F473340
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 332 | 1320 | 407 |
Family's Representative Sequence
| Representative Sequence | 3300026142|Ga0207698_10156783|Ga0207698_101567832 |
| Length | 435 |
| Sequence | MTSKTISDSERNPSQSAGSAQSQTRAAVDRLAGLLPPEALEDALKGLEPEEITGPGGLLTQLAGRVIETALGAELTEHLGHPPGGVTQGPNVRNGAGRKTVKTELGAVEVRTPRDRNGSFEPKIVGKHQRRFTGFDDKILSMYARGMSTREIQGHLAEIYQVEISPSLISEVTDAVLEEVKAWQSRPLESLYPVLFLDALMVKMRHEGRVENRAVYVAIGIDSQGQKDVLGLWTSANEGAKFWLQVLTDLKNRGVKDVFIACVDGLKGFPQAIETVFPQAQVQLCIVHLTRASLNYVTWKDRKAVAADLKTIYRADTVEQAEQELENLSKKWGTRYPTVALIWSRNWNQVTPFFAFPAEIRRIIYTTNAVESLNMSLRKIIKTRGAFPSEEVGIKLLYLALSNVVKKWETVQHWRQAMARFTLLWDDPIQAAAQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 194 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 222 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 324 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 325 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 326 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0.15 |
| Rhizoplane | 3.33 |
| Rhizosphere | 93.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207698_10156783 | 3300026142 | Bacteria | 1985 |
| 2 | JGI24741J21665_1014103 | 3300001915 | Bacteria | 1342 |
| 3 | JGI24743J22301_10011957 | 3300001991 | Bacteria | 1571 |
| 4 | JGI24735J21928_10033346 | 3300002067 | Bacteria | 1521 |
| 5 | JGI24738J21930_10021809 | 3300002075 | Bacteria | 1326 |
| 6 | rootL2_10012909 | 3300003322 | Bacteria | 1464 |
| 7 | rootH1_10068339 | 3300003323 | Bacteria | 5364 |
| 8 | Ga0065704_10077942 | 3300005289 | Bacteria | 4576 |
| 9 | Ga0065715_10160914 | 3300005293 | Bacteria | 1558 |
| 10 | Ga0065707_10082119 | 3300005295 | Bacteria | 21429 |
| 11 | Ga0070658_10093772 | 3300005327 | Bacteria | 2476 |
| 12 | Ga0070676_10069573 | 3300005328 | Bacteria | 2110 |
| 13 | Ga0070683_100248313 | 3300005329 | Bacteria | 1692 |
| 14 | Ga0070683_100259714 | 3300005329 | Bacteria | 1652 |
| 15 | Ga0070683_100396833 | 3300005329 | Bacteria | 1315 |
| 16 | Ga0070690_100111006 | 3300005330 | Bacteria | 1830 |
| 17 | Ga0070690_100136371 | 3300005330 | Bacteria | 1662 |
| 18 | Ga0070690_100160113 | 3300005330 | Bacteria | 1542 |
| 19 | Ga0070670_100057403 | 3300005331 | Bacteria | 3342 |
| 20 | Ga0070670_100174429 | 3300005331 | Unclassified | 1866 |
| 21 | Ga0070670_100268975 | 3300005331 | Bacteria | 1487 |
| 22 | Ga0070670_100314301 | 3300005331 | Bacteria | 1372 |
| 23 | Ga0068869_100121297 | 3300005334 | Unclassified | 2000 |
| 24 | Ga0068869_100190888 | 3300005334 | Bacteria | 1611 |
| 25 | Ga0070666_10056101 | 3300005335 | Bacteria | 2659 |
| 26 | Ga0070666_10068003 | 3300005335 | Bacteria | 2419 |
| 27 | Ga0070666_10084683 | 3300005335 | Bacteria | 2170 |
| 28 | Ga0070680_100161278 | 3300005336 | Bacteria | 1884 |
| 29 | Ga0070682_100088613 | 3300005337 | Bacteria | 2020 |
| 30 | Ga0068868_100127713 | 3300005338 | Bacteria | 2078 |
| 31 | Ga0070660_100171390 | 3300005339 | Bacteria | 1753 |
| 32 | Ga0070660_100243809 | 3300005339 | Bacteria | 1464 |
| 33 | Ga0070689_100076125 | 3300005340 | Unclassified | 2628 |
| 34 | Ga0070689_100148984 | 3300005340 | Bacteria | 1886 |
| 35 | Ga0070689_100215239 | 3300005340 | Bacteria | 1574 |
| 36 | Ga0070687_100106718 | 3300005343 | Bacteria | 1578 |
| 37 | Ga0070687_100126144 | 3300005343 | Bacteria | 1471 |
| 38 | Ga0070661_100187102 | 3300005344 | Bacteria | 1578 |
| 39 | Ga0070692_10103769 | 3300005345 | Bacteria | 1562 |
| 40 | Ga0070668_100277921 | 3300005347 | Bacteria | 1398 |
| 41 | Ga0070675_100159301 | 3300005354 | Bacteria | 1940 |
| 42 | Ga0070671_100150617 | 3300005355 | Bacteria | 1964 |
| 43 | Ga0070673_100109705 | 3300005364 | Bacteria | 2286 |
| 44 | Ga0070673_100183239 | 3300005364 | Bacteria | 1794 |
| 45 | Ga0070673_100244750 | 3300005364 | Bacteria | 1561 |
| 46 | Ga0070688_100040817 | 3300005365 | Unclassified | 2845 |
| 47 | Ga0070659_100203619 | 3300005366 | Bacteria | 1630 |
| 48 | Ga0070659_100242465 | 3300005366 | Bacteria | 1492 |
| 49 | Ga0070667_100120165 | 3300005367 | Bacteria | 2285 |
| 50 | Ga0070667_100130492 | 3300005367 | Bacteria | 2193 |
| 51 | Ga0070667_100155452 | 3300005367 | Bacteria | 2011 |
| 52 | Ga0070667_100326229 | 3300005367 | Bacteria | 1386 |
| 53 | Ga0070714_100179472 | 3300005435 | Unclassified | 1926 |
| 54 | Ga0070714_100254662 | 3300005435 | Bacteria | 1624 |
| 55 | Ga0070713_100183474 | 3300005436 | Bacteria | 1882 |
| 56 | Ga0070710_10049316 | 3300005437 | Bacteria | 2355 |
| 57 | Ga0070711_100065302 | 3300005439 | Bacteria | 2545 |
| 58 | Ga0070694_100210419 | 3300005444 | Bacteria | 1454 |
| 59 | Ga0070678_100136153 | 3300005456 | Bacteria | 1959 |
| 60 | Ga0070678_100249495 | 3300005456 | Bacteria | 1488 |
| 61 | Ga0070681_10112792 | 3300005458 | Bacteria | 2658 |
| 62 | Ga0070681_10211616 | 3300005458 | Bacteria | 1855 |
| 63 | Ga0068867_100166416 | 3300005459 | Bacteria | 1743 |
| 64 | Ga0070685_10089677 | 3300005466 | Bacteria | 1859 |
| 65 | Ga0070685_10104527 | 3300005466 | Unclassified | 1734 |
| 66 | Ga0070698_100226345 | 3300005471 | Bacteria | 1803 |
| 67 | Ga0070698_100263502 | 3300005471 | Bacteria | 1656 |
| 68 | Ga0070699_100188697 | 3300005518 | Bacteria | 1831 |
| 69 | Ga0070679_100402631 | 3300005530 | Bacteria | 1314 |
| 70 | Ga0070684_100173657 | 3300005535 | Bacteria | 1958 |
| 71 | Ga0070684_100191873 | 3300005535 | Bacteria | 1859 |
| 72 | Ga0070684_100229535 | 3300005535 | Bacteria | 1695 |
| 73 | Ga0070684_100241711 | 3300005535 | Bacteria | 1650 |
| 74 | Ga0070684_100243884 | 3300005535 | Unclassified | 1642 |
| 75 | Ga0070684_100298920 | 3300005535 | Bacteria | 1477 |
| 76 | Ga0070697_100094132 | 3300005536 | Bacteria | 2482 |
| 77 | Ga0068853_100121199 | 3300005539 | Bacteria | 2333 |
| 78 | Ga0068853_100205624 | 3300005539 | Bacteria | 1793 |
| 79 | Ga0068853_100262641 | 3300005539 | Bacteria | 1588 |
| 80 | Ga0068853_100388056 | 3300005539 | Bacteria | 1305 |
| 81 | Ga0070672_100205999 | 3300005543 | Bacteria | 1646 |
| 82 | Ga0070686_100045845 | 3300005544 | Bacteria | 2755 |
| 83 | Ga0070686_100210309 | 3300005544 | Bacteria | 1400 |
| 84 | Ga0070686_100237980 | 3300005544 | Bacteria | 1324 |
| 85 | Ga0070696_100206748 | 3300005546 | Bacteria | 1468 |
| 86 | Ga0070693_100120854 | 3300005547 | Bacteria | 1624 |
| 87 | Ga0070665_100303566 | 3300005548 | Bacteria | 1599 |
| 88 | Ga0070665_100341349 | 3300005548 | Bacteria | 1503 |
| 89 | Ga0070704_100025663 | 3300005549 | Bacteria | 3883 |
| 90 | Ga0070704_100241892 | 3300005549 | Unclassified | 1477 |
| 91 | Ga0068855_100114940 | 3300005563 | Bacteria | 3085 |
| 92 | Ga0068855_100227959 | 3300005563 | Bacteria | 2087 |
| 93 | Ga0068855_100280230 | 3300005563 | Bacteria | 1851 |
| 94 | Ga0068855_100396296 | 3300005563 | Bacteria | 1513 |
| 95 | Ga0070664_100104335 | 3300005564 | Bacteria | 2468 |
| 96 | Ga0070664_100125825 | 3300005564 | Bacteria | 2248 |
| 97 | Ga0070664_100259590 | 3300005564 | Bacteria | 1563 |
| 98 | Ga0070664_100347721 | 3300005564 | Bacteria | 1348 |
| 99 | Ga0068857_100079873 | 3300005577 | Bacteria | 2920 |
| 100 | Ga0068857_100193821 | 3300005577 | Bacteria | 1851 |
| 101 | Ga0068857_100206866 | 3300005577 | Bacteria | 1790 |
| 102 | Ga0068857_100253291 | 3300005577 | Bacteria | 1614 |
| 103 | Ga0068857_100319329 | 3300005577 | Bacteria | 1434 |
| 104 | Ga0068854_100173193 | 3300005578 | Bacteria | 1681 |
| 105 | Ga0068854_100201110 | 3300005578 | Bacteria | 1566 |
| 106 | Ga0068856_100050878 | 3300005614 | Bacteria | 4085 |
| 107 | Ga0068856_100279996 | 3300005614 | Bacteria | 1684 |
| 108 | Ga0070702_100087083 | 3300005615 | Unclassified | 1885 |
| 109 | Ga0070702_100141328 | 3300005615 | Bacteria | 1534 |
| 110 | Ga0068852_100158080 | 3300005616 | Bacteria | 2113 |
| 111 | Ga0068852_100221985 | 3300005616 | Bacteria | 1798 |
| 112 | Ga0068852_100250595 | 3300005616 | Bacteria | 1696 |
| 113 | Ga0068859_100159135 | 3300005617 | Unclassified | 2337 |
| 114 | Ga0068859_100260607 | 3300005617 | Bacteria | 1825 |
| 115 | Ga0068859_100313357 | 3300005617 | Bacteria | 1663 |
