F473327

General Info

Members Datasets Scaffolds Average Seq Length
660 271 1320 182

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10795615|Ga0114129_107956152
Length 188
Sequence VRIEKLRTEHDVKIEWVHFPLHPETPPEGRALGDLFRGRSAEQRKAMHAQMKERMDAEGLPYGERTMTYNSRLAQELGKWADTQPGGGDAFHDAMFRAYFVDARDISDREVLLEIAGRVGLSVEGAREVLDQRTFKAAVDEDWKLSREYGITGVPTFVIGRYGVVGAQPYEALEQLVRKASEPDAAGG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.76
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 8.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10795615 3300009147 Archaea 1207
2 JGI26129J50193_1001831 3300003349 Bacteria 1474
3 Ga0065707_10341289 3300005295 Bacteria 933
4 Ga0070676_10091100 3300005328 Bacteria 1868
5 Ga0070683_100065859 3300005329 Bacteria 3374
6 Ga0070690_100058994 3300005330 Bacteria 2466
7 Ga0070690_100066158 3300005330 Bacteria 2339
8 Ga0070670_100002721 3300005331 Bacteria 14603
9 Ga0068869_100000012 3300005334 Bacteria 75525
10 Ga0068869_101105873 3300005334 Bacteria 693
11 Ga0068869_101396652 3300005334 Bacteria 620
12 Ga0070666_10223656 3300005335 Bacteria 1328
13 Ga0070680_100000130 3300005336 Bacteria 44941
14 Ga0070680_100027390 3300005336 Bacteria 4563
15 Ga0070682_100333142 3300005337 Bacteria 1125
16 Ga0068868_100304713 3300005338 Bacteria 1354
17 Ga0070660_100000314 3300005339 Bacteria 32233
18 Ga0070689_100000894 3300005340 Bacteria 18602
19 Ga0070689_100020438 3300005340 Bacteria 4913
20 Ga0070691_10000538 3300005341 Bacteria 14317
21 Ga0070687_100192089 3300005343 Bacteria 1231
22 Ga0070661_100006123 3300005344 Bacteria 8281
23 Ga0070692_10017625 3300005345 Bacteria 3418
24 Ga0070668_100102517 3300005347 Bacteria 2269
25 Ga0070668_100620383 3300005347 Unclassified 948
26 Ga0070669_100009496 3300005353 Bacteria 6929
27 Ga0070669_100046604 3300005353 Bacteria 3162
28 Ga0070669_100199284 3300005353 Bacteria 1574
29 Ga0070675_100583543 3300005354 Bacteria 1013
30 Ga0070671_100071685 3300005355 Bacteria 2892
31 Ga0070673_100026688 3300005364 Bacteria 4270
32 Ga0070659_100000210 3300005366 Bacteria 45474
33 Ga0070703_10004543 3300005406 Bacteria 3903
34 Ga0070703_10086036 3300005406 Bacteria 1081
35 Ga0070714_100154493 3300005435 Bacteria 2070
36 Ga0070701_10064406 3300005438 Bacteria 1942
37 Ga0070701_10084508 3300005438 Bacteria 1726
38 Ga0070711_100582391 3300005439 Bacteria 932
39 Ga0070705_100000800 3300005440 Bacteria 17755
40 Ga0070705_100033160 3300005440 Bacteria 2876
41 Ga0070705_100365031 3300005440 Bacteria 1057
42 Ga0070700_100499004 3300005441 Bacteria 936
43 Ga0070694_100003078 3300005444 Bacteria 9934
44 Ga0070694_100010122 3300005444 Bacteria 5801
45 Ga0070694_100176949 3300005444 Bacteria 1575
46 Ga0070708_100008471 3300005445 Bacteria 8257
47 Ga0070708_100022122 3300005445 Bacteria 5389
48 Ga0070708_100072841 3300005445 Bacteria 3096
49 Ga0070708_100076269 3300005445 Bacteria 3027
50 Ga0070708_100091271 3300005445 Bacteria 2774
51 Ga0070708_100136904 3300005445 Bacteria 2269
52 Ga0070708_100204068 3300005445 Bacteria 1851
53 Ga0070708_100345727 3300005445 Bacteria 1401
54 Ga0070663_100014348 3300005455 Bacteria 5084
55 Ga0070663_101058465 3300005455 Unclassified 708
56 Ga0070662_100012491 3300005457 Bacteria 5631
57 Ga0070662_100235387 3300005457 Bacteria 1467
58 Ga0070662_100658403 3300005457 Bacteria 884
59 Ga0070681_10002040 3300005458 Bacteria 18301
60 Ga0068867_100003134 3300005459 Bacteria 11663
61 Ga0068867_100696821 3300005459 Unclassified 896
62 Ga0070706_100053145 3300005467 Bacteria 3739
63 Ga0070706_100310720 3300005467 Bacteria 1470
64 Ga0070706_100364462 3300005467 Bacteria 1346
65 Ga0070706_100601797 3300005467 Bacteria 1021
66 Ga0070706_101266712 3300005467 Bacteria 677
67 Ga0070707_100011666 3300005468 Bacteria 8198
68 Ga0070707_100018265 3300005468 Bacteria 6599
69 Ga0070707_100048092 3300005468 Bacteria 4085
70 Ga0070707_100050579 3300005468 Bacteria 3983
71 Ga0070707_100071960 3300005468 Bacteria 3331
72 Ga0070707_100139837 3300005468 Bacteria 2356
73 Ga0070707_100155236 3300005468 Bacteria 2230
74 Ga0070707_101132456 3300005468 Bacteria 748
75 Ga0070698_100051042 3300005471 Bacteria 4214
76 Ga0070698_100091624 3300005471 Bacteria 3022
77 Ga0070698_100174313 3300005471 Bacteria 2091
78 Ga0070698_100521429 3300005471 Bacteria 1127
79 Ga0070699_100006433 3300005518 Bacteria 10229
80 Ga0070699_100120147 3300005518 Bacteria 2310
81 Ga0070699_100122389 3300005518 Unclassified 2289
82 Ga0070699_100129899 3300005518 Bacteria 2220
83 Ga0070699_100161901 3300005518 Bacteria 1980
84 Ga0070699_100204510 3300005518 Bacteria 1756
85 Ga0070699_100527780 3300005518 Unclassified 1074
86 Ga0070679_100002034 3300005530 Bacteria 18160
87 Ga0070679_100681104 3300005530 Bacteria 971
88 Ga0070684_100659996 3300005535 Bacteria 974
89 Ga0070697_100067384 3300005536 Bacteria 2928
90 Ga0070697_100117705 3300005536 Bacteria 2220
91 Ga0070697_100128296 3300005536 Bacteria 2125
92 Ga0070697_100139712 3300005536 Bacteria 2036
93 Ga0070697_100162191 3300005536 Bacteria 1889
