339_10117443
1046 Ga0265331_10070404
1047 Ga0265316_10064121
1048 Ga0265316_10139551
1049 Ga0265316_10168140
1050 Ga0307513_10198922
1051 Ga0307408_100184138
1052 Ga0265313_10078646
1053 Ga0265314_10101531
1054 Ga0265314_10140355
1055 Ga0265342_10089977
1056 Ga0307406_10049477
1057 Ga0307406_10187013
1058 Ga0307416_100330126
1059 Ga0373926_0037841
1060 Ga0373929_0011178
1061 Ga0373934_0032716
1062 Ga0373934_0039856
1063 Ga0373923_0060619
1064 Ga0373923_0065884
1065 Ga0373932_0019512
1066 Ga0373936_0009564
1067 Ga0373936_0047872
1068 Ga0373936_0067194
1069 Ga0373945_0000987
1070 Ga0373945_0026416
1071 Ga0373945_0029376
1072 Ga0373945_0039813
1073 Ga0373953_0007621
1074 Ga0373953_0051450
1075 Ga0373953_0063331
1076 Ga0373954_0039893
1077 Ga0373954_0076272
1078 Ga0373954_0080841
1079 Ga0373956_0003135
1080 Ga0373956_0009228
1081 Ga0373956_0068585
1082 Ga0373957_0019161
1083 Ga0373957_0032571
1084 Ga0373957_0038703
1085 Ga0373943_0055635
1086 Ga0373943_0072355
1087 Ga0373943_0104222
1088 Ga0373946_0040095
1089 Ga0373946_0042439
1090 Ga0373946_0065469
1091 Ga0373955_0061204
1092 Ga0373955_0082980
1093 Ga0373955_0140585
1094 Ga0373961_0040016
1095 Ga0373924_0017351
1096 Ga0373924_0026042
1097 Ga0373924_0066294
1098 Ga0373931_0079790
1099 Ga0373931_0089103
1100 Ga0373935_0033673
1101 Ga0373935_0106626
1102 Ga0373935_0127633
1103 Ga0373935_0147583
1104 Ga0373935_0186007
1105 Ga0373927_0120712
1106 Ga0373927_0139272
1107 Ga0373927_0206633
1108 Ga0373933_0003803
1109 Ga0373933_0020833
1110 Ga0373933_0060894
1111 Ga0373947_0075167
1112 Ga0373947_0087331
1113 Ga0373947_0133841
1114 Ga0373947_0134953
1115 Ga0373947_0171122
1116 Ga0373937_0082509
1117 Ga0373937_0169931
1118 Ga0373925_0016172
1119 Ga0373925_0088154
1120 Ga0373925_0155147
1121 Ga0373925_0179848
1122 Ga0373925_0231507
1123 Ga0395900_0453382
1124 Ga0395898_0222684
1125 Ga0316581_0039703
1126 Ga0436364_0204662
1127 Ga0436364_0440491
1128 Ga0436364_1208221
1129 Ga0436364_1554448
1130 Ga0395901_0198528
1131 Ga0395901_0381723
1132 Ga0242419_001257
1133 Ga0242420_005085
1134 Ga0242420_011656
1135 Ga0436365_0469483
1136 Ga0436360_0464691
1137 Ga0436360_1091598
1138 Ga0436360_1184589
1139 Ga0436361_0228305
1140 Ga0436361_0888187
1141 Ga0436363_0172554
1142 Ga0436362_0554849
1143 Ga0439464_0050350
1144 Ga0451577_0190630
1145 Ga0451577_0197643
1146 Ga0451577_0215867
1147 Ga0451577_0266450
1148 Ga0453683_0136227
1149 Ga0453683_0157630
1150 Ga0453683_0165548
1151 Ga0466966_0129756
1152 Ga0466961_0092976
1153 Ga0466963_0147398
1154 Ga0453684_0280023
1155 Ga0453684_0333259
1156 Ga0453684_0385165
1157 Ga0453684_0494233
1158 Ga0466971_0070005
1159 Ga0466968_0023697
1160 Ga0466970_0055537
1161 Ga0466957_0062551
1162 Ga0466960_0069109
1163 Ga0466959_0171378
1164 Ga0451576_0251476
1165 Ga0451576_0261665
1166 Ga0451576_0391390
1167 Ga0466967_0230413
1168 Ga0466967_0308868
1169 Ga0466967_0331206
1170 Ga0495592_0070752
1171 Ga0495592_0096702
1172 Ga0495592_0160445
1173 Ga0495629_0105163
1174 Ga0495629_0164104
1175 Ga0495638_0109358
1176 Ga0495651_0043111
1177 Ga0495651_0103506
1178 Ga0495653_0122754
1179 Ga0495653_0154009
1180 Ga0495580_0073598
1181 Ga0495580_0127890
1182 Ga0495580_0137905
1183 Ga0495580_0242840
1184 Ga0495582_0080288
1185 Ga0495582_0089169
1186 Ga0495582_0120596
1187 Ga0495639_0048854
1188 Ga0495662_0090102
1189 Ga0495662_0110656
1190 Ga0495664_0043836
1191 Ga0495664_0146207
1192 Ga0495594_0018679
1193 Ga0495583_0063183
1194 Ga0495608_0097193
1195 Ga0495608_0112904
1196 Ga0495608_0115737
1197 Ga0495618_0068405
1198 Ga0495628_0166249
1199 Ga0495630_0042002
1200 Ga0495630_0110168
1201 Ga0495666_0057454
1202 Ga0495652_0119987
1203 Ga0495652_0129978
1204 Ga0495652_0140219
1205 Ga0495665_0050102
1206 Ga0495665_0061276
1207 Ga0495665_0094320
1208 Ga0495640_0056846
1209 Ga0495640_0097773
1210 Ga0495640_0137766
1211 Ga0495586_0074111
1212 Ga0495587_0038821
1213 Ga0495587_0044137
1214 Ga0495587_0089806
1215 Ga0495587_0128009
1216 Ga0495645_0095550
1217 Ga0495645_0145099
1218 Ga0495667_0076953
1219 Ga0495667_0112399
1220 Ga0495634_0099858
1221 Ga0495625_0196247
1222 Ga0495635_0171258
1223 Ga0495588_0149576
1224 Ga0495657_0126439
1225 Ga0495599_0112130
1226 Ga0495599_0134306
1227 Ga0495623_0085314
1228 Ga0495623_0096805
1229 Ga0495623_0126635
1230 Ga0495646_0087858
1231 Ga0495669_0067577
1232 Ga0495613_0149500
1233 Ga0495624_0101387
1234 Ga0495600_0070186
1235 Ga0495600_0153148
1236 Ga0495604_0119510
1237 Ga0495604_0136373
1238 Ga0495604_0154274
1239 Ga0495604_0196541
1240 Ga0495674_0140721
1241 Ga0495674_0162581
1242 Ga0495674_0194754
1243 Ga0495680_0046296
1244 Ga0495675_0033592
1245 Ga0495675_0129034
1246 Ga0495675_0140815
1247 Ga0495684_0032147
1248 Ga0495684_0062332
1249 Ga0495684_0089759
1250 Ga0495684_0146615
1251 Ga0495602_0057676
1252 Ga0495602_0186549
1253 Ga0496100_0205627
1254 Ga0496101_0245382
1255 Ga0496104_0147256
1256 Ga0496104_0179335
1257 Ga0496104_0221242
1258 Ga0496104_0281536
1259 Ga0496105_0117898
1260 Ga0496105_0210142
1261 Ga0496106_0150525
1262 Ga0496106_0165105
1263 Ga0496106_0258074
1264 Ga0496107_0216787
1265 Ga0496108_0139612
1266 Ga0496109_0375206
1267 Ga0496110_0157379
1268 Ga0496111_0076945
1269 Ga0496112_0248581
1270 Ga0496112_0300124
1271 Ga0496113_0098272
1272 Ga0496113_0244969
1273 Ga0496115_0128482
1274 Ga0496115_0257379
1275 Ga0501031_0134512
1276 Ga0501032_0064489
1277 Ga0501033_0041080
1278 Ga0501034_0258843
1279 Ga0501034_0352167
1280 Ga0501036_0187834
1281 Ga0501037_0173462
1282 Ga0501038_0069478
1283 Ga0501043_0194881
1284 Ga0501043_0241034
1285 Ga0501046_0190692
1286 Ga0501047_0302614
1287 Ga0501048_0143014
1288 Ga0501048_0143596
1289 Ga0501070_0162733
1290 Ga0501074_0175016
1291 Ga0501079_0160600
1292 Ga0501080_0172905
1293 Ga0501080_0181154
1294 Ga0501035_0277086
1295 Ga0501035_0283814
1296 Ga0501045_0027287
1297 nmdc:mga0n895_219449_c1
1298 nmdc:mga0n895_243129_c1
1299 nmdc:mga0rr50_118203_c1
1300 nmdc:mga08x19_194404_c1
1301 nmdc:mga0a205_295108_c1
1302 Ga0495601_0107198
1303 Ga0495612_0038798
1304 Ga0495612_0050741
1305 Ga0495595_0067266
1306 Ga0495595_0085590
1307 Ga0495619_0085949
1308 Ga0495619_0146003
1309 Ga0495619_0161744
1310 Ga0500593_080841
1311 Ga0500594_0015027
1312 Ga0500617_088661
1313 Ga0500658_0068143
1314 Ga0500568_0024724
1315 Ga0500588_0008660
1316 Ga0500616_0010868
1317 Ga0501084_0195795
1318 Ga0501082_0143211
1319 Ga0501082_0179143
1320 2644123779