| 116 | Ga0068859_100319460 | 3300005617 | Bacteria | 1647 |
| 117 | Ga0068859_100377412 | 3300005617 | Bacteria | 1513 |
| 118 | Ga0068859_100441184 | 3300005617 | Bacteria | 1398 |
| 119 | Ga0068864_100089640 | 3300005618 | Bacteria | 2710 |
| 120 | Ga0068864_100275239 | 3300005618 | Bacteria | 1570 |
| 121 | Ga0068866_10154784 | 3300005718 | Bacteria | 1331 |
| 122 | Ga0068861_100185841 | 3300005719 | Bacteria | 1733 |
| 123 | Ga0068870_10133254 | 3300005840 | Bacteria | 1446 |
| 124 | Ga0068863_100063597 | 3300005841 | Bacteria | 3490 |
| 125 | Ga0068863_100069809 | 3300005841 | Bacteria | 3321 |
| 126 | Ga0068863_100256829 | 3300005841 | Bacteria | 1689 |
| 127 | Ga0068858_100112101 | 3300005842 | Unclassified | 2547 |
| 128 | Ga0068858_100159827 | 3300005842 | Bacteria | 2121 |
| 129 | Ga0068858_100160689 | 3300005842 | Bacteria | 2115 |
| 130 | Ga0068858_100238626 | 3300005842 | Bacteria | 1724 |
| 131 | Ga0068860_100182062 | 3300005843 | Bacteria | 2031 |
| 132 | Ga0068860_100233062 | 3300005843 | Bacteria | 1789 |
| 133 | Ga0068862_100280913 | 3300005844 | Bacteria | 1526 |
| 134 | Ga0068862_100349590 | 3300005844 | Bacteria | 1371 |
| 135 | Ga0081455_10000065 | 3300005937 | Bacteria | 115239 |
| 136 | Ga0081455_10208409 | 3300005937 | Bacteria | 1458 |
| 137 | Ga0081540_1029918 | 3300005983 | Bacteria | 3025 |
| 138 | Ga0070717_10072606 | 3300006028 | Bacteria | 2874 |
| 139 | Ga0070717_10147564 | 3300006028 | Unclassified | 2033 |
| 140 | Ga0070715_10029798 | 3300006163 | Bacteria | 2200 |
| 141 | Ga0070715_10067096 | 3300006163 | Bacteria | 1592 |
| 142 | Ga0070716_100076955 | 3300006173 | Unclassified | 1979 |
| 143 | Ga0070716_100090853 | 3300006173 | Bacteria | 1848 |
| 144 | Ga0070716_100123414 | 3300006173 | Bacteria | 1625 |
| 145 | Ga0070712_100118978 | 3300006175 | Bacteria | 1985 |
| 146 | Ga0097621_100065653 | 3300006237 | Bacteria | 2987 |
| 147 | Ga0097621_100184157 | 3300006237 | Bacteria | 1806 |
| 148 | Ga0097621_100213044 | 3300006237 | Bacteria | 1681 |
| 149 | Ga0068871_100128711 | 3300006358 | Bacteria | 2145 |
| 150 | Ga0068871_100170503 | 3300006358 | Bacteria | 1865 |
| 151 | Ga0068871_100204830 | 3300006358 | Bacteria | 1705 |
| 152 | Ga0068871_100264994 | 3300006358 | Bacteria | 1500 |
| 153 | Ga0075428_100258586 | 3300006844 | Unclassified | 1875 |
| 154 | Ga0075433_10289600 | 3300006852 | Bacteria | 1451 |
| 155 | Ga0075434_100098587 | 3300006871 | Bacteria | 2928 |
| 156 | Ga0075434_100217381 | 3300006871 | Bacteria | 1931 |
| 157 | Ga0068865_100199404 | 3300006881 | Bacteria | 1553 |
| 158 | Ga0097620_100159136 | 3300006931 | Unclassified | 2337 |
| 159 | Ga0097620_100260596 | 3300006931 | Bacteria | 1825 |
| 160 | Ga0097620_100313337 | 3300006931 | Bacteria | 1663 |
| 161 | Ga0097620_100319458 | 3300006931 | Bacteria | 1647 |
| 162 | Ga0097620_100377394 | 3300006931 | Bacteria | 1513 |
| 163 | Ga0097620_100441133 | 3300006931 | Bacteria | 1398 |
| 164 | Ga0099826_10089341 | 3300006948 | Bacteria | 1889 |
| 165 | Ga0075435_100135657 | 3300007076 | Bacteria | 2061 |
| 166 | Ga0105240_10199968 | 3300009093 | Bacteria | 2343 |
| 167 | Ga0105240_10326040 | 3300009093 | Bacteria | 1749 |
| 168 | Ga0105240_10343556 | 3300009093 | Bacteria | 1695 |
| 169 | Ga0105240_10468144 | 3300009093 | Bacteria | 1407 |
| 170 | Ga0111539_10341733 | 3300009094 | Bacteria | 1742 |
| 171 | Ga0105245_10125532 | 3300009098 | Bacteria | 2402 |
| 172 | Ga0105245_10164894 | 3300009098 | Bacteria | 2105 |
| 173 | Ga0105245_10238659 | 3300009098 | Bacteria | 1761 |
| 174 | Ga0105247_10043279 | 3300009101 | Bacteria | 2758 |
| 175 | Ga0105243_10072013 | 3300009148 | Bacteria | 2796 |
| 176 | Ga0105243_10080391 | 3300009148 | Bacteria | 2658 |
| 177 | Ga0105243_10312761 | 3300009148 | Bacteria | 1428 |
| 178 | Ga0105241_10094328 | 3300009174 | Bacteria | 2366 |
| 179 | Ga0105241_10197767 | 3300009174 | Bacteria | 1677 |
| 180 | Ga0105241_10200557 | 3300009174 | Bacteria | 1666 |
| 181 | Ga0105241_10218725 | 3300009174 | Bacteria | 1600 |
| 182 | Ga0105241_10227760 | 3300009174 | Bacteria | 1570 |
| 183 | Ga0105242_10129016 | 3300009176 | Bacteria | 2180 |
| 184 | Ga0105242_10170429 | 3300009176 | Bacteria | 1913 |
| 185 | Ga0105242_10225488 | 3300009176 | Bacteria | 1677 |
| 186 | Ga0105242_10266413 | 3300009176 | Bacteria | 1550 |
| 187 | Ga0105248_10083276 | 3300009177 | Bacteria | 3598 |
| 188 | Ga0105248_10283928 | 3300009177 | Unclassified | 1864 |
| 189 | Ga0105248_10354287 | 3300009177 | Bacteria | 1652 |
| 190 | Ga0105248_10393430 | 3300009177 | Bacteria | 1561 |
| 191 | Ga0105248_10540345 | 3300009177 | Unclassified | 1315 |
| 192 | Ga0105237_10052425 | 3300009545 | Bacteria | 4095 |
| 193 | Ga0105237_10196887 | 3300009545 | Bacteria | 2015 |
| 194 | Ga0105237_10233244 | 3300009545 | Bacteria | 1841 |
| 195 | Ga0105237_10250710 | 3300009545 | Unclassified | 1772 |
| 196 | Ga0105237_10291876 | 3300009545 | Bacteria | 1633 |
| 197 | Ga0105238_10047519 | 3300009551 | Bacteria | 4326 |
| 198 | Ga0105238_10243409 | 3300009551 | Bacteria | 1776 |
| 199 | Ga0105238_10289623 | 3300009551 | Bacteria | 1620 |
| 200 | Ga0105238_10289748 | 3300009551 | Bacteria | 1619 |
| 201 | Ga0105249_10291757 | 3300009553 | Bacteria | 1633 |
| 202 | Ga0105239_10130859 | 3300010375 | Bacteria | 2791 |
| 203 | Ga0105239_10359314 | 3300010375 | Bacteria | 1645 |
| 204 | Ga0105239_10394572 | 3300010375 | Bacteria | 1565 |
| 205 | Ga0105239_10405071 | 3300010375 | Bacteria | 1544 |
| 206 | Ga0105246_10091584 | 3300011119 | Bacteria | 2192 |
| 207 | Ga0105246_10129554 | 3300011119 | Bacteria | 1882 |
| 208 | Ga0105246_10158870 | 3300011119 | Bacteria | 1720 |
| 209 | Ga0157373_10152496 | 3300013100 | Bacteria | 1625 |
| 210 | Ga0157370_10372762 | 3300013104 | Bacteria | 1315 |
| 211 | Ga0157369_10306709 | 3300013105 | Bacteria | 1651 |
| 212 | Ga0157374_10090184 | 3300013296 | Bacteria | 2922 |
| 213 | Ga0157374_10247404 | 3300013296 | Bacteria | 1754 |
| 214 | Ga0157374_10294834 | 3300013296 | Bacteria | 1604 |
| 215 | Ga0157378_10154600 | 3300013297 | Bacteria | 2140 |
| 216 | Ga0157378_10178288 | 3300013297 | Bacteria | 1997 |
| 217 | Ga0157378_10219479 | 3300013297 | Bacteria | 1807 |
| 218 | Ga0163162_10076946 | 3300013306 | Bacteria | 3399 |
| 219 | Ga0163162_10184195 | 3300013306 | Bacteria | 2215 |
| 220 | Ga0163162_10241915 | 3300013306 | Bacteria | 1936 |
| 221 | Ga0163162_10349084 | 3300013306 | Bacteria | 1612 |
| 222 | Ga0163162_10360273 | 3300013306 | Bacteria | 1587 |
| 223 | Ga0157372_10134519 | 3300013307 | Bacteria | 2846 |
| 224 | Ga0157372_10263623 | 3300013307 | Bacteria | 2001 |
| 225 | Ga0157372_10365929 | 3300013307 | Bacteria | 1680 |
| 226 | Ga0157375_10390773 | 3300013308 | Unclassified | 1558 |
| 227 | Ga0163163_10166490 | 3300014325 | Unclassified | 2250 |
| 228 | Ga0163163_10230365 | 3300014325 | Bacteria | 1902 |
| 229 | Ga0163163_10235427 | 3300014325 | Unclassified | 1880 |
| 230 | Ga0163163_10342754 | 3300014325 | Bacteria | 1550 |
| 231 | Ga0163163_10358765 | 3300014325 | Bacteria | 1514 |
| 232 | Ga0157380_10234998 | 3300014326 | Unclassified | 1649 |
| 233 | Ga0157377_10058032 | 3300014745 | Bacteria | 2203 |
| 234 | Ga0157377_10081934 | 3300014745 | Bacteria | 1888 |
| 235 | Ga0157377_10119078 | 3300014745 | Bacteria | 1598 |
| 236 | Ga0157379_10149178 | 3300014968 | Bacteria | 2109 |
| 237 | Ga0157379_10188311 | 3300014968 | Bacteria | 1865 |
| 238 | Ga0157379_10211295 | 3300014968 | Unclassified | 1757 |
| 239 | Ga0157379_10247410 | 3300014968 | Bacteria | 1618 |
| 240 | Ga0157376_10194978 | 3300014969 | Bacteria | 1860 |
| 241 | Ga0157376_10218622 | 3300014969 | Bacteria | 1763 |
| 242 | Ga0163161_10038312 | 3300017792 | Unclassified | 3438 |
| 243 | Ga0163161_10093944 | 3300017792 | Unclassified | 2223 |
| 244 | Ga0213872_10046760 | 3300021361 | Bacteria | 1969 |
| 245 | Ga0213874_10033957 | 3300021377 | Unclassified | 1490 |
| 246 | Ga0213875_10062582 | 3300021388 | Bacteria | 1740 |
| 247 | Ga0207697_10031562 | 3300025315 | Bacteria | 2167 |
| 248 | Ga0207692_10074681 | 3300025898 | Bacteria | 1797 |