94 Ga0070697_100268296 3300005536 Bacteria 1462
95 Ga0070697_100410788 3300005536 Bacteria 1175
96 Ga0068853_100000911 3300005539 Bacteria 20652
97 Ga0070672_100132267 3300005543 Bacteria 2052
98 Ga0070695_100001699 3300005545 Bacteria 12390
99 Ga0070695_100005431 3300005545 Bacteria 7498
100 Ga0070695_100047150 3300005545 Bacteria 2751
101 Ga0070695_100070833 3300005545 Bacteria 2282
102 Ga0070695_100320075 3300005545 Bacteria 1153
103 Ga0070696_100000252 3300005546 Bacteria 32358
104 Ga0070696_100082138 3300005546 Bacteria 2284
105 Ga0070696_100192512 3300005546 Bacteria 1518
106 Ga0070696_100206182 3300005546 Bacteria 1470
107 Ga0070693_100001409 3300005547 Bacteria 10840
108 Ga0070693_100016688 3300005547 Bacteria 3805
109 Ga0070704_100000437 3300005549 Bacteria 19549
110 Ga0070704_100299250 3300005549 Bacteria 1340
111 Ga0070704_100309322 3300005549 Bacteria 1320
112 Ga0070704_100647300 3300005549 Bacteria 933
113 Ga0070704_101007051 3300005549 Bacteria 754
114 Ga0068855_100000567 3300005563 Bacteria 45343
115 Ga0070664_100011658 3300005564 Bacteria 7132
116 Ga0068854_100001260 3300005578 Bacteria 15212
117 Ga0068854_100206298 3300005578 Bacteria 1548
118 Ga0068856_100004512 3300005614 Bacteria 13843
119 Ga0068856_100308663 3300005614 Bacteria 1600
120 Ga0070702_100030216 3300005615 Bacteria 2952
121 Ga0068852_101182212 3300005616 Unclassified 786
122 Ga0068859_100001346 3300005617 Bacteria 25058
123 Ga0068859_100068896 3300005617 Bacteria 3572
124 Ga0068859_100121236 3300005617 Bacteria 2681
125 Ga0068859_100398252 3300005617 Unclassified 1472
126 Ga0068859_100507585 3300005617 Bacteria 1301
127 Ga0068859_100688338 3300005617 Bacteria 1113
128 Ga0068859_101814814 3300005617 Bacteria 673
129 Ga0068864_100143245 3300005618 Bacteria 2158
130 Ga0068864_100269382 3300005618 Bacteria 1586
131 Ga0068866_10842514 3300005718 Bacteria 641
132 Ga0068861_100008465 3300005719 Bacteria 7085
133 Ga0068861_100680786 3300005719 Unclassified 953
134 Ga0068870_10000824 3300005840 Bacteria 12060
135 Ga0068863_100099476 3300005841 Unclassified 2763
136 Ga0068860_100042665 3300005843 Bacteria 4331
137 Ga0068860_100069254 3300005843 Bacteria 3353
138 Ga0068860_100448979 3300005843 Unclassified 1282
139 Ga0068862_100014908 3300005844 Bacteria 6457
140 Ga0068862_100016041 3300005844 Bacteria 6230
141 Ga0068862_100176782 3300005844 Bacteria 1914
142 Ga0068862_100234922 3300005844 Unclassified 1664
143 Ga0081455_10000459 3300005937 Bacteria 53464
144 Ga0081455_10025531 3300005937 Bacteria 5451
145 Ga0081538_10029976 3300005981 Bacteria 3703
146 Ga0081540_1004849 3300005983 Bacteria 10137
147 Ga0070715_10156198 3300006163 Bacteria 1123
148 Ga0070716_100017969 3300006173 Bacteria 3676
149 Ga0075428_100064988 3300006844 Bacteria 3995
150 Ga0075428_100161635 3300006844 Bacteria 2431
151 Ga0075428_100284659 3300006844 Bacteria 1778
152 Ga0075428_100822872 3300006844 Bacteria 987
153 Ga0075428_101148060 3300006844 Bacteria 820
154 Ga0075430_100008644 3300006846 Bacteria 8590
155 Ga0075431_100002021 3300006847 Bacteria 19367
156 Ga0075431_100005691 3300006847 Bacteria 12315
157 Ga0075431_100104460 3300006847 Bacteria 2924
158 Ga0075431_100253442 3300006847 Bacteria 1788
159 Ga0075431_100614711 3300006847 Unclassified 1070
160 Ga0075433_10003752 3300006852 Bacteria 11756
161 Ga0075433_10007770 3300006852 Bacteria 8521
162 Ga0075433_10033360 3300006852 Bacteria 4413
163 Ga0075433_10045240 3300006852 Bacteria 3826
164 Ga0075433_10065490 3300006852 Bacteria 3187
165 Ga0075433_10156381 3300006852 Bacteria 2028
166 Ga0075433_10347613 3300006852 Bacteria 1310
167 Ga0075434_100008173 3300006871 Bacteria 9706
168 Ga0075434_100009400 3300006871 Bacteria 9112
169 Ga0075434_100012625 3300006871 Bacteria 8010
170 Ga0075434_100177738 3300006871 Unclassified 2148
171 Ga0075429_100014510 3300006880 Bacteria 6829
172 Ga0075429_100213639 3300006880 Bacteria 1690
173 Ga0075429_100670272 3300006880 Unclassified 909
174 Ga0075429_100760505 3300006880 Bacteria 849
175 Ga0075429_101279178 3300006880 Bacteria 640
176 Ga0068865_100661681 3300006881 Bacteria 889
177 Ga0075436_100007060 3300006914 Bacteria 7691
178 Ga0075436_100407468 3300006914 Bacteria 986
179 Ga0097620_100001346 3300006931 Bacteria 25058
180 Ga0097620_100068899 3300006931 Bacteria 3572
181 Ga0097620_100121247 3300006931 Bacteria 2681
182 Ga0097620_100398238 3300006931 Unclassified 1472
183 Ga0097620_100507531 3300006931 Bacteria 1301
184 Ga0097620_100688368 3300006931 Bacteria 1113
185 Ga0097620_101814833 3300006931 Bacteria 673
186 Ga0075435_100001558 3300007076 Bacteria 14793
187 Ga0075435_100001827 3300007076 Bacteria 13837
188 Ga0075435_100007439 3300007076 Bacteria 7802
189 Ga0075435_100216695 3300007076 Bacteria 1625
190 Ga0075435_100339199 3300007076 Bacteria 1288
191 Ga0075435_100519007 3300007076 Bacteria 1030
192 Ga0099794_10015617 3300007265 Bacteria 3356
193 Ga0111539_10002045 3300009094 Bacteria 26976
194 Ga0111539_10005755 3300009094 Bacteria 16026