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00872

Transposase_mut

Transposase, Mutator family

36

411

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg8-assembly1.cif.gz_B iscth4 transposase, pre-cleaved complex, pcc 0.8157 1 399
6xgx-assembly1.cif.gz_B iscth4 transposase, strand transfer complex 1, stc1 0.8147 1 400
6xg8-assembly1.cif.gz_B iscth4 transposase, pre-cleaved complex, pcc 0.8046 1 399
6xgx-assembly1.cif.gz_B iscth4 transposase, strand transfer complex 1, stc1 0.7992 1 400
6xgw-assembly1.cif.gz_B iscth4 transposase, pre-reaction complex, prc 0.7783 1 399
ID Description Score Start End Superfamily
af_K7LV62_47_129_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8498 200 263 3.30.420.10
af_A0A0P0VVK9_357_451_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8065 167 261 3.30.420.10
af_I1MFY3_263_357_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7973 167 263 3.30.420.10
af_A0A0P0VHN3_509_601_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7914 184 257 3.30.420.10
af_A0A0N7KL01_497_591_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7875 168 261 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4R9BZJ2-F1-model_v4 Mutator family transposase 0.9893 140 265 GO:0003677
GO:0004803
GO:0006313
AF-L1QGH8-F1-model_v4 Mutator family transposase 0.9839 172 270 GO:0003677
GO:0004803
GO:0006313
AF-A0A3D1RMU3-F1-model_v4 Mutator family transposase 0.9808 191 308 GO:0003677
GO:0004803
GO:0006313
AF-A0A2A5K2R8-F1-model_v4 deleted 0.9774 160 259
AF-A0A1G6E8S5-F1-model_v4 Mutator family transposase 0.9745 6 107 GO:0003677
GO:0004803
GO:0006313

Map