| 249 | Ga0207642_10114709 | 3300025899 | Bacteria | 1378 |
| 250 | Ga0207710_10053822 | 3300025900 | Bacteria | 1812 |
| 251 | Ga0207688_10202721 | 3300025901 | Bacteria | 1190 |
| 252 | Ga0207680_10053102 | 3300025903 | Bacteria | 2432 |
| 253 | Ga0207680_10067966 | 3300025903 | Bacteria | 2197 |
| 254 | Ga0207680_10106673 | 3300025903 | Bacteria | 1809 |
| 255 | Ga0207680_10141880 | 3300025903 | Bacteria | 1593 |
| 256 | Ga0207685_10050918 | 3300025905 | Bacteria | 1597 |
| 257 | Ga0207685_10080933 | 3300025905 | Unclassified | 1344 |
| 258 | Ga0207645_10112782 | 3300025907 | Bacteria | 1761 |
| 259 | Ga0207645_10138125 | 3300025907 | Bacteria | 1587 |
| 260 | Ga0207645_10175735 | 3300025907 | Bacteria | 1404 |
| 261 | Ga0207643_10133503 | 3300025908 | Unclassified | 1479 |
| 262 | Ga0207705_10179962 | 3300025909 | Bacteria | 1595 |
| 263 | Ga0207654_10168506 | 3300025911 | Bacteria | 1420 |
| 264 | Ga0207654_10178929 | 3300025911 | Bacteria | 1382 |
| 265 | Ga0207707_10146805 | 3300025912 | Bacteria | 2062 |
| 266 | Ga0207707_10278915 | 3300025912 | Bacteria | 1448 |
| 267 | Ga0207695_10190267 | 3300025913 | Bacteria | 1970 |
| 268 | Ga0207695_10254036 | 3300025913 | Bacteria | 1657 |
| 269 | Ga0207695_10289970 | 3300025913 | Bacteria | 1529 |
| 270 | Ga0207695_10346236 | 3300025913 | Bacteria | 1374 |
| 271 | Ga0207671_10199165 | 3300025914 | Bacteria | 1564 |
| 272 | Ga0207671_10234970 | 3300025914 | Bacteria | 1439 |
| 273 | Ga0207693_10058523 | 3300025915 | Bacteria | 3019 |
| 274 | Ga0207693_10106873 | 3300025915 | Bacteria | 2195 |
| 275 | Ga0207663_10035166 | 3300025916 | Bacteria | 3003 |
| 276 | Ga0207663_10168384 | 3300025916 | Bacteria | 1554 |
| 277 | Ga0207663_10169516 | 3300025916 | Bacteria | 1549 |
| 278 | Ga0207660_10171399 | 3300025917 | Bacteria | 1680 |
| 279 | Ga0207662_10133874 | 3300025918 | Bacteria | 1565 |
| 280 | Ga0207662_10153260 | 3300025918 | Bacteria | 1467 |
| 281 | Ga0207657_10136652 | 3300025919 | Bacteria | 2005 |
| 282 | Ga0207657_10176157 | 3300025919 | Bacteria | 1731 |
| 283 | Ga0207657_10225318 | 3300025919 | Bacteria | 1501 |
| 284 | Ga0207649_10045433 | 3300025920 | Bacteria | 2693 |
| 285 | Ga0207649_10104301 | 3300025920 | Bacteria | 1882 |
| 286 | Ga0207649_10192417 | 3300025920 | Bacteria | 1436 |
| 287 | Ga0207652_10153955 | 3300025921 | Bacteria | 2059 |
| 288 | Ga0207694_10175161 | 3300025924 | Bacteria | 1738 |
| 289 | Ga0207694_10214082 | 3300025924 | Bacteria | 1570 |
| 290 | Ga0207694_10243417 | 3300025924 | Bacteria | 1470 |
| 291 | Ga0207650_10120825 | 3300025925 | Bacteria | 2039 |
| 292 | Ga0207650_10143211 | 3300025925 | Bacteria | 1881 |
| 293 | Ga0207650_10216434 | 3300025925 | Unclassified | 1540 |
| 294 | Ga0207650_10236669 | 3300025925 | Bacteria | 1474 |
| 295 | Ga0207659_10165578 | 3300025926 | Bacteria | 1740 |
| 296 | Ga0207687_10075448 | 3300025927 | Bacteria | 2420 |
| 297 | Ga0207687_10262782 | 3300025927 | Bacteria | 1377 |
| 298 | Ga0207700_10206744 | 3300025928 | Bacteria | 1657 |
| 299 | Ga0207700_10249701 | 3300025928 | Bacteria | 1515 |
| 300 | Ga0207664_10233078 | 3300025929 | Bacteria | 1601 |
| 301 | Ga0207644_10180849 | 3300025931 | Bacteria | 1652 |
| 302 | Ga0207644_10235746 | 3300025931 | Bacteria | 1455 |
| 303 | Ga0207690_10171460 | 3300025932 | Bacteria | 1626 |
| 304 | Ga0207690_10258976 | 3300025932 | Bacteria | 1347 |
| 305 | Ga0207686_10110035 | 3300025934 | Bacteria | 1856 |
| 306 | Ga0207686_10157942 | 3300025934 | Bacteria | 1586 |
| 307 | Ga0207686_10199499 | 3300025934 | Bacteria | 1432 |
| 308 | Ga0207709_10137514 | 3300025935 | Bacteria | 1675 |
| 309 | Ga0207670_10157828 | 3300025936 | Bacteria | 1690 |
| 310 | Ga0207704_10201513 | 3300025938 | Bacteria | 1457 |
| 311 | Ga0207704_10203544 | 3300025938 | Bacteria | 1451 |
| 312 | Ga0207665_10132620 | 3300025939 | Bacteria | 1770 |
| 313 | Ga0207711_10139974 | 3300025941 | Bacteria | 2176 |
| 314 | Ga0207711_10255413 | 3300025941 | Bacteria | 1610 |
| 315 | Ga0207689_10080905 | 3300025942 | Unclassified | 2670 |
| 316 | Ga0207689_10116730 | 3300025942 | Bacteria | 2194 |
| 317 | Ga0207661_10113149 | 3300025944 | Bacteria | 2299 |
| 318 | Ga0207661_10131674 | 3300025944 | Bacteria | 2143 |
| 319 | Ga0207661_10162006 | 3300025944 | Bacteria | 1941 |
| 320 | Ga0207661_10172464 | 3300025944 | Bacteria | 1883 |
| 321 | Ga0207661_10261287 | 3300025944 | Bacteria | 1542 |
| 322 | Ga0207661_10324116 | 3300025944 | Bacteria | 1385 |
| 323 | Ga0207679_10203811 | 3300025945 | Bacteria | 1654 |
| 324 | Ga0207667_10280648 | 3300025949 | Bacteria | 1702 |
| 325 | Ga0207667_10310944 | 3300025949 | Bacteria | 1609 |
| 326 | Ga0207667_10372994 | 3300025949 | Bacteria | 1454 |
| 327 | Ga0207667_10375798 | 3300025949 | Bacteria | 1448 |
| 328 | Ga0207651_10246078 | 3300025960 | Unclassified | 1460 |
| 329 | Ga0207651_10285431 | 3300025960 | Bacteria | 1366 |
| 330 | Ga0207658_10171762 | 3300025986 | Bacteria | 1786 |
| 331 | Ga0207658_10224673 | 3300025986 | Bacteria | 1581 |
| 332 | Ga0207658_10276630 | 3300025986 | Bacteria | 1437 |
| 333 | Ga0207677_10194148 | 3300026023 | Bacteria | 1608 |
| 334 | Ga0207677_10276136 | 3300026023 | Bacteria | 1377 |
| 335 | Ga0207703_10174971 | 3300026035 | Unclassified | 1891 |
| 336 | Ga0207703_10253566 | 3300026035 | Bacteria | 1587 |
| 337 | Ga0207703_10358173 | 3300026035 | Bacteria | 1345 |
| 338 | Ga0207639_10200214 | 3300026041 | Bacteria | 1712 |
| 339 | Ga0207639_10203830 | 3300026041 | Bacteria | 1698 |
| 340 | Ga0207639_10231353 | 3300026041 | Bacteria | 1602 |
| 341 | Ga0207639_10336284 | 3300026041 | Bacteria | 1345 |
| 342 | Ga0207702_10065905 | 3300026078 | Bacteria | 3103 |
| 343 | Ga0207702_10334886 | 3300026078 | Bacteria | 1444 |
| 344 | Ga0207641_10235800 | 3300026088 | Bacteria | 1702 |
| 345 | Ga0207641_10269716 | 3300026088 | Bacteria | 1596 |
| 346 | Ga0207641_10281840 | 3300026088 | Bacteria | 1563 |
| 347 | Ga0207648_10069604 | 3300026089 | Bacteria | 3066 |
| 348 | Ga0207648_10097301 | 3300026089 | Bacteria | 2576 |
| 349 | Ga0207676_10085707 | 3300026095 | Bacteria | 2571 |
| 350 | Ga0207676_10294374 | 3300026095 | Bacteria | 1479 |
| 351 | Ga0207674_10079251 | 3300026116 | Bacteria | 3289 |
| 352 | Ga0207674_10138832 | 3300026116 | Bacteria | 2391 |
| 353 | Ga0207674_10161890 | 3300026116 | Bacteria | 2192 |
| 354 | Ga0207674_10225691 | 3300026116 | Unclassified | 1821 |
| 355 | Ga0207674_10237905 | 3300026116 | Bacteria | 1768 |
| 356 | Ga0207675_100140742 | 3300026118 | Bacteria | 2292 |
| 357 | Ga0207683_10073452 | 3300026121 | Plasmid | 3026 |
| 358 | Ga0207683_10189273 | 3300026121 | Bacteria | 1868 |
| 359 | Ga0207698_10174354 | 3300026142 | Bacteria | 1897 |
| 360 | Ga0207698_10181363 | 3300026142 | Bacteria | 1865 |
| 361 | Ga0207698_10378874 | 3300026142 | Bacteria | 1345 |
| 362 | Ga0268266_10183876 | 3300028379 | Bacteria | 1905 |
| 363 | Ga0268266_10217571 | 3300028379 | Bacteria | 1754 |
| 364 | Ga0268266_10267318 | 3300028379 | Bacteria | 1586 |
| 365 | Ga0268265_10324751 | 3300028380 | Bacteria | 1395 |
| 366 | Ga0268264_10233917 | 3300028381 | Bacteria | 1698 |
| 367 | Ga0268264_10287267 | 3300028381 | Bacteria | 1543 |
| 368 | Ga0268264_10322056 | 3300028381 | Bacteria | 1462 |
| 369 | Ga0265326_10033391 | 3300028558 | Bacteria | 1464 |
| 370 | Ga0265319_1045032 | 3300028563 | Bacteria | 1476 |
| 371 | Ga0265334_10048565 | 3300028573 | Bacteria | 1634 |
| 372 | Ga0265318_10055071 | 3300028577 | Unclassified | 1489 |
| 373 | Ga0265323_10027546 | 3300028653 | Bacteria | 2135 |
| 374 | Ga0265322_10031821 | 3300028654 | Bacteria | 1506 |
| 375 | Ga0265338_10185155 | 3300028800 | Bacteria | 1583 |
| 376 | Ga0265338_10188886 | 3300028800 | Bacteria | 1563 |
| 377 | Ga0265324_10046602 | 3300029957 | Bacteria | 1491 |
| 378 | Ga0265330_10041824 | 3300031235 | Bacteria | 2031 |
| 379 | Ga0265332_10070218 | 3300031238 | Bacteria | 1492 |
| 380 | Ga0265320_10081274 | 3300031240 | Bacteria | 1512 |
| 381 | Ga0265325_10093491 | 3300031241 | Bacteria | 1479 |
| 382 | Ga0265329_10040335 | 3300031242 | Bacteria | 1498 |