195 Ga0111539_10063842 3300009094 Bacteria 4357
196 Ga0111539_10100086 3300009094 Bacteria 3404
197 Ga0111539_10944831 3300009094 Bacteria 1002
198 Ga0105245_10145759 3300009098 Bacteria 2234
199 Ga0114129_10128903 3300009147 Bacteria 3476
200 Ga0114129_10140588 3300009147 Unclassified 3310
201 Ga0114129_10175235 3300009147 Bacteria 2921
202 Ga0114129_10388966 3300009147 Bacteria 1840
203 Ga0114129_10439930 3300009147 Bacteria 1712
204 Ga0114129_10926210 3300009147 Bacteria 1102
205 Ga0105243_10633289 3300009148 Unclassified 1034
206 Ga0105243_10753334 3300009148 Bacteria 955
207 Ga0105241_10000778 3300009174 Bacteria 24240
208 Ga0105241_10015238 3300009174 Bacteria 5630
209 Ga0105241_10680395 3300009174 Bacteria 937
210 Ga0105242_10140648 3300009176 Bacteria 2094
211 Ga0105248_10027558 3300009177 Bacteria 6327
212 Ga0105248_10507253 3300009177 Bacteria 1360
213 Ga0105248_10826500 3300009177 Bacteria 1046
214 Ga0105249_10062667 3300009553 Bacteria 3414
215 Ga0105249_10284542 3300009553 Bacteria 1652
216 Ga0105249_10367326 3300009553 Unclassified 1462
217 Ga0105249_11153040 3300009553 Unclassified 846
218 Ga0105239_11528347 3300010375 Bacteria 771
219 Ga0105239_11990053 3300010375 Bacteria 674
220 Ga0105246_10118575 3300011119 Bacteria 1957
221 Ga0157373_10000316 3300013100 Bacteria 38900
222 Ga0157373_10245439 3300013100 Unclassified 1266
223 Ga0157371_10093328 3300013102 Bacteria 2133
224 Ga0157371_10302012 3300013102 Bacteria 1159
225 Ga0157378_10642299 3300013297 Unclassified 1076
226 Ga0157378_12062219 3300013297 Bacteria 621
227 Ga0163162_10017314 3300013306 Bacteria 7051
228 Ga0157372_10001422 3300013307 Bacteria 25836
229 Ga0157372_10560487 3300013307 Bacteria 1332
230 Ga0157375_10061509 3300013308 Bacteria 3728
231 Ga0163163_10045550 3300014325 Bacteria 4306
232 Ga0157380_10233446 3300014326 Unclassified 1654
233 Ga0157380_10322074 3300014326 Bacteria 1433
234 Ga0182008_10040500 3300014497 Bacteria 2326
235 Ga0157377_10049286 3300014745 Bacteria 2367
236 Ga0157379_10647596 3300014968 Bacteria 989
237 Ga0182007_10155532 3300015262 Bacteria 779
238 Ga0206356_10521279 3300020070 Bacteria 1323
239 Ga0206355_1292207 3300020076 Unclassified 702
240 Ga0224712_10362410 3300022467 Bacteria 686
241 Ga0207653_10001470 3300025885 Bacteria 7652
242 Ga0207642_10219783 3300025899 Bacteria 1061
243 Ga0207688_10042519 3300025901 Bacteria 2530
244 Ga0207680_10226365 3300025903 Bacteria 1284
245 Ga0207685_10014233 3300025905 Unclassified 2485
246 Ga0207645_10000671 3300025907 Bacteria 28334
247 Ga0207645_10045188 3300025907 Bacteria 2815
248 Ga0207643_10001764 3300025908 Bacteria 12075
249 Ga0207643_10078001 3300025908 Bacteria 1916
250 Ga0207684_10014106 3300025910 Bacteria 6901
251 Ga0207684_10058644 3300025910 Bacteria 3267
252 Ga0207684_10068729 3300025910 Bacteria 3010
253 Ga0207684_10104474 3300025910 Bacteria 2422
254 Ga0207684_10142584 3300025910 Bacteria 2060
255 Ga0207654_10166378 3300025911 Bacteria 1428
256 Ga0207707_10000034 3300025912 Bacteria 152677
257 Ga0207693_10045437 3300025915 Unclassified 3451
258 Ga0207660_10000759 3300025917 Bacteria 21473
259 Ga0207662_10004424 3300025918 Bacteria 7390
260 Ga0207662_10508620 3300025918 Bacteria 830
261 Ga0207657_10000365 3300025919 Bacteria 47574
262 Ga0207649_10022489 3300025920 Bacteria 3643
263 Ga0207652_10000430 3300025921 Bacteria 43655
264 Ga0207646_10018570 3300025922 Bacteria 6483
265 Ga0207646_10052047 3300025922 Bacteria 3664
266 Ga0207646_10054636 3300025922 Bacteria 3572
267 Ga0207646_10087480 3300025922 Bacteria 2788
268 Ga0207646_10091465 3300025922 Bacteria 2723
269 Ga0207646_10191469 3300025922 Bacteria 1847
270 Ga0207646_10326891 3300025922 Unclassified 1385
271 Ga0207681_10016242 3300025923 Bacteria 4654
272 Ga0207681_10121274 3300025923 Bacteria 1918
273 Ga0207681_10175048 3300025923 Bacteria 1630
274 Ga0207650_10002316 3300025925 Bacteria 13271
275 Ga0207687_10086481 3300025927 Bacteria 2276
276 Ga0207644_10473300 3300025931 Bacteria 1031
277 Ga0207690_10000781 3300025932 Bacteria 20611
278 Ga0207706_10001814 3300025933 Bacteria 20975
279 Ga0207706_10010767 3300025933 Bacteria 8349
280 Ga0207706_10044701 3300025933 Bacteria 3925
281 Ga0207706_10149284 3300025933 Bacteria 2056
282 Ga0207709_10211405 3300025935 Bacteria 1392
283 Ga0207709_10340206 3300025935 Bacteria 1129
284 Ga0207670_10015140 3300025936 Bacteria 4599
285 Ga0207670_10389693 3300025936 Bacteria 1111
286 Ga0207704_10538129 3300025938 Bacteria 947
287 Ga0207665_10022111 3300025939 Bacteria 4181
288 Ga0207691_10030677 3300025940 Bacteria 5022
289 Ga0207691_10081511 3300025940 Bacteria 2908
290 Ga0207689_10000345 3300025942 Bacteria 43436
291 Ga0207689_10918740 3300025942 Bacteria 738
292 Ga0207679_10000607 3300025945 Bacteria 23847
293 Ga0207667_10000308 3300025949 Bacteria 67806
294 Ga0207651_10003335 3300025960 Bacteria 7871
295 Ga0207651_10264146 3300025960 Bacteria 1415
296 Ga0207712_10016847 3300025961 Bacteria 4739
297 Ga0207712_10126833 3300025961 Bacteria 1938