| 383 | Ga0265329_10041582 | 3300031242 | Bacteria | 1473 |
| 384 | Ga0265340_10085060 | 3300031247 | Bacteria | 1484 |
| 385 | Ga0265339_10117443 | 3300031249 | Bacteria | 1370 |
| 386 | Ga0265331_10070404 | 3300031250 | Bacteria | 1637 |
| 387 | Ga0265316_10064121 | 3300031344 | Bacteria | 2846 |
| 388 | Ga0265316_10139551 | 3300031344 | Bacteria | 1821 |
| 389 | Ga0265316_10168140 | 3300031344 | Bacteria | 1637 |
| 390 | Ga0307513_10198922 | 3300031456 | Bacteria | 1847 |
| 391 | Ga0307408_100184138 | 3300031548 | Bacteria | 1677 |
| 392 | Ga0265313_10078646 | 3300031595 | Bacteria | 1503 |
| 393 | Ga0265314_10101531 | 3300031711 | Bacteria | 1848 |
| 394 | Ga0265314_10140355 | 3300031711 | Bacteria | 1494 |
| 395 | Ga0265342_10089977 | 3300031712 | Bacteria | 1760 |
| 396 | Ga0307406_10049477 | 3300031901 | Bacteria | 2660 |
| 397 | Ga0307406_10187013 | 3300031901 | Bacteria | 1513 |
| 398 | Ga0307416_100330126 | 3300032002 | Bacteria | 1532 |
| 399 | Ga0373926_0037841 | 3300035083 | Bacteria | 1717 |
| 400 | Ga0373929_0011178 | 3300035085 | Bacteria | 1688 |
| 401 | Ga0373934_0032716 | 3300035086 | Bacteria | 2040 |
| 402 | Ga0373934_0039856 | 3300035086 | Bacteria | 1852 |
| 403 | Ga0373923_0060619 | 3300035111 | Bacteria | 1606 |
| 404 | Ga0373923_0065884 | 3300035111 | Unclassified | 1547 |
| 405 | Ga0373932_0019512 | 3300035112 | Bacteria | 1768 |
| 406 | Ga0373936_0009564 | 3300035113 | Bacteria | 3653 |
| 407 | Ga0373936_0047872 | 3300035113 | Bacteria | 1725 |
| 408 | Ga0373936_0067194 | 3300035113 | Bacteria | 1473 |
| 409 | Ga0373945_0000987 | 3300035116 | Bacteria | 8487 |
| 410 | Ga0373945_0026416 | 3300035116 | Bacteria | 2022 |
| 411 | Ga0373945_0029376 | 3300035116 | Bacteria | 1931 |
| 412 | Ga0373945_0039813 | 3300035116 | Bacteria | 1695 |
| 413 | Ga0373953_0007621 | 3300035117 | Bacteria | 3634 |
| 414 | Ga0373953_0051450 | 3300035117 | Bacteria | 1665 |
| 415 | Ga0373953_0063331 | 3300035117 | Bacteria | 1515 |
| 416 | Ga0373954_0039893 | 3300035118 | Bacteria | 2186 |
| 417 | Ga0373954_0076272 | 3300035118 | Bacteria | 1597 |
| 418 | Ga0373954_0080841 | 3300035118 | Bacteria | 1552 |
| 419 | Ga0373956_0003135 | 3300035119 | Bacteria | 6685 |
| 420 | Ga0373956_0009228 | 3300035119 | Bacteria | 4004 |
| 421 | Ga0373956_0068585 | 3300035119 | Bacteria | 1615 |
| 422 | Ga0373957_0019161 | 3300035120 | Bacteria | 2404 |
| 423 | Ga0373957_0032571 | 3300035120 | Bacteria | 1920 |
| 424 | Ga0373957_0038703 | 3300035120 | Bacteria | 1786 |
| 425 | Ga0373943_0055635 | 3300035170 | Bacteria | 1960 |
| 426 | Ga0373943_0072355 | 3300035170 | Bacteria | 1748 |
| 427 | Ga0373943_0104222 | 3300035170 | Bacteria | 1488 |
| 428 | Ga0373946_0040095 | 3300035171 | Bacteria | 1914 |
| 429 | Ga0373946_0042439 | 3300035171 | Bacteria | 1869 |
| 430 | Ga0373946_0065469 | 3300035171 | Bacteria | 1556 |
| 431 | Ga0373955_0061204 | 3300035172 | Bacteria | 2078 |
| 432 | Ga0373955_0082980 | 3300035172 | Bacteria | 1814 |
| 433 | Ga0373955_0140585 | 3300035172 | Unclassified | 1415 |
| 434 | Ga0373961_0040016 | 3300035241 | Bacteria | 1349 |
| 435 | Ga0373924_0017351 | 3300035410 | Unclassified | 2760 |
| 436 | Ga0373924_0026042 | 3300035410 | Bacteria | 2316 |
| 437 | Ga0373924_0066294 | 3300035410 | Bacteria | 1517 |
| 438 | Ga0373931_0079790 | 3300035691 | Bacteria | 1803 |
| 439 | Ga0373931_0089103 | 3300035691 | Bacteria | 1716 |
| 440 | Ga0373935_0033673 | 3300035692 | Unclassified | 3190 |
| 441 | Ga0373935_0106626 | 3300035692 | Bacteria | 1854 |
| 442 | Ga0373935_0127633 | 3300035692 | Unclassified | 1705 |
| 443 | Ga0373935_0147583 | 3300035692 | Bacteria | 1593 |
| 444 | Ga0373935_0186007 | 3300035692 | Bacteria | 1428 |
| 445 | Ga0373927_0120712 | 3300035695 | Bacteria | 1710 |
| 446 | Ga0373927_0139272 | 3300035695 | Bacteria | 1586 |
| 447 | Ga0373927_0206633 | 3300035695 | Bacteria | 1289 |
| 448 | Ga0373933_0003803 | 3300035724 | Bacteria | 8345 |
| 449 | Ga0373933_0020833 | 3300035724 | Bacteria | 3718 |
| 450 | Ga0373933_0060894 | 3300035724 | Bacteria | 2276 |
| 451 | Ga0373947_0075167 | 3300035725 | Bacteria | 2079 |
| 452 | Ga0373947_0087331 | 3300035725 | Bacteria | 1939 |
| 453 | Ga0373947_0133841 | 3300035725 | Bacteria | 1585 |
| 454 | Ga0373947_0134953 | 3300035725 | Bacteria | 1578 |
| 455 | Ga0373947_0171122 | 3300035725 | Bacteria | 1409 |
| 456 | Ga0373937_0082509 | 3300036401 | Bacteria | 2974 |
| 457 | Ga0373937_0169931 | 3300036401 | Bacteria | 2046 |
| 458 | Ga0373925_0016172 | 3300037068 | Bacteria | 5401 |
| 459 | Ga0373925_0088154 | 3300037068 | Bacteria | 2369 |
| 460 | Ga0373925_0155147 | 3300037068 | Bacteria | 1800 |
| 461 | Ga0373925_0179848 | 3300037068 | Unclassified | 1673 |
| 462 | Ga0373925_0231507 | 3300037068 | Bacteria | 1477 |
| 463 | Ga0395900_0453382 | 3300037418 | Bacteria | 1238 |
| 464 | Ga0395898_0222684 | 3300037466 | Unclassified | 1799 |
| 465 | Ga0316581_0039703 | 3300037588 | Bacteria | 1433 |
| 466 | Ga0436364_0204662 | 3300037853 | Bacteria | 1905 |
| 467 | Ga0436364_0440491 | 3300037853 | Bacteria | 1659 |
| 468 | Ga0436364_1208221 | 3300037853 | Bacteria | 5126 |
| 469 | Ga0436364_1554448 | 3300037853 | Bacteria | 11409 |
| 470 | Ga0395901_0198528 | 3300038443 | Bacteria | 2103 |
| 471 | Ga0395901_0381723 | 3300038443 | Bacteria | 1450 |
| 472 | Ga0242419_001257 | 3300038698 | Bacteria | 1539 |
| 473 | Ga0242420_005085 | 3300038996 | Bacteria | 2020 |
| 474 | Ga0242420_011656 | 3300038996 | Bacteria | 1478 |
| 475 | Ga0436365_0469483 | 3300039437 | Unclassified | 2590 |
| 476 | Ga0436360_0464691 | 3300039438 | Bacteria | 2534 |
| 477 | Ga0436360_1091598 | 3300039438 | Unclassified | 1371 |
| 478 | Ga0436360_1184589 | 3300039438 | Bacteria | 2058 |
| 479 | Ga0436361_0228305 | 3300039447 | Bacteria | 1829 |
| 480 | Ga0436361_0888187 | 3300039447 | Bacteria | 2672 |
| 481 | Ga0436363_0172554 | 3300039450 | Bacteria | 1583 |
| 482 | Ga0436362_0554849 | 3300039453 | Bacteria | 1885 |
| 483 | Ga0439464_0050350 | 3300042439 | Bacteria | 1203 |
| 484 | Ga0451577_0190630 | 3300042876 | Bacteria | 1849 |
| 485 | Ga0451577_0197643 | 3300042876 | Bacteria | 1815 |
| 486 | Ga0451577_0215867 | 3300042876 | Bacteria | 1733 |
| 487 | Ga0451577_0266450 | 3300042876 | Bacteria | 1551 |
| 488 | Ga0453683_0136227 | 3300044673 | Bacteria | 1548 |
| 489 | Ga0453683_0157630 | 3300044673 | Bacteria | 1435 |
| 490 | Ga0453683_0165548 | 3300044673 | Bacteria | 1399 |
| 491 | Ga0466966_0129756 | 3300044684 | Bacteria | 1544 |
| 492 | Ga0466961_0092976 | 3300044693 | Bacteria | 1903 |
| 493 | Ga0466963_0147398 | 3300044694 | Bacteria | 1633 |
| 494 | Ga0453684_0280023 | 3300044712 | Bacteria | 1902 |
| 495 | Ga0453684_0333259 | 3300044712 | Bacteria | 1715 |
| 496 | Ga0453684_0385165 | 3300044712 | Bacteria | 1573 |
| 497 | Ga0453684_0494233 | 3300044712 | Bacteria | 1355 |
| 498 | Ga0466971_0070005 | 3300044719 | Bacteria | 1592 |
| 499 | Ga0466968_0023697 | 3300044735 | Bacteria | 2503 |
| 500 | Ga0466970_0055537 | 3300044765 | Bacteria | 2115 |
| 501 | Ga0466957_0062551 | 3300044842 | Bacteria | 2286 |
| 502 | Ga0466960_0069109 | 3300044901 | Bacteria | 1754 |
| 503 | Ga0466959_0171378 | 3300045049 | Bacteria | 1522 |
| 504 | Ga0451576_0251476 | 3300045051 | Unclassified | 1847 |
| 505 | Ga0451576_0261665 | 3300045051 | Unclassified | 1808 |
| 506 | Ga0451576_0391390 | 3300045051 | Bacteria | 1457 |
| 507 | Ga0466967_0230413 | 3300045976 | Bacteria | 1763 |
| 508 | Ga0466967_0308868 | 3300045976 | Bacteria | 1523 |
| 509 | Ga0466967_0331206 | 3300045976 | Bacteria | 1470 |
| 510 | Ga0495592_0070752 | 3300046454 | Bacteria | 2540 |
| 511 | Ga0495592_0096702 | 3300046454 | Bacteria | 2110 |
| 512 | Ga0495592_0160445 | 3300046454 | Bacteria | 1547 |
| 513 | Ga0495629_0105163 | 3300046459 | Bacteria | 1969 |
| 514 | Ga0495629_0164104 | 3300046459 | Bacteria | 1543 |
| 515 | Ga0495638_0109358 | 3300046460 | Bacteria | 1643 |
| 516 | Ga0495651_0043111 | 3300046462 | Bacteria | 3501 |
| 517 | Ga0495651_0103506 | 3300046462 | Bacteria | 2115 |
| 518 | Ga0495653_0122754 | 3300046463 | Bacteria | 1848 |
| 519 | Ga0495653_0154009 | 3300046463 | Bacteria | 1603 |
| 520 | Ga0495580_0073598 | 3300046472 | Bacteria | 2385 |
| 521 | Ga0495580_0127890 | 3300046472 | Bacteria | 1763 |
| 522 | Ga0495580_0137905 | 3300046472 | Bacteria | 1691 |
| 523 | Ga0495580_0242840 | 3300046472 | Bacteria | 1234 |
| 524 | Ga0495582_0080288 | 3300046473 | Bacteria | 1811 |
| 525 | Ga0495582_0089169 | 3300046473 | Bacteria | 1718 |
| 526 | Ga0495582_0120596 | 3300046473 | Bacteria | 1477 |
| 527 | Ga0495639_0048854 | 3300046475 | Bacteria | 1919 |
| 528 | Ga0495662_0090102 | 3300046476 | Bacteria | 1495 |
| 529 | Ga0495662_0110656 | 3300046476 | Bacteria | 1346 |
| 530 | Ga0495664_0043836 | 3300046477 | Unclassified | 2651 |
| 531 | Ga0495664_0146207 | 3300046477 | Bacteria | 1433 |
| 532 | Ga0495594_0018679 | 3300046499 | Bacteria | 3675 |
| 533 | Ga0495583_0063183 | 3300046506 | Bacteria | 1646 |
| 534 | Ga0495608_0097193 | 3300046511 | Bacteria | 1901 |
| 535 | Ga0495608_0112904 | 3300046511 | Bacteria | 1746 |
| 536 | Ga0495608_0115737 | 3300046511 | Bacteria | 1721 |
| 537 | Ga0495618_0068405 | 3300046514 | Bacteria | 2258 |
| 538 | Ga0495628_0166249 | 3300046516 | Bacteria | 1674 |
| 539 | Ga0495630_0042002 | 3300046517 | Bacteria | 3415 |
| 540 | Ga0495630_0110168 | 3300046517 | Bacteria | 2085 |
| 541 | Ga0495666_0057454 | 3300046526 | Unclassified | 1862 |
| 542 | Ga0495652_0119987 | 3300046529 | Bacteria | 2099 |
| 543 | Ga0495652_0129978 | 3300046529 | Bacteria | 1995 |
| 544 | Ga0495652_0140219 | 3300046529 | Bacteria | 1902 |
| 545 | Ga0495665_0050102 | 3300046531 | Bacteria | 2214 |
| 546 | Ga0495665_0061276 | 3300046531 | Bacteria | 1986 |
| 547 | Ga0495665_0094320 | 3300046531 | Unclassified | 1572 |
| 548 | Ga0495640_0056846 | 3300046533 | Unclassified | 2671 |
| 549 | Ga0495640_0097773 | 3300046533 | Bacteria | 1930 |
| 550 | Ga0495640_0137766 | 3300046533 | Bacteria | 1575 |
| 551 | Ga0495586_0074111 | 3300046535 | Unclassified | 1862 |
| 552 | Ga0495587_0038821 | 3300046536 | Bacteria | 2852 |
| 553 | Ga0495587_0044137 | 3300046536 | Bacteria | 2652 |
| 554 | Ga0495587_0089806 | 3300046536 | Bacteria | 1775 |
| 555 | Ga0495587_0128009 | 3300046536 | Bacteria | 1452 |
| 556 | Ga0495645_0095550 | 3300046543 | Bacteria | 2118 |
| 557 | Ga0495645_0145099 | 3300046543 | Bacteria | 1653 |
| 558 | Ga0495667_0076953 | 3300046559 | Bacteria | 2170 |
| 559 | Ga0495667_0112399 | 3300046559 | Bacteria | 1760 |
| 560 | Ga0495634_0099858 | 3300046642 | Bacteria | 1876 |
| 561 | Ga0495625_0196247 | 3300046660 | Bacteria | 1334 |
| 562 | Ga0495635_0171258 | 3300046663 | Bacteria | 1476 |
| 563 | Ga0495588_0149576 | 3300046674 | Bacteria | 1234 |
| 564 | Ga0495657_0126439 | 3300046675 | Bacteria | 1605 |
| 565 | Ga0495599_0112130 | 3300046678 | Bacteria | 1698 |
| 566 | Ga0495599_0134306 | 3300046678 | Bacteria | 1536 |
| 567 | Ga0495623_0085314 | 3300046679 | Bacteria | 1947 |
| 568 | Ga0495623_0096805 | 3300046679 | Bacteria | 1803 |
| 569 | Ga0495623_0126635 | 3300046679 | Bacteria | 1533 |
| 570 | Ga0495646_0087858 | 3300046680 | Bacteria | 1801 |
| 571 | Ga0495669_0067577 | 3300046684 | Unclassified | 1625 |
| 572 | Ga0495613_0149500 | 3300046689 | Bacteria | 1666 |
| 573 | Ga0495624_0101387 | 3300046690 | Bacteria | 1772 |
| 574 | Ga0495600_0070186 | 3300046809 | Bacteria | 2289 |
| 575 | Ga0495600_0153148 | 3300046809 | Bacteria | 1492 |
| 576 | Ga0495604_0119510 | 3300047317 | Bacteria | 1909 |
| 577 | Ga0495604_0136373 | 3300047317 | Bacteria | 1758 |
| 578 | Ga0495604_0154274 | 3300047317 | Bacteria | 1628 |
| 579 | Ga0495604_0196541 | 3300047317 | Bacteria | 1402 |
| 580 | Ga0495674_0140721 | 3300047319 | Bacteria | 2028 |
| 581 | Ga0495674_0162581 | 3300047319 | Bacteria | 1867 |
| 582 | Ga0495674_0194754 | 3300047319 | Bacteria | 1683 |
| 583 | Ga0495680_0046296 | 3300047322 | Bacteria | 3430 |
| 584 | Ga0495675_0033592 | 3300047444 | Bacteria | 3274 |
| 585 | Ga0495675_0129034 | 3300047444 | Bacteria | 1572 |
| 586 | Ga0495675_0140815 | 3300047444 | Bacteria | 1495 |
| 587 | Ga0495684_0032147 | 3300047471 | Bacteria | 4027 |
| 588 | Ga0495684_0062332 | 3300047471 | Bacteria | 2836 |
| 589 | Ga0495684_0089759 | 3300047471 | Bacteria | 2328 |
| 590 | Ga0495684_0146615 | 3300047471 | Bacteria | 1767 |
| 591 | Ga0495602_0057676 | 3300048088 | Bacteria | 3404 |
| 592 | Ga0495602_0186549 | 3300048088 | Bacteria | 1594 |
| 593 | Ga0496100_0205627 | 3300048903 | Bacteria | 1437 |
| 594 | Ga0496101_0245382 | 3300048904 | Bacteria | 1394 |
| 595 | Ga0496104_0147256 | 3300048907 | Unclassified | 2261 |
| 596 | Ga0496104_0179335 | 3300048907 | Unclassified | 2028 |
| 597 | Ga0496104_0221242 | 3300048907 | Bacteria | 1805 |
| 598 | Ga0496104_0281536 | 3300048907 | Bacteria | 1576 |
| 599 | Ga0496105_0117898 | 3300048908 | Unclassified | 2189 |
| 600 | Ga0496105_0210142 | 3300048908 | Bacteria | 1586 |
| 601 | Ga0496106_0150525 | 3300048909 | Bacteria | 1835 |
| 602 | Ga0496106_0165105 | 3300048909 | Bacteria | 1752 |
| 603 | Ga0496106_0258074 | 3300048909 | Bacteria | 1394 |
| 604 | Ga0496107_0216787 | 3300048910 | Bacteria | 1423 |
| 605 | Ga0496108_0139612 | 3300048911 | Bacteria | 2087 |
| 606 | Ga0496109_0375206 | 3300048912 | Bacteria | 1343 |
| 607 | Ga0496110_0157379 | 3300048913 | Bacteria | 2058 |
| 608 | Ga0496111_0076945 | 3300048914 | Unclassified | 2432 |
| 609 | Ga0496112_0248581 | 3300048915 | Unclassified | 1730 |
| 610 | Ga0496112_0300124 | 3300048915 | Bacteria | 1552 |
| 611 | Ga0496113_0098272 | 3300048916 | Bacteria | 2266 |
| 612 | Ga0496113_0244969 | 3300048916 | Bacteria | 1430 |
| 613 | Ga0496115_0128482 | 3300048918 | Bacteria | 2088 |
| 614 | Ga0496115_0257379 | 3300048918 | Unclassified | 1436 |
| 615 | Ga0501031_0134512 | 3300049568 | Bacteria | 1615 |
| 616 | Ga0501032_0064489 | 3300049569 | Bacteria | 2452 |
| 617 | Ga0501033_0041080 | 3300049570 | Bacteria | 3452 |
| 618 | Ga0501034_0258843 | 3300049571 | Bacteria | 1683 |
| 619 | Ga0501034_0352167 | 3300049571 | Bacteria | 1400 |
| 620 | Ga0501036_0187834 | 3300049572 | Bacteria | 1739 |
| 621 | Ga0501037_0173462 | 3300049573 | Bacteria | 1532 |
| 622 | Ga0501038_0069478 | 3300049574 | Bacteria | 2992 |
| 623 | Ga0501043_0194881 | 3300049579 | Bacteria | 1574 |
| 624 | Ga0501043_0241034 | 3300049579 | Bacteria | 1394 |
| 625 | Ga0501046_0190692 | 3300049580 | Bacteria | 1529 |
| 626 | Ga0501047_0302614 | 3300049581 | Bacteria | 1441 |
| 627 | Ga0501048_0143014 | 3300049582 | Bacteria | 1691 |
| 628 | Ga0501048_0143596 | 3300049582 | Bacteria | 1688 |
| 629 | Ga0501070_0162733 | 3300049586 | Bacteria | 1839 |
| 630 | Ga0501074_0175016 | 3300049590 | Bacteria | 1531 |
| 631 | Ga0501079_0160600 | 3300049741 | Bacteria | 1752 |
| 632 | Ga0501080_0172905 | 3300049742 | Bacteria | 1991 |
| 633 | Ga0501080_0181154 | 3300049742 | Bacteria | 1938 |
| 634 | Ga0501035_0277086 | 3300049822 | Bacteria | 1418 |
| 635 | Ga0501035_0283814 | 3300049822 | Bacteria | 1399 |
| 636 | Ga0501045_0027287 | 3300049824 | Bacteria | 4113 |
| 637 | nmdc:mga0n895_219449_c1 | 3300050512 | Bacteria | 1931 |
| 638 | nmdc:mga0n895_243129_c1 | 3300050512 | Bacteria | 1827 |
| 639 | nmdc:mga0rr50_118203_c1 | 3300050513 | Bacteria | 2106 |
| 640 | nmdc:mga08x19_194404_c1 | 3300050514 | Bacteria | 1389 |
| 641 | nmdc:mga0a205_295108_c1 | 3300050515 | Bacteria | 1495 |
| 642 | Ga0495601_0107198 | 3300053077 | Bacteria | 1807 |
| 643 | Ga0495612_0038798 | 3300053078 | Unclassified | 1936 |
| 644 | Ga0495612_0050741 | 3300053078 | Bacteria | 1704 |
| 645 | Ga0495595_0067266 | 3300053084 | Bacteria | 1688 |
| 646 | Ga0495595_0085590 | 3300053084 | Bacteria | 1507 |
| 647 | Ga0495619_0085949 | 3300053085 | Bacteria | 2125 |
| 648 | Ga0495619_0146003 | 3300053085 | Bacteria | 1631 |
| 649 | Ga0495619_0161744 | 3300053085 | Bacteria | 1546 |
| 650 | Ga0500593_080841 | 3300053117 | Bacteria | 1393 |
| 651 | Ga0500594_0015027 | 3300053118 | Bacteria | 1862 |
| 652 | Ga0500617_088661 | 3300053124 | Bacteria | 1328 |