298 Ga0207712_11067967 3300025961 Bacteria 718
299 Ga0207640_10001175 3300025981 Bacteria 14345
300 Ga0207640_10195419 3300025981 Bacteria 1528
301 Ga0207658_10517153 3300025986 Bacteria 1065
302 Ga0207677_10042304 3300026023 Bacteria 3020
303 Ga0207703_10710574 3300026035 Bacteria 956
304 Ga0207639_10072209 3300026041 Bacteria 2702
305 Ga0207678_10021490 3300026067 Bacteria 5659
306 Ga0207708_10968741 3300026075 Bacteria 738
307 Ga0207702_10010131 3300026078 Bacteria 7895
308 Ga0207641_10094566 3300026088 Bacteria 2621
309 Ga0207641_10672996 3300026088 Bacteria 1018
310 Ga0207648_10003844 3300026089 Bacteria 15690
311 Ga0207648_10180476 3300026089 Bacteria 1868
312 Ga0207676_10009413 3300026095 Bacteria 6953
313 Ga0207674_10000991 3300026116 Bacteria 37044
314 Ga0207675_100021189 3300026118 Bacteria 6055
315 Ga0207675_100252016 3300026118 Bacteria 1709
316 Ga0207675_101028328 3300026118 Unclassified 843
317 Ga0209969_1003631 3300027360 Bacteria 2139
318 Ga0209967_1007194 3300027364 Unclassified 1518
319 Ga0209981_1009132 3300027378 Bacteria 1353
320 Ga0210000_1011570 3300027462 Unclassified 1308
321 Ga0209968_1006559 3300027526 Unclassified 1754
322 Ga0209982_1003270 3300027552 Bacteria 2296
323 Ga0210002_1005291 3300027617 Bacteria 1937
324 Ga0209983_1092780 3300027665 Bacteria 681
325 Ga0209588_1004128 3300027671 Bacteria 4073
326 Ga0209588_1016488 3300027671 Bacteria 2281
327 Ga0209971_1000203 3300027682 Bacteria 17744
328 Ga0209966_1000352 3300027695 Bacteria 14073
329 Ga0209966_1031053 3300027695 Bacteria 1082
330 Ga0209998_10000178 3300027717 Bacteria 23073
331 Ga0209974_10012941 3300027876 Bacteria 2784
332 Ga0209974_10205955 3300027876 Bacteria 728
333 Ga0207428_10000336 3300027907 Bacteria 61182
334 Ga0207428_10029695 3300027907 Bacteria 4527
335 Ga0207428_10326977 3300027907 Unclassified 1131
336 Ga0268265_10016759 3300028380 Bacteria 5043
337 Ga0268265_10017365 3300028380 Bacteria 4964
338 Ga0268265_10045737 3300028380 Bacteria 3268
339 Ga0268265_10178760 3300028380 Bacteria 1821
340 Ga0268265_10212468 3300028380 Unclassified 1687
341 Ga0268264_10109661 3300028381 Bacteria 2415
342 Ga0268264_11089258 3300028381 Bacteria 807
343 Ga0307408_100049079 3300031548 Bacteria 3030
344 Ga0316575_10023827 3300031665 Bacteria 2367
345 Ga0316575_10033285 3300031665 Bacteria 2021
346 Ga0316579_10006943 3300031691 Bacteria 4648
347 Ga0316576_10192766 3300031727 Bacteria 1536
348 Ga0316578_10110053 3300031728 Bacteria 1654
349 Ga0307405_10155873 3300031731 Archaea 1612
350 Ga0316577_10333038 3300031733 Bacteria 861
351 Ga0307410_10273316 3300031852 Bacteria 1323
352 Ga0307416_100749714 3300032002 Archaea 1069
353 Ga0307411_10340957 3300032005 Unclassified 1218
354 Ga0307411_10447219 3300032005 Unclassified 1080
355 Ga0316583_10016391 3300032133 Bacteria 2667
356 Ga0373948_0122977 3300034817 Bacteria 628
357 Ga0373950_0006630 3300034818 Bacteria 1773
358 Ga0373959_0018425 3300034820 Bacteria 1313
359 Ga0373926_0282334 3300035083 Bacteria 646
360 Ga0373929_0063987 3300035085 Bacteria 867
361 Ga0373940_0008356 3300035088 Bacteria 2372
362 Ga0373944_0098269 3300035089 Bacteria 986
363 Ga0373949_0025434 3300035090 Bacteria 1381
364 Ga0373951_0056206 3300035091 Bacteria 977
365 Ga0373936_0092741 3300035113 Bacteria 1267
366 Ga0316574_0010503 3300035398 Bacteria 5237
367 Ga0373931_0110284 3300035691 Bacteria 1560
368 Ga0373947_0033457 3300035725 Bacteria 3035
369 Ga0316582_0057262 3300036647 Bacteria 2489
370 Ga0316584_0653137 3300036712 Bacteria 725
371 Ga0373925_0292503 3300037068 Bacteria 1313
372 Ga0436365_1019957 3300039437 Bacteria 1011
373 Ga0436365_1155282 3300039437 Bacteria 622
374 Ga0436361_0287471 3300039447 Bacteria 642
375 Ga0436361_0646384 3300039447 Bacteria 1847
376 Ga0436361_0964499 3300039447 Bacteria 1956
377 Ga0436362_1127113 3300039453 Bacteria 1645
378 Ga0439461_0001987 3300041410 Bacteria 3232
379 Ga0439431_0083874 3300041997 Unclassified 862
380 Ga0439441_007428 3300042001 Bacteria 1765
381 Ga0439441_054271 3300042001 Bacteria 832
382 Ga0439448_0001352 3300042005 Bacteria 6288
383 Ga0439463_024582 3300042016 Bacteria 1510
384 Ga0439434_0004174 3300042435 Bacteria 4217
385 Ga0439435_0000022 3300042436 Bacteria 17156
386 Ga0439444_0045442 3300042437 Bacteria 877
387 Ga0439459_0000745 3300042438 Bacteria 4466
388 Ga0439464_0012390 3300042439 Bacteria 2271
389 Ga0439460_0001556 3300042461 Bacteria 5408
390 Ga0451577_0098067 3300042876 Bacteria 2617
391 Ga0451577_0221962 3300042876 Bacteria 1708
392 Ga0453683_0064275 3300044673 Bacteria 2293
393 Ga0453683_0366095 3300044673 Bacteria 927
394 Ga0466964_0176473 3300044706 Bacteria 1010
395 Ga0453684_0014598 3300044712 Bacteria 12541
396 Ga0453684_0854246 3300044712 Unclassified 978
397 Ga0453684_0865481 3300044712 Bacteria 970
398 Ga0451576_0110733 3300045051 Bacteria 2857
399 Ga0451576_0172786 3300045051 Bacteria 2255
400 Ga0451576_0236108 3300045051 Bacteria 1910
401 Ga0451576_0346019 3300045051 Bacteria 1556
402 Ga0451576_1175579 3300045051 Bacteria 801