| 653 | Ga0500658_0068143 | 3300053134 | Bacteria | 1495 |
| 654 | Ga0500568_0024724 | 3300053139 | Bacteria | 2541 |
| 655 | Ga0500588_0008660 | 3300053146 | Bacteria | 2387 |
| 656 | Ga0500616_0010868 | 3300053153 | Bacteria | 5424 |
| 657 | Ga0501084_0195795 | 3300054114 | Bacteria | 1705 |
| 658 | Ga0501082_0143211 | 3300060353 | Unclassified | 2074 |
| 659 | Ga0501082_0179143 | 3300060353 | Bacteria | 1843 |
| 660 | 2644123779 | 2643221621 | Bacteria | 6212786 |
| 661 | Ga0207698_10156783 | |||
| 662 | JGI24741J21665_1014103 | |||
| 663 | JGI24743J22301_10011957 | |||
| 664 | JGI24735J21928_10033346 | |||
| 665 | JGI24738J21930_10021809 | |||
| 666 | rootL2_10012909 | |||
| 667 | rootH1_10068339 | |||
| 668 | Ga0065704_10077942 | |||
| 669 | Ga0065715_10160914 | |||
| 670 | Ga0065707_10082119 | |||
| 671 | Ga0070658_10093772 | |||
| 672 | Ga0070676_10069573 | |||
| 673 | Ga0070683_100248313 | |||
| 674 | Ga0070683_100259714 | |||
| 675 | Ga0070683_100396833 | |||
| 676 | Ga0070690_100111006 | |||
| 677 | Ga0070690_100136371 | |||
| 678 | Ga0070690_100160113 | |||
| 679 | Ga0070670_100057403 | |||
| 680 | Ga0070670_100174429 | |||
| 681 | Ga0070670_100268975 | |||
| 682 | Ga0070670_100314301 | |||
| 683 | Ga0068869_100121297 | |||
| 684 | Ga0068869_100190888 | |||
| 685 | Ga0070666_10056101 | |||
| 686 | Ga0070666_10068003 | |||
| 687 | Ga0070666_10084683 | |||
| 688 | Ga0070680_100161278 | |||
| 689 | Ga0070682_100088613 | |||
| 690 | Ga0068868_100127713 | |||
| 691 | Ga0070660_100171390 | |||
| 692 | Ga0070660_100243809 | |||
| 693 | Ga0070689_100076125 | |||
| 694 | Ga0070689_100148984 | |||
| 695 | Ga0070689_100215239 | |||
| 696 | Ga0070687_100106718 | |||
| 697 | Ga0070687_100126144 | |||
| 698 | Ga0070661_100187102 | |||
| 699 | Ga0070692_10103769 | |||
| 700 | Ga0070668_100277921 | |||
| 701 | Ga0070675_100159301 | |||
| 702 | Ga0070671_100150617 | |||
| 703 | Ga0070673_100109705 | |||
| 704 | Ga0070673_100183239 | |||
| 705 | Ga0070673_100244750 | |||
| 706 | Ga0070688_100040817 | |||
| 707 | Ga0070659_100203619 | |||
| 708 | Ga0070659_100242465 | |||
| 709 | Ga0070667_100120165 | |||
| 710 | Ga0070667_100130492 | |||
| 711 | Ga0070667_100155452 | |||
| 712 | Ga0070667_100326229 | |||
| 713 | Ga0070714_100179472 | |||
| 714 | Ga0070714_100254662 | |||
| 715 | Ga0070713_100183474 | |||
| 716 | Ga0070710_10049316 | |||
| 717 | Ga0070711_100065302 | |||
| 718 | Ga0070694_100210419 | |||
| 719 | Ga0070678_100136153 | |||
| 720 | Ga0070678_100249495 | |||
| 721 | Ga0070681_10112792 | |||
| 722 | Ga0070681_10211616 | |||
| 723 | Ga0068867_100166416 | |||
| 724 | Ga0070685_10089677 | |||
| 725 | Ga0070685_10104527 | |||
| 726 | Ga0070698_100226345 | |||
| 727 | Ga0070698_100263502 | |||
| 728 | Ga0070699_100188697 | |||
| 729 | Ga0070679_100402631 | |||
| 730 | Ga0070684_100173657 | |||
| 731 | Ga0070684_100191873 | |||
| 732 | Ga0070684_100229535 | |||
| 733 | Ga0070684_100241711 | |||
| 734 | Ga0070684_100243884 | |||
| 735 | Ga0070684_100298920 | |||
| 736 | Ga0070697_100094132 | |||
| 737 | Ga0068853_100121199 | |||
| 738 | Ga0068853_100205624 | |||
| 739 | Ga0068853_100262641 | |||
| 740 | Ga0068853_100388056 | |||
| 741 | Ga0070672_100205999 | |||
| 742 | Ga0070686_100045845 | |||
| 743 | Ga0070686_100210309 | |||
| 744 | Ga0070686_100237980 | |||
| 745 | Ga0070696_100206748 | |||
| 746 | Ga0070693_100120854 | |||
| 747 | Ga0070665_100303566 | |||
| 748 | Ga0070665_100341349 | |||
| 749 | Ga0070704_100025663 | |||
| 750 | Ga0070704_100241892 | |||
| 751 | Ga0068855_100114940 | |||
| 752 | Ga0068855_100227959 | |||
| 753 | Ga0068855_100280230 | |||
| 754 | Ga0068855_100396296 | |||
| 755 | Ga0070664_100104335 | |||
| 756 | Ga0070664_100125825 | |||
| 757 | Ga0070664_100259590 | |||
| 758 | Ga0070664_100347721 | |||
| 759 | Ga0068857_100079873 | |||
| 760 | Ga0068857_100193821 | |||
| 761 | Ga0068857_100206866 | |||
| 762 | Ga0068857_100253291 | |||
| 763 | Ga0068857_100319329 | |||
| 764 | Ga0068854_100173193 | |||
| 765 | Ga0068854_100201110 | |||
| 766 | Ga0068856_100050878 | |||
| 767 | Ga0068856_100279996 | |||
| 768 | Ga0070702_100087083 | |||
| 769 | Ga0070702_100141328 | |||
| 770 | Ga0068852_100158080 | |||
| 771 | Ga0068852_100221985 | |||
| 772 | Ga0068852_100250595 | |||
| 773 | Ga0068859_100159135 | |||
| 774 | Ga0068859_100260607 | |||
| 775 | Ga0068859_100313357 | |||
| 776 | Ga0068859_100319460 | |||
| 777 | Ga0068859_100377412 | |||
| 778 | Ga0068859_100441184 | |||
| 779 | Ga0068864_100089640 | |||
| 780 | Ga0068864_100275239 | |||
| 781 | Ga0068866_10154784 | |||
| 782 | Ga0068861_100185841 | |||
| 783 | Ga0068870_10133254 | |||
| 784 | Ga0068863_100063597 | |||
| 785 | Ga0068863_100069809 | |||
| 786 | Ga0068863_100256829 | |||
| 787 | Ga0068858_100112101 | |||
| 788 | Ga0068858_100159827 | |||
| 789 | Ga0068858_100160689 | |||
| 790 | Ga0068858_100238626 | |||
| 791 | Ga0068860_100182062 | |||
| 792 | Ga0068860_100233062 | |||
| 793 | Ga0068862_100280913 | |||
| 794 | Ga0068862_100349590 | |||
| 795 | Ga0081455_10000065 | |||
| 796 | Ga0081455_10208409 | |||
| 797 | Ga0081540_1029918 | |||
| 798 | Ga0070717_10072606 | |||
| 799 | Ga0070717_10147564 | |||
| 800 | Ga0070715_10029798 | |||
| 801 | Ga0070715_10067096 | |||
| 802 | Ga0070716_100076955 | |||
| 803 | Ga0070716_100090853 | |||
| 804 | Ga0070716_100123414 | |||
| 805 | Ga0070712_100118978 | |||
| 806 | Ga0097621_100065653 | |||
| 807 | Ga0097621_100184157 | |||
| 808 | Ga0097621_100213044 | |||
| 809 | Ga0068871_100128711 | |||
| 810 | Ga0068871_100170503 | |||
| 811 | Ga0068871_100204830 | |||
| 812 | Ga0068871_100264994 | |||
| 813 | Ga0075428_100258586 | |||
| 814 | Ga0075433_10289600 | |||
| 815 | Ga0075434_100098587 | |||
| 816 | Ga0075434_100217381 | |||
| 817 | Ga0068865_100199404 | |||
| 818 | Ga0097620_100159136 | |||
| 819 | Ga0097620_100260596 | |||
| 820 | Ga0097620_100313337 | |||
| 821 | Ga0097620_100319458 | |||
| 822 | Ga0097620_100377394 | |||
| 823 | Ga0097620_100441133 | |||
| 824 | Ga0099826_10089341 | |||
| 825 | Ga0075435_100135657 | |||
| 826 | Ga0105240_10199968 | |||
| 827 | Ga0105240_10326040 | |||
| 828 | Ga0105240_10343556 | |||
| 829 | Ga0105240_10468144 | |||
| 830 | Ga0111539_10341733 | |||
| 831 | Ga0105245_10125532 | |||
| 832 | Ga0105245_10164894 | |||
| 833 | Ga0105245_10238659 | |||
| 834 | Ga0105247_10043279 | |||
| 835 | Ga0105243_10072013 | |||
| 836 | Ga0105243_10080391 | |||
| 837 | Ga0105243_10312761 | |||
| 838 | Ga0105241_10094328 | |||
| 839 | Ga0105241_10197767 | |||
| 840 | Ga0105241_10200557 | |||
| 841 | Ga0105241_10218725 | |||
| 842 | Ga0105241_10227760 | |||
| 843 | Ga0105242_10129016 | |||
| 844 | Ga0105242_10170429 | |||
| 845 | Ga0105242_10225488 | |||
| 846 | Ga0105242_10266413 | |||
| 847 | Ga0105248_10083276 | |||
| 848 | Ga0105248_10283928 | |||
| 849 | Ga0105248_10354287 | |||
| 850 | Ga0105248_10393430 | |||
| 851 | Ga0105248_10540345 | |||
| 852 | Ga0105237_10052425 | |||
| 853 | Ga0105237_10196887 | |||
| 854 | Ga0105237_10233244 | |||
| 855 | Ga0105237_10250710 | |||
| 856 | Ga0105237_10291876 | |||
| 857 | Ga0105238_10047519 | |||
| 858 | Ga0105238_10243409 | |||
| 859 | Ga0105238_10289623 | |||
| 860 | Ga0105238_10289748 | |||
| 861 | Ga0105249_10291757 | |||
| 862 | Ga0105239_10130859 | |||
| 863 | Ga0105239_10359314 | |||
| 864 | Ga0105239_10394572 | |||
| 865 | Ga0105239_10405071 | |||
| 866 | Ga0105246_10091584 | |||
| 867 | Ga0105246_10129554 | |||
| 868 | Ga0105246_10158870 | |||
| 869 | Ga0157373_10152496 | |||
| 870 | Ga0157370_10372762 | |||
| 871 | Ga0157369_10306709 | |||
| 872 | Ga0157374_10090184 | |||
| 873 | Ga0157374_10247404 | |||
| 874 | Ga0157374_10294834 | |||
| 875 | Ga0157378_10154600 | |||
| 876 | Ga0157378_10178288 | |||
| 877 | Ga0157378_10219479 | |||
| 878 | Ga0163162_10076946 | |||
| 879 | Ga0163162_10184195 | |||
| 880 | Ga0163162_10241915 | |||
| 881 | Ga0163162_10349084 | |||
| 882 | Ga0163162_10360273 | |||
| 883 | Ga0157372_10134519 | |||
| 884 | Ga0157372_10263623 | |||
| 885 | Ga0157372_10365929 | |||
| 886 | Ga0157375_10390773 | |||
| 887 | Ga0163163_10166490 | |||
| 888 | Ga0163163_10230365 | |||
| 889 | Ga0163163_10235427 | |||
| 890 | Ga0163163_10342754 | |||
| 891 | Ga0163163_10358765 | |||
| 892 | Ga0157380_10234998 | |||
| 893 | Ga0157377_10058032 | |||
| 894 | Ga0157377_10081934 | |||
| 895 | Ga0157377_10119078 | |||
| 896 | Ga0157379_10149178 | |||
| 897 | Ga0157379_10188311 | |||
| 898 | Ga0157379_10211295 | |||
| 899 | Ga0157379_10247410 | |||
| 900 | Ga0157376_10194978 | |||
| 901 | Ga0157376_10218622 | |||
| 902 | Ga0163161_10038312 | |||
| 903 | Ga0163161_10093944 | |||
| 904 | Ga0213872_10046760 | |||
| 905 | Ga0213874_10033957 | |||
| 906 | Ga0213875_10062582 | |||
| 907 | Ga0207697_10031562 | |||
| 908 | Ga0207692_10074681 | |||
| 909 | Ga0207642_10114709 | |||
| 910 | Ga0207710_10053822 | |||
| 911 | Ga0207688_10202721 | |||
| 912 | Ga0207680_10053102 | |||
| 913 | Ga0207680_10067966 | |||
| 914 | Ga0207680_10106673 | |||
| 915 | Ga0207680_10141880 | |||
| 916 | Ga0207685_10050918 | |||
| 917 | Ga0207685_10080933 | |||
| 918 | Ga0207645_10112782 | |||
| 919 | Ga0207645_10138125 | |||
| 920 | Ga0207645_10175735 | |||
| 921 | Ga0207643_10133503 | |||
| 922 | Ga0207705_10179962 | |||
| 923 | Ga0207654_10168506 | |||
| 924 | Ga0207654_10178929 | |||
| 925 | Ga0207707_10146805 | |||
| 926 | Ga0207707_10278915 | |||
| 927 | Ga0207695_10190267 | |||
| 928 | Ga0207695_10254036 | |||
| 929 | Ga0207695_10289970 | |||
| 930 | Ga0207695_10346236 | |||
| 931 | Ga0207671_10199165 | |||
| 932 | Ga0207671_10234970 | |||
| 933 | Ga0207693_10058523 | |||
| 934 | Ga0207693_10106873 | |||
| 935 | Ga0207663_10035166 | |||
| 936 | Ga0207663_10168384 | |||
| 937 | Ga0207663_10169516 | |||
| 938 | Ga0207660_10171399 | |||
| 939 | Ga0207662_10133874 | |||
| 940 | Ga0207662_10153260 | |||
| 941 | Ga0207657_10136652 | |||
| 942 | Ga0207657_10176157 | |||
| 943 | Ga0207657_10225318 | |||
| 944 | Ga0207649_10045433 | |||
| 945 | Ga0207649_10104301 | |||
| 946 | Ga0207649_10192417 | |||
| 947 | Ga0207652_10153955 | |||
| 948 | Ga0207694_10175161 | |||
| 949 | Ga0207694_10214082 | |||
| 950 | Ga0207694_10243417 | |||
| 951 | Ga0207650_10120825 | |||
| 952 | Ga0207650_10143211 | |||
| 953 | Ga0207650_10216434 | |||
| 954 | Ga0207650_10236669 | |||
| 955 | Ga0207659_10165578 | |||
| 956 | Ga0207687_10075448 | |||
| 957 | Ga0207687_10262782 | |||
| 958 | Ga0207700_10206744 | |||
| 959 | Ga0207700_10249701 | |||
| 960 | Ga0207664_10233078 | |||
| 961 | Ga0207644_10180849 | |||
| 962 | Ga0207644_10235746 | |||
| 963 | Ga0207690_10171460 | |||
| 964 | Ga0207690_10258976 | |||
| 965 | Ga0207686_10110035 | |||
| 966 | Ga0207686_10157942 | |||
| 967 | Ga0207686_10199499 | |||
| 968 | Ga0207709_10137514 | |||
| 969 | Ga0207670_10157828 | |||
| 970 | Ga0207704_10201513 | |||
| 971 | Ga0207704_10203544 | |||
| 972 | Ga0207665_10132620 | |||
| 973 | Ga0207711_10139974 | |||
| 974 | Ga0207711_10255413 | |||
| 975 | Ga0207689_10080905 | |||
| 976 | Ga0207689_10116730 | |||
| 977 | Ga0207661_10113149 | |||
| 978 | Ga0207661_10131674 | |||
| 979 | Ga0207661_10162006 | |||
| 980 | Ga0207661_10172464 | |||
| 981 | Ga0207661_10261287 | |||
| 982 | Ga0207661_10324116 | |||
| 983 | Ga0207679_10203811 | |||
| 984 | Ga0207667_10280648 | |||
| 985 | Ga0207667_10310944 | |||
| 986 | Ga0207667_10372994 | |||
| 987 | Ga0207667_10375798 | |||
| 988 | Ga0207651_10246078 | |||
| 989 | Ga0207651_10285431 | |||
| 990 | Ga0207658_10171762 | |||
| 991 | Ga0207658_10224673 | |||
| 992 | Ga0207658_10276630 | |||
| 993 | Ga0207677_10194148 | |||
| 994 | Ga0207677_10276136 | |||
| 995 | Ga0207703_10174971 | |||
| 996 | Ga0207703_10253566 | |||
| 997 | Ga0207703_10358173 | |||
| 998 | Ga0207639_10200214 | |||
| 999 | Ga0207639_10203830 | |||
| 1000 | Ga0207639_10231353 | |||
| 1001 | Ga0207639_10336284 | |||
| 1002 | Ga0207702_10065905 | |||
| 1003 | Ga0207702_10334886 | |||
| 1004 | Ga0207641_10235800 | |||
| 1005 | Ga0207641_10269716 | |||
| 1006 | Ga0207641_10281840 | |||
| 1007 | Ga0207648_10069604 | |||
| 1008 | Ga0207648_10097301 | |||
| 1009 | Ga0207676_10085707 | |||
| 1010 | Ga0207676_10294374 | |||
| 1011 | Ga0207674_10079251 | |||
| 1012 | Ga0207674_10138832 | |||
| 1013 | Ga0207674_10161890 | |||
| 1014 | Ga0207674_10225691 | |||
| 1015 | Ga0207674_10237905 | |||
| 1016 | Ga0207675_100140742 | |||
| 1017 | Ga0207683_10073452 | |||
| 1018 | Ga0207683_10189273 | |||
| 1019 | Ga0207698_10174354 | |||
| 1020 | Ga0207698_10181363 | |||
| 1021 | Ga0207698_10378874 | |||
| 1022 | Ga0268266_10183876 | |||
| 1023 | Ga0268266_10217571 | |||
| 1024 | Ga0268266_10267318 | |||
| 1025 | Ga0268265_10324751 | |||
| 1026 | Ga0268264_10233917 | |||
| 1027 | Ga0268264_10287267 | |||
| 1028 | Ga0268264_10322056 | |||
| 1029 | Ga0265326_10033391 | |||
| 1030 | Ga0265319_1045032 | |||
| 1031 | Ga0265334_10048565 | |||
| 1032 | Ga0265318_10055071 | |||
| 1033 | Ga0265323_10027546 | |||
| 1034 | Ga0265322_10031821 | |||
| 1035 | Ga0265338_10185155 | |||
| 1036 | Ga0265338_10188886 | |||
| 1037 | Ga0265324_10046602 | |||
| 1038 | Ga0265330_10041824 | |||
| 1039 | Ga0265332_10070218 | |||
| 1040 | Ga0265320_10081274 | |||
| 1041 | Ga0265325_10093491 | |||
| 1042 | Ga0265329_10040335 | |||
| 1043 | Ga0265329_10041582 | |||
| 1044 | Ga0265340_10085060 | |||
| 1045 | Ga0265339_10117443 | |||
| 1046 | Ga0265331_10070404 | |||
| 1047 | Ga0265316_10064121 | |||
| 1048 | Ga0265316_10139551 | |||
| 1049 | Ga0265316_10168140 | |||
| 1050 | Ga0307513_10198922 | |||
| 1051 | Ga0307408_100184138 | |||
| 1052 | Ga0265313_10078646 | |||
| 1053 | Ga0265314_10101531 | |||
| 1054 | Ga0265314_10140355 | |||
| 1055 | Ga0265342_10089977 | |||
| 1056 | Ga0307406_10049477 | |||
| 1057 | Ga0307406_10187013 | |||
| 1058 | Ga0307416_100330126 | |||
| 1059 | Ga0373926_0037841 | |||
| 1060 | Ga0373929_0011178 | |||
| 1061 | Ga0373934_0032716 | |||
| 1062 | Ga0373934_0039856 | |||
| 1063 | Ga0373923_0060619 | |||
| 1064 | Ga0373923_0065884 | |||
| 1065 | Ga0373932_0019512 | |||
| 1066 | Ga0373936_0009564 | |||
| 1067 | Ga0373936_0047872 | |||
| 1068 | Ga0373936_0067194 | |||
| 1069 | Ga0373945_0000987 | |||
| 1070 | Ga0373945_0026416 | |||
| 1071 | Ga0373945_0029376 | |||
| 1072 | Ga0373945_0039813 | |||
| 1073 | Ga0373953_0007621 | |||
| 1074 | Ga0373953_0051450 | |||
| 1075 | Ga0373953_0063331 | |||
| 1076 | Ga0373954_0039893 | |||
| 1077 | Ga0373954_0076272 | |||
| 1078 | Ga0373954_0080841 | |||
| 1079 | Ga0373956_0003135 | |||
| 1080 | Ga0373956_0009228 | |||
| 1081 | Ga0373956_0068585 | |||
| 1082 | Ga0373957_0019161 | |||
| 1083 | Ga0373957_0032571 | |||
| 1084 | Ga0373957_0038703 | |||
| 1085 | Ga0373943_0055635 | |||
| 1086 | Ga0373943_0072355 | |||
| 1087 | Ga0373943_0104222 | |||
| 1088 | Ga0373946_0040095 | |||
| 1089 | Ga0373946_0042439 | |||
| 1090 | Ga0373946_0065469 | |||
| 1091 | Ga0373955_0061204 | |||
| 1092 | Ga0373955_0082980 | |||
| 1093 | Ga0373955_0140585 | |||
| 1094 | Ga0373961_0040016 | |||
| 1095 | Ga0373924_0017351 | |||
| 1096 | Ga0373924_0026042 | |||
| 1097 | Ga0373924_0066294 | |||
| 1098 | Ga0373931_0079790 | |||
| 1099 | Ga0373931_0089103 | |||
| 1100 | Ga0373935_0033673 | |||
| 1101 | Ga0373935_0106626 | |||
| 1102 | Ga0373935_0127633 | |||
| 1103 | Ga0373935_0147583 | |||
| 1104 | Ga0373935_0186007 | |||
| 1105 | Ga0373927_0120712 | |||
| 1106 | Ga0373927_0139272 | |||
| 1107 | Ga0373927_0206633 | |||
| 1108 | Ga0373933_0003803 | |||
| 1109 | Ga0373933_0020833 | |||
| 1110 | Ga0373933_0060894 | |||
| 1111 | Ga0373947_0075167 | |||
| 1112 | Ga0373947_0087331 | |||
| 1113 | Ga0373947_0133841 | |||
| 1114 | Ga0373947_0134953 | |||
| 1115 | Ga0373947_0171122 | |||
| 1116 | Ga0373937_0082509 | |||
| 1117 | Ga0373937_0169931 | |||
| 1118 | Ga0373925_0016172 | |||
| 1119 | Ga0373925_0088154 | |||
| 1120 | Ga0373925_0155147 | |||
| 1121 | Ga0373925_0179848 | |||
| 1122 | Ga0373925_0231507 | |||
| 1123 | Ga0395900_0453382 | |||
| 1124 | Ga0395898_0222684 | |||
| 1125 | Ga0316581_0039703 | |||
| 1126 | Ga0436364_0204662 | |||
| 1127 | Ga0436364_0440491 | |||
| 1128 | Ga0436364_1208221 | |||