403 Ga0466958_0363700 3300045836 Bacteria 932
404 Ga0466967_0231316 3300045976 Bacteria 1760
405 Ga0495603_0278296 3300046455 Unclassified 962
406 Ga0495580_0221231 3300046472 Bacteria 1301
407 Ga0495594_0110226 3300046499 Bacteria 1552
408 Ga0495594_0254558 3300046499 Bacteria 1000
409 Ga0495598_0015446 3300046537 Unclassified 1929
410 Ga0495656_0003322 3300046615 Bacteria 5434
411 Ga0495656_0016177 3300046615 Bacteria 2828
412 Ga0495659_0115285 3300046664 Bacteria 1053
413 Ga0495676_0103628 3300047321 Bacteria 2100
414 Ga0496102_0303708 3300048905 Bacteria 1504
415 Ga0496103_0160522 3300048906 Bacteria 1442
416 Ga0496106_0853952 3300048909 Bacteria 720
417 Ga0496107_0081958 3300048910 Bacteria 2353
418 Ga0496110_0083315 3300048913 Bacteria 2853
419 Ga0501031_0031301 3300049568 Bacteria 3471
420 Ga0501031_0525988 3300049568 Bacteria 762
421 Ga0501032_0019170 3300049569 Bacteria 4787
422 Ga0501032_0032068 3300049569 Bacteria 3601
423 Ga0501032_0456997 3300049569 Unclassified 818
424 Ga0501033_0001847 3300049570 Bacteria 18423
425 Ga0501033_0005965 3300049570 Bacteria 9563
426 Ga0501036_0051217 3300049572 Bacteria 3496
427 Ga0501036_0084800 3300049572 Bacteria 2678
428 Ga0501036_0116367 3300049572 Bacteria 2258
429 Ga0501037_0159058 3300049573 Bacteria 1611
430 Ga0501037_0296422 3300049573 Bacteria 1124
431 Ga0501037_0300859 3300049573 Bacteria 1114
432 Ga0501038_0003895 3300049574 Bacteria 13873
433 Ga0501038_0015310 3300049574 Bacteria 6973
434 Ga0501038_0016769 3300049574 Bacteria 6634
435 Ga0501038_0020030 3300049574 Bacteria 6022
436 Ga0501038_0062353 3300049574 Bacteria 3186
437 Ga0501038_0083007 3300049574 Bacteria 2698
438 Ga0501038_0112662 3300049574 Unclassified 2252
439 Ga0501038_0144216 3300049574 Unclassified 1945
440 Ga0501038_0186753 3300049574 Bacteria 1670
441 Ga0501039_0001408 3300049575 Bacteria 17698
442 Ga0501039_0006698 3300049575 Bacteria 8762
443 Ga0501039_0166849 3300049575 Bacteria 1731
444 Ga0501039_0243066 3300049575 Bacteria 1415
445 Ga0501039_0285744 3300049575 Bacteria 1297
446 Ga0501039_0305384 3300049575 Bacteria 1251
447 Ga0501039_0427890 3300049575 Bacteria 1040
448 Ga0501040_0000433 3300049576 Bacteria 24836
449 Ga0501040_0002350 3300049576 Bacteria 12148
450 Ga0501040_0011471 3300049576 Bacteria 5803
451 Ga0501040_0014869 3300049576 Bacteria 5138
452 Ga0501040_0201738 3300049576 Bacteria 1412
453 Ga0501040_0423128 3300049576 Bacteria 957
454 Ga0501041_0001494 3300049577 Bacteria 12958
455 Ga0501041_0001882 3300049577 Bacteria 11762
456 Ga0501041_0002356 3300049577 Bacteria 10696
457 Ga0501041_0008980 3300049577 Bacteria 5881
458 Ga0501041_0032518 3300049577 Bacteria 3153
459 Ga0501041_0201232 3300049577 Unclassified 1248
460 Ga0501042_0000865 3300049578 Bacteria 16902
461 Ga0501042_0001293 3300049578 Bacteria 14587
462 Ga0501042_0008836 3300049578 Bacteria 6679
463 Ga0501042_0017485 3300049578 Bacteria 4945
464 Ga0501042_0036501 3300049578 Bacteria 3487
465 Ga0501042_0069272 3300049578 Bacteria 2523
466 Ga0501042_0109980 3300049578 Bacteria 1984
467 Ga0501042_0276728 3300049578 Bacteria 1212
468 Ga0501042_0753701 3300049578 Unclassified 708
469 Ga0501043_0009538 3300049579 Bacteria 7609
470 Ga0501043_0070460 3300049579 Bacteria 2746
471 Ga0501043_0116487 3300049579 Bacteria 2097
472 Ga0501043_0136405 3300049579 Bacteria 1922
473 Ga0501043_0251870 3300049579 Bacteria 1360
474 Ga0501043_0322707 3300049579 Bacteria 1177
475 Ga0501043_0690503 3300049579 Bacteria 746
476 Ga0501046_0001091 3300049580 Bacteria 26577
477 Ga0501046_0006527 3300049580 Bacteria 10317
478 Ga0501046_0010686 3300049580 Bacteria 7872
479 Ga0501046_0160012 3300049580 Bacteria 1694
480 Ga0501046_0264134 3300049580 Bacteria 1264
481 Ga0501046_0269272 3300049580 Bacteria 1250
482 Ga0501046_0369862 3300049580 Bacteria 1039
483 Ga0501046_0612538 3300049580 Unclassified 772
484 Ga0501047_0369574 3300049581 Bacteria 1269
485 Ga0501047_0908657 3300049581 Unclassified 694
486 Ga0501048_0014256 3300049582 Bacteria 5887
487 Ga0501048_0046960 3300049582 Bacteria 3082
488 Ga0501048_0358908 3300049582 Bacteria 1039
489 Ga0501067_0125264 3300049583 Bacteria 1430
490 Ga0501068_0002856 3300049584 Bacteria 9191
491 Ga0501070_0056319 3300049586 Bacteria 3259
492 Ga0501070_0176748 3300049586 Unclassified 1757
493 Ga0501071_0003390 3300049587 Bacteria 9955
494 Ga0501071_0054048 3300049587 Bacteria 2898
495 Ga0501071_0064742 3300049587 Unclassified 2653
496 Ga0501071_0097237 3300049587 Bacteria 2167
497 Ga0501071_0155608 3300049587 Bacteria 1707
498 Ga0501071_0437519 3300049587 Bacteria 1000
499 Ga0501071_0797811 3300049587 Bacteria 728
500 Ga0501072_0001618 3300049588 Bacteria 16843
501 Ga0501072_0005320 3300049588 Bacteria 9798
502 Ga0501072_0017840 3300049588 Bacteria 5458
503 Ga0501072_0031322 3300049588 Bacteria 4162
504 Ga0501072_0054035 3300049588 Bacteria 3164
505 Ga0501072_0073074 3300049588 Bacteria 2711
506 Ga0501072_0215691 3300049588 Bacteria 1530
507 Ga0501072_0723970 3300049588 Bacteria 781