| 1129 | Ga0436364_1554448 | |||
| 1130 | Ga0395901_0198528 | |||
| 1131 | Ga0395901_0381723 | |||
| 1132 | Ga0242419_001257 | |||
| 1133 | Ga0242420_005085 | |||
| 1134 | Ga0242420_011656 | |||
| 1135 | Ga0436365_0469483 | |||
| 1136 | Ga0436360_0464691 | |||
| 1137 | Ga0436360_1091598 | |||
| 1138 | Ga0436360_1184589 | |||
| 1139 | Ga0436361_0228305 | |||
| 1140 | Ga0436361_0888187 | |||
| 1141 | Ga0436363_0172554 | |||
| 1142 | Ga0436362_0554849 | |||
| 1143 | Ga0439464_0050350 | |||
| 1144 | Ga0451577_0190630 | |||
| 1145 | Ga0451577_0197643 | |||
| 1146 | Ga0451577_0215867 | |||
| 1147 | Ga0451577_0266450 | |||
| 1148 | Ga0453683_0136227 | |||
| 1149 | Ga0453683_0157630 | |||
| 1150 | Ga0453683_0165548 | |||
| 1151 | Ga0466966_0129756 | |||
| 1152 | Ga0466961_0092976 | |||
| 1153 | Ga0466963_0147398 | |||
| 1154 | Ga0453684_0280023 | |||
| 1155 | Ga0453684_0333259 | |||
| 1156 | Ga0453684_0385165 | |||
| 1157 | Ga0453684_0494233 | |||
| 1158 | Ga0466971_0070005 | |||
| 1159 | Ga0466968_0023697 | |||
| 1160 | Ga0466970_0055537 | |||
| 1161 | Ga0466957_0062551 | |||
| 1162 | Ga0466960_0069109 | |||
| 1163 | Ga0466959_0171378 | |||
| 1164 | Ga0451576_0251476 | |||
| 1165 | Ga0451576_0261665 | |||
| 1166 | Ga0451576_0391390 | |||
| 1167 | Ga0466967_0230413 | |||
| 1168 | Ga0466967_0308868 | |||
| 1169 | Ga0466967_0331206 | |||
| 1170 | Ga0495592_0070752 | |||
| 1171 | Ga0495592_0096702 | |||
| 1172 | Ga0495592_0160445 | |||
| 1173 | Ga0495629_0105163 | |||
| 1174 | Ga0495629_0164104 | |||
| 1175 | Ga0495638_0109358 | |||
| 1176 | Ga0495651_0043111 | |||
| 1177 | Ga0495651_0103506 | |||
| 1178 | Ga0495653_0122754 | |||
| 1179 | Ga0495653_0154009 | |||
| 1180 | Ga0495580_0073598 | |||
| 1181 | Ga0495580_0127890 | |||
| 1182 | Ga0495580_0137905 | |||
| 1183 | Ga0495580_0242840 | |||
| 1184 | Ga0495582_0080288 | |||
| 1185 | Ga0495582_0089169 | |||
| 1186 | Ga0495582_0120596 | |||
| 1187 | Ga0495639_0048854 | |||
| 1188 | Ga0495662_0090102 | |||
| 1189 | Ga0495662_0110656 | |||
| 1190 | Ga0495664_0043836 | |||
| 1191 | Ga0495664_0146207 | |||
| 1192 | Ga0495594_0018679 | |||
| 1193 | Ga0495583_0063183 | |||
| 1194 | Ga0495608_0097193 | |||
| 1195 | Ga0495608_0112904 | |||
| 1196 | Ga0495608_0115737 | |||
| 1197 | Ga0495618_0068405 | |||
| 1198 | Ga0495628_0166249 | |||
| 1199 | Ga0495630_0042002 | |||
| 1200 | Ga0495630_0110168 | |||
| 1201 | Ga0495666_0057454 | |||
| 1202 | Ga0495652_0119987 | |||
| 1203 | Ga0495652_0129978 | |||
| 1204 | Ga0495652_0140219 | |||
| 1205 | Ga0495665_0050102 | |||
| 1206 | Ga0495665_0061276 | |||
| 1207 | Ga0495665_0094320 | |||
| 1208 | Ga0495640_0056846 | |||
| 1209 | Ga0495640_0097773 | |||
| 1210 | Ga0495640_0137766 | |||
| 1211 | Ga0495586_0074111 | |||
| 1212 | Ga0495587_0038821 | |||
| 1213 | Ga0495587_0044137 | |||
| 1214 | Ga0495587_0089806 | |||
| 1215 | Ga0495587_0128009 | |||
| 1216 | Ga0495645_0095550 | |||
| 1217 | Ga0495645_0145099 | |||
| 1218 | Ga0495667_0076953 | |||
| 1219 | Ga0495667_0112399 | |||
| 1220 | Ga0495634_0099858 | |||
| 1221 | Ga0495625_0196247 | |||
| 1222 | Ga0495635_0171258 | |||
| 1223 | Ga0495588_0149576 | |||
| 1224 | Ga0495657_0126439 | |||
| 1225 | Ga0495599_0112130 | |||
| 1226 | Ga0495599_0134306 | |||
| 1227 | Ga0495623_0085314 | |||
| 1228 | Ga0495623_0096805 | |||
| 1229 | Ga0495623_0126635 | |||
| 1230 | Ga0495646_0087858 | |||
| 1231 | Ga0495669_0067577 | |||
| 1232 | Ga0495613_0149500 | |||
| 1233 | Ga0495624_0101387 | |||
| 1234 | Ga0495600_0070186 | |||
| 1235 | Ga0495600_0153148 | |||
| 1236 | Ga0495604_0119510 | |||
| 1237 | Ga0495604_0136373 | |||
| 1238 | Ga0495604_0154274 | |||
| 1239 | Ga0495604_0196541 | |||
| 1240 | Ga0495674_0140721 | |||
| 1241 | Ga0495674_0162581 | |||
| 1242 | Ga0495674_0194754 | |||
| 1243 | Ga0495680_0046296 | |||
| 1244 | Ga0495675_0033592 | |||
| 1245 | Ga0495675_0129034 | |||
| 1246 | Ga0495675_0140815 | |||
| 1247 | Ga0495684_0032147 | |||
| 1248 | Ga0495684_0062332 | |||
| 1249 | Ga0495684_0089759 | |||
| 1250 | Ga0495684_0146615 | |||
| 1251 | Ga0495602_0057676 | |||
| 1252 | Ga0495602_0186549 | |||
| 1253 | Ga0496100_0205627 | |||
| 1254 | Ga0496101_0245382 | |||
| 1255 | Ga0496104_0147256 | |||
| 1256 | Ga0496104_0179335 | |||
| 1257 | Ga0496104_0221242 | |||
| 1258 | Ga0496104_0281536 | |||
| 1259 | Ga0496105_0117898 | |||
| 1260 | Ga0496105_0210142 | |||
| 1261 | Ga0496106_0150525 | |||
| 1262 | Ga0496106_0165105 | |||
| 1263 | Ga0496106_0258074 | |||
| 1264 | Ga0496107_0216787 | |||
| 1265 | Ga0496108_0139612 | |||
| 1266 | Ga0496109_0375206 | |||
| 1267 | Ga0496110_0157379 | |||
| 1268 | Ga0496111_0076945 | |||
| 1269 | Ga0496112_0248581 | |||
| 1270 | Ga0496112_0300124 | |||
| 1271 | Ga0496113_0098272 | |||
| 1272 | Ga0496113_0244969 | |||
| 1273 | Ga0496115_0128482 | |||
| 1274 | Ga0496115_0257379 | |||
| 1275 | Ga0501031_0134512 | |||
| 1276 | Ga0501032_0064489 | |||
| 1277 | Ga0501033_0041080 | |||
| 1278 | Ga0501034_0258843 | |||
| 1279 | Ga0501034_0352167 | |||
| 1280 | Ga0501036_0187834 | |||
| 1281 | Ga0501037_0173462 | |||
| 1282 | Ga0501038_0069478 | |||
| 1283 | Ga0501043_0194881 | |||
| 1284 | Ga0501043_0241034 | |||
| 1285 | Ga0501046_0190692 | |||
| 1286 | Ga0501047_0302614 | |||
| 1287 | Ga0501048_0143014 | |||
| 1288 | Ga0501048_0143596 | |||
| 1289 | Ga0501070_0162733 | |||
| 1290 | Ga0501074_0175016 | |||
| 1291 | Ga0501079_0160600 | |||
| 1292 | Ga0501080_0172905 | |||
| 1293 | Ga0501080_0181154 | |||
| 1294 | Ga0501035_0277086 | |||
| 1295 | Ga0501035_0283814 | |||
| 1296 | Ga0501045_0027287 | |||
| 1297 | nmdc:mga0n895_219449_c1 | |||
| 1298 | nmdc:mga0n895_243129_c1 | |||
| 1299 | nmdc:mga0rr50_118203_c1 | |||
| 1300 | nmdc:mga08x19_194404_c1 | |||
| 1301 | nmdc:mga0a205_295108_c1 | |||
| 1302 | Ga0495601_0107198 | |||
| 1303 | Ga0495612_0038798 | |||
| 1304 | Ga0495612_0050741 | |||
| 1305 | Ga0495595_0067266 | |||
| 1306 | Ga0495595_0085590 | |||
| 1307 | Ga0495619_0085949 | |||
| 1308 | Ga0495619_0146003 | |||
| 1309 | Ga0495619_0161744 | |||
| 1310 | Ga0500593_080841 | |||
| 1311 | Ga0500594_0015027 | |||
| 1312 | Ga0500617_088661 | |||
| 1313 | Ga0500658_0068143 | |||
| 1314 | Ga0500568_0024724 | |||
| 1315 | Ga0500588_0008660 | |||
| 1316 | Ga0500616_0010868 | |||
| 1317 | Ga0501084_0195795 | |||
| 1318 | Ga0501082_0143211 | |||
| 1319 | Ga0501082_0179143 | |||
| 1320 | 2644123779 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xg8-assembly1.cif.gz_B | iscth4 transposase, pre-cleaved complex, pcc | 0.8157 | 1 | 399 |
| 6xgx-assembly1.cif.gz_B | iscth4 transposase, strand transfer complex 1, stc1 | 0.8147 | 1 | 400 |
| 6xg8-assembly1.cif.gz_B | iscth4 transposase, pre-cleaved complex, pcc | 0.8046 | 1 | 399 |
| 6xgx-assembly1.cif.gz_B | iscth4 transposase, strand transfer complex 1, stc1 | 0.7992 | 1 | 400 |
| 6xgw-assembly1.cif.gz_B | iscth4 transposase, pre-reaction complex, prc | 0.7783 | 1 | 399 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LV62_47_129_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8498 | 200 | 263 | 3.30.420.10 |
| af_A0A0P0VVK9_357_451_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8065 | 167 | 261 | 3.30.420.10 |
| af_I1MFY3_263_357_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7973 | 167 | 263 | 3.30.420.10 |
| af_A0A0P0VHN3_509_601_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7914 | 184 | 257 | 3.30.420.10 |
| af_A0A0N7KL01_497_591_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7875 | 168 | 261 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R9BZJ2-F1-model_v4 | Mutator family transposase | 0.9893 | 140 | 265 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-L1QGH8-F1-model_v4 | Mutator family transposase | 0.9839 | 172 | 270 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A3D1RMU3-F1-model_v4 | Mutator family transposase | 0.9808 | 191 | 308 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A2A5K2R8-F1-model_v4 | deleted | 0.9774 | 160 | 259 |
|
| AF-A0A1G6E8S5-F1-model_v4 | Mutator family transposase | 0.9745 | 6 | 107 |
GO:0003677
GO:0004803 GO:0006313 |