508 Ga0501072_0751211 3300049588 Bacteria 765
509 Ga0501073_0238194 3300049589 Bacteria 1257
510 Ga0501074_0005972 3300049590 Bacteria 8784
511 Ga0501074_0072973 3300049590 Bacteria 2465
512 Ga0501074_0178879 3300049590 Bacteria 1513
513 Ga0501075_0000784 3300049591 Bacteria 19847
514 Ga0501075_0001596 3300049591 Bacteria 14839
515 Ga0501075_0040976 3300049591 Bacteria 3470
516 Ga0501075_0047809 3300049591 Bacteria 3215
517 Ga0501075_0056118 3300049591 Bacteria 2965
518 Ga0501075_0134115 3300049591 Bacteria 1886
519 Ga0501075_0360411 3300049591 Bacteria 1108
520 Ga0501076_0000906 3300049592 Bacteria 19296
521 Ga0501076_0001146 3300049592 Bacteria 17555
522 Ga0501076_0001426 3300049592 Bacteria 16037
523 Ga0501076_0005526 3300049592 Bacteria 9106
524 Ga0501076_0005666 3300049592 Bacteria 9004
525 Ga0501076_0018701 3300049592 Bacteria 5288
526 Ga0501076_0109615 3300049592 Bacteria 2231
527 Ga0501076_0126152 3300049592 Bacteria 2074
528 Ga0501076_0274326 3300049592 Unclassified 1381
529 Ga0501076_0376087 3300049592 Unclassified 1167
530 Ga0501077_0000153 3300049593 Bacteria 38510
531 Ga0501077_0010748 3300049593 Bacteria 5700
532 Ga0501077_0019048 3300049593 Bacteria 4340
533 Ga0501077_0114399 3300049593 Unclassified 1711
534 Ga0501077_0117561 3300049593 Bacteria 1685
535 Ga0501077_0136715 3300049593 Bacteria 1554
536 Ga0501077_0237033 3300049593 Bacteria 1160
537 Ga0501079_0000372 3300049741 Bacteria 28860
538 Ga0501079_0002133 3300049741 Bacteria 14228
539 Ga0501079_0005043 3300049741 Bacteria 9802
540 Ga0501079_0005971 3300049741 Bacteria 9116
541 Ga0501079_0047905 3300049741 Bacteria 3298
542 Ga0501079_0056508 3300049741 Bacteria 3028
543 Ga0501079_0088752 3300049741 Bacteria 2394
544 Ga0501079_0271638 3300049741 Bacteria 1325
545 Ga0501080_0002056 3300049742 Bacteria 17431
546 Ga0501080_0042100 3300049742 Bacteria 4255
547 Ga0501080_0155146 3300049742 Bacteria 2115
548 Ga0501080_0182692 3300049742 Bacteria 1929
549 Ga0501080_0218017 3300049742 Bacteria 1747
550 Ga0501080_0350280 3300049742 Unclassified 1334
551 Ga0501080_0792219 3300049742 Bacteria 832
552 Ga0501081_0000579 3300049743 Bacteria 20804
553 Ga0501081_0003684 3300049743 Bacteria 9807
554 Ga0501081_0005990 3300049743 Bacteria 7871
555 Ga0501081_0010819 3300049743 Bacteria 5959
556 Ga0501081_0011191 3300049743 Bacteria 5867
557 Ga0501081_0037620 3300049743 Bacteria 3302
558 Ga0501081_0063163 3300049743 Bacteria 2570
559 Ga0501081_0181494 3300049743 Bacteria 1522
560 Ga0501081_0265028 3300049743 Bacteria 1256
561 Ga0501081_0269427 3300049743 Bacteria 1245
562 Ga0501081_0485256 3300049743 Bacteria 920
563 Ga0501081_0509960 3300049743 Unclassified 897
564 Ga0501083_0025415 3300049744 Bacteria 4099
565 Ga0501083_0028657 3300049744 Bacteria 3837
566 Ga0501083_0049412 3300049744 Bacteria 2835
567 Ga0501083_0059987 3300049744 Bacteria 2543
568 Ga0501083_0206899 3300049744 Bacteria 1280
569 Ga0501035_0014660 3300049822 Bacteria 7236
570 Ga0501035_0115116 3300049822 Bacteria 2354
571 Ga0501035_0123862 3300049822 Bacteria 2258
572 Ga0501035_0241907 3300049822 Bacteria 1535
573 Ga0501035_0915262 3300049822 Bacteria 694
574 Ga0501044_0252764 3300049823 Bacteria 1703
575 Ga0501045_0000465 3300049824 Bacteria 25165
576 Ga0501045_0002312 3300049824 Bacteria 12926
577 Ga0501045_0012456 3300049824 Bacteria 5989
578 Ga0501045_0017931 3300049824 Bacteria 5027
579 Ga0501045_0053326 3300049824 Bacteria 2955
580 Ga0501045_0067106 3300049824 Bacteria 2634
581 Ga0501045_0299300 3300049824 Unclassified 1197
582 Ga0501045_0359507 3300049824 Bacteria 1083
583 nmdc:mga05p37_1225116_c1 3300050507 Archaea 773
584 nmdc:mga05p37_1355229_c1 3300050507 Bacteria 720
585 nmdc:mga05p37_216213_c1 3300050507 Bacteria 2315
586 nmdc:mga05p37_29441_c1 3300050507 Bacteria 6701
587 nmdc:mga05p37_479853_c1 3300050507 Unclassified 1432
588 nmdc:mga05p37_52256_c1 3300050507 Bacteria 5025
589 nmdc:mga05p37_52775_c1 3300050507 Bacteria 4999
590 nmdc:mga05p37_599395_c1 3300050507 Bacteria 1244
591 nmdc:mga09592_349824_c1 3300050508 Bacteria 1279
592 nmdc:mga09592_74605_c1 3300050508 Bacteria 2882
593 nmdc:mga09592_8720_c1 3300050508 Bacteria 8250
594 nmdc:mga0qj67_1013684_c1 3300050509 Bacteria 651
595 nmdc:mga0qj67_662919_c1 3300050509 Bacteria 832
596 nmdc:mga06r32_104956_c1 3300050510 Bacteria 2775
597 nmdc:mga06r32_17225_c1 3300050510 Bacteria 6595
598 nmdc:mga06r32_21791_c1 3300050510 Bacteria 5916
599 nmdc:mga06r32_663473_c1 3300050510 Bacteria 1010
600 nmdc:mga06r32_713910_c1 3300050510 Bacteria 967
601 nmdc:mga06r32_728587_c1 3300050510 Bacteria 956
602 nmdc:mga08y16_1027759_c1 3300050511 Bacteria 803
603 nmdc:mga08y16_40245_c1 3300050511 Bacteria 4900
604 nmdc:mga08y16_42961_c1 3300050511 Bacteria 4735
605 nmdc:mga08y16_633667_c1 3300050511 Bacteria 1075
606 nmdc:mga0n895_126399_c1 3300050512 Unclassified 2581
607 nmdc:mga0n895_246230_c1 3300050512 Bacteria 1814
608 nmdc:mga0n895_31997_c1 3300050512 Bacteria 5044
609 nmdc:mga0n895_35105_c1 3300050512 Bacteria 4833
610 nmdc:mga0n895_76859_c1 3300050512 Bacteria 3320
611 nmdc:mga0n895_915800_c1 3300050512 Bacteria 861
612 nmdc:mga0rr50_14257_c1 3300050513 Bacteria 5207
613 nmdc:mga0rr50_14403_c1 3300050513 Bacteria 5186
614 nmdc:mga0rr50_16449_c1 3300050513 Bacteria 4915
615 nmdc:mga08x19_139624_c1 3300050514 Bacteria 1636
616 nmdc:mga08x19_20956_c1 3300050514 Bacteria 4031
617 nmdc:mga08x19_459389_c1 3300050514 Bacteria 897
618 nmdc:mga08x19_9587_c1 3300050514 Bacteria 5797
619 nmdc:mga0a205_13678_c1 3300050515 Bacteria 7562
620 nmdc:mga0a205_151301_c1 3300050515 Unclassified 2220
621 nmdc:mga0a205_19055_c1 3300050515 Bacteria 6465
622 nmdc:mga0a205_3718_c1 3300050515 Bacteria 13661
623 nmdc:mga0a205_46294_c1 3300050515 Bacteria 4195
624 nmdc:mga0a205_63196_c1 3300050515 Bacteria 3577
625 nmdc:mga0a205_6750_c1 3300050515 Bacteria 10378
626 Ga0501084_0000634 3300054114 Bacteria 26815
627 Ga0501084_0002259 3300054114 Bacteria 15478
628 Ga0501084_0015687 3300054114 Bacteria 6284
629 Ga0501084_0028580 3300054114 Bacteria 4661
630 Ga0501084_0037357 3300054114 Bacteria 4057
631 Ga0501084_0105238 3300054114 Bacteria 2370
632 Ga0501084_0273353 3300054114 Bacteria 1427
633 Ga0501084_0358031 3300054114 Bacteria 1233
634 Ga0501084_0465168 3300054114 Unclassified 1069
635 Ga0590071_027388 3300059421 Bacteria 1353
636 Ga0590071_068951 3300059421 Bacteria 870
637 Ga0590075_014917 3300059424 Bacteria 1903
638 Ga0590075_082857 3300059424 Bacteria 831
639 Ga0590075_136937 3300059424 Bacteria 643
640 Ga0590077_012414 3300059426 Bacteria 1766
641 Ga0590077_093346 3300059426 Bacteria 700
642 Ga0501082_0001161 3300060353 Bacteria 23200
643 Ga0501082_0012045 3300060353 Bacteria 7431
644 Ga0501082_0012732 3300060353 Bacteria 7229
645 Ga0501082_0019215 3300060353 Bacteria 5889
646 Ga0501082_0024996 3300060353 Bacteria 5145
647 Ga0501082_0043672 3300060353 Bacteria 3865
648 Ga0501082_0189319 3300060353 Bacteria 1790
649 Ga0501082_0410590 3300060353 Bacteria 1182
650 Ga0530510_0000082 3300061734 Bacteria 50078
651 Ga0530510_0000158 3300061734 Bacteria 40587
652 Ga0530510_0002559 3300061734 Bacteria 12501
653 Ga0530510_0006560 3300061734 Bacteria 8109
654 Ga0530510_0027428 3300061734 Bacteria 4080
655 Ga0530510_0033941 3300061734 Bacteria 3674
656 Ga0530510_0048265 3300061734 Bacteria 3077
657 Ga0530510_0162002 3300061734 Bacteria 1655
658 Ga0530510_0201373 3300061734 Bacteria 1479
659 Ga0530510_0321543 3300061734 Unclassified 1160
660 Ga0530510_0369024 3300061734 Bacteria 1079
661 Ga0114129_10795615
662 JGI26129J50193_1001831
663 Ga0065707_10341289
664 Ga0070676_10091100
665 Ga0070683_100065859
666 Ga0070690_100058994
667 Ga0070690_100066158
668 Ga0070670_100002721
669 Ga0068869_100000012
670 Ga0068869_101105873
671 Ga0068869_101396652
672 Ga0070666_10223656
673 Ga0070680_100000130
674 Ga0070680_100027390
675 Ga0070682_100333142
676 Ga0068868_100304713
677 Ga0070660_100000314
678 Ga0070689_100000894
679 Ga0070689_100020438
680 Ga0070691_10000538
681 Ga0070687_100192089
682 Ga0070661_100006123
683 Ga0070692_10017625
684 Ga0070668_100102517
685 Ga0070668_100620383
686 Ga0070669_100009496
687 Ga0070669_100046604
688 Ga0070669_100199284
689 Ga0070675_100583543
690 Ga0070671_100071685
691 Ga0070673_100026688
692 Ga0070659_100000210
693 Ga0070703_10004543
694 Ga0070703_10086036
695 Ga0070714_100154493
696 Ga0070701_10064406
697 Ga0070701_10084508
698 Ga0070711_100582391
699 Ga0070705_100000800
700 Ga0070705_100033160
701 Ga0070705_100365031
702 Ga0070700_100499004
703 Ga0070694_100003078
704 Ga0070694_100010122
705 Ga0070694_100176949
706 Ga0070708_100008471
707 Ga0070708_100022122
708 Ga0070708_100072841
709 Ga0070708_100076269
710 Ga0070708_100091271
711 Ga0070708_100136904
712 Ga0070708_100204068
713 Ga0070708_100345727
714 Ga0070663_100014348
715 Ga0070663_101058465
716 Ga0070662_100012491
717 Ga0070662_100235387
718 Ga0070662_100658403
719 Ga0070681_10002040
720 Ga0068867_100003134
721 Ga0068867_100696821
722 Ga0070706_100053145
723 Ga0070706_100310720
724 Ga0070706_100364462
725 Ga0070706_100601797
726 Ga0070706_101266712
727 Ga0070707_100011666
728 Ga0070707_100018265
729 Ga0070707_100048092
730 Ga0070707_100050579
731 Ga0070707_100071960
732 Ga0070707_100139837
733 Ga0070707_100155236
734 Ga0070707_101132456
735 Ga0070698_100051042
736 Ga0070698_100091624
737 Ga0070698_100174313
738 Ga0070698_100521429
739 Ga0070699_100006433
740 Ga0070699_100120147
741 Ga0070699_100122389
742 Ga0070699_100129899
743 Ga0070699_100161901
744 Ga0070699_100204510
745 Ga0070699_100527780
746 Ga0070679_100002034
747 Ga0070679_100681104
748 Ga0070684_100659996
749 Ga0070697_100067384
750 Ga0070697_100117705
751 Ga0070697_100128296
752 Ga0070697_100139712
753 Ga0070697_100162191
754 Ga0070697_100268296
755 Ga0070697_100410788
756 Ga0068853_100000911
757 Ga0070672_100132267
758 Ga0070695_100001699
759 Ga0070695_100005431
760 Ga0070695_100047150
761 Ga0070695_100070833
762 Ga0070695_100320075
763 Ga0070696_100000252
764 Ga0070696_100082138
765 Ga0070696_100192512
766 Ga0070696_100206182
767 Ga0070693_100001409
768 Ga0070693_100016688
769 Ga0070704_100000437
770 Ga0070704_100299250
771 Ga0070704_100309322
772 Ga0070704_100647300
773 Ga0070704_101007051
774 Ga0068855_100000567
775 Ga0070664_100011658
776 Ga0068854_100001260
777 Ga0068854_100206298
778 Ga0068856_100004512
779 Ga0068856_100308663
780 Ga0070702_100030216
781 Ga0068852_101182212
782 Ga0068859_100001346
783 Ga0068859_100068896
784 Ga0068859_100121236
785 Ga0068859_100398252
786 Ga0068859_100507585
787 Ga0068859_100688338
788 Ga0068859_101814814
789 Ga0068864_100143245
790 Ga0068864_100269382
791 Ga0068866_10842514
792 Ga0068861_100008465
793 Ga0068861_100680786
794 Ga0068870_10000824
795 Ga0068863_100099476
796 Ga0068860_100042665
797 Ga0068860_100069254
798 Ga0068860_100448979
799 Ga0068862_100014908
800 Ga0068862_100016041
801 Ga0068862_100176782
802 Ga0068862_100234922
803 Ga0081455_10000459
804 Ga0081455_10025531
805 Ga0081538_10029976
806 Ga0081540_1004849
807 Ga0070715_10156198
808 Ga0070716_100017969
809 Ga0075428_100064988
810 Ga0075428_100161635
811 Ga0075428_100284659
812 Ga0075428_100822872
813 Ga0075428_101148060
814 Ga0075430_100008644
815 Ga0075431_100002021
816 Ga0075431_100005691
817 Ga0075431_100104460
818 Ga0075431_100253442
819 Ga0075431_100614711
820 Ga0075433_10003752
821 Ga0075433_10007770
822 Ga0075433_10033360
823 Ga0075433_10045240
824 Ga0075433_10065490
825 Ga0075433_10156381
826 Ga0075433_10347613
827 Ga0075434_100008173
828 Ga0075434_100009400
829 Ga0075434_100012625
830 Ga0075434_100177738
831 Ga0075429_100014510
832 Ga0075429_100213639
833 Ga0075429_100670272
834 Ga0075429_100760505
835 Ga0075429_101279178
836 Ga0068865_100661681
837 Ga0075436_100007060
838 Ga0075436_100407468
839 Ga0097620_100001346
840 Ga0097620_100068899
841 Ga0097620_100121247
842 Ga0097620_100398238
843 Ga0097620_100507531
844 Ga0097620_100688368
845 Ga0097620_101814833
846 Ga0075435_100001558
847 Ga0075435_100001827
848 Ga0075435_100007439
849 Ga0075435_100216695
850 Ga0075435_100339199
851 Ga0075435_100519007
852 Ga0099794_10015617
853 Ga0111539_10002045
854 Ga0111539_10005755
855 Ga0111539_10063842
856 Ga0111539_10100086
857 Ga0111539_10944831
858 Ga0105245_10145759
859 Ga0114129_10128903
860 Ga0114129_10140588
861 Ga0114129_10175235
862 Ga0114129_10388966
863 Ga0114129_10439930
864 Ga0114129_10926210
865 Ga0105243_10633289
866 Ga0105243_10753334
867 Ga0105241_10000778
868 Ga0105241_10015238
869 Ga0105241_10680395
870 Ga0105242_10140648
871 Ga0105248_10027558
872 Ga0105248_10507253
873 Ga0105248_10826500
874 Ga0105249_10062667
875 Ga0105249_10284542
876 Ga0105249_10367326
877 Ga0105249_11153040
878 Ga0105239_11528347
879 Ga0105239_11990053
880 Ga0105246_10118575
881 Ga0157373_10000316
882 Ga0157373_10245439
883 Ga0157371_10093328
884 Ga0157371_10302012
885 Ga0157378_10642299
886 Ga0157378_12062219
887 Ga0163162_10017314
888 Ga0157372_10001422
889 Ga0157372_10560487
890 Ga0157375_10061509
891 Ga0163163_10045550
892 Ga0157380_10233446
893 Ga0157380_10322074
894 Ga0182008_10040500
895 Ga0157377_10049286
896 Ga0157379_10647596
897 Ga0182007_10155532
898 Ga0206356_10521279
899 Ga0206355_1292207
900 Ga0224712_10362410
901 Ga0207653_10001470
902 Ga0207642_10219783
903 Ga0207688_10042519
904 Ga0207680_10226365
905 Ga0207685_10014233
906 Ga0207645_10000671
907 Ga0207645_10045188
908 Ga0207643_10001764
909 Ga0207643_10078001
910 Ga0207684_10014106
911 Ga0207684_10058644
912 Ga0207684_10068729
913 Ga0207684_10104474
914 Ga0207684_10142584
915 Ga0207654_10166378
916 Ga0207707_10000034
917 Ga0207693_10045437
918 Ga0207660_10000759
919 Ga0207662_10004424
920 Ga0207662_10508620
921 Ga0207657_10000365
922 Ga0207649_10022489
923 Ga0207652_10000430
924 Ga0207646_10018570
925 Ga0207646_10052047
926 Ga0207646_10054636
927 Ga0207646_10087480
928 Ga0207646_10091465
929 Ga0207646_10191469
930 Ga0207646_10326891
931 Ga0207681_10016242
932 Ga0207681_10121274
933 Ga0207681_10175048
934 Ga0207650_10002316
935 Ga0207687_10086481
936 Ga0207644_10473300
937 Ga0207690_10000781
938 Ga0207706_10001814
939 Ga0207706_10010767
940 Ga0207706_10044701
941 Ga0207706_10149284
942 Ga0207709_10211405
943 Ga0207709_10340206
944 Ga0207670_10015140
945 Ga0207670_10389693
946 Ga0207704_10538129
947 Ga0207665_10022111
948 Ga0207691_10030677
949 Ga0207691_10081511
950 Ga0207689_10000345
951 Ga0207689_10918740
952 Ga0207679_10000607
953 Ga0207667_10000308
954 Ga0207651_10003335
955 Ga0207651_10264146
956 Ga0207712_10016847
957 Ga0207712_10126833
958 Ga0207712_11067967
959 Ga0207640_10001175
960 Ga0207640_10195419
961 Ga0207658_10517153
962 Ga0207677_10042304
963 Ga0207703_10710574
964 Ga0207639_10072209
965 Ga0207678_10021490
966 Ga0207708_10968741
967 Ga0207702_10010131
968 Ga0207641_10094566
969 Ga0207641_10672996
970 Ga0207648_10003844
971 Ga0207648_10180476
972 Ga0207676_10009413
973 Ga0207674_10000991
974 Ga0207675_100021189
975 Ga0207675_100252016
976 Ga0207675_101028328
977 Ga0209969_1003631
978 Ga0209967_1007194
979 Ga0209981_1009132
980 Ga0210000_1011570
981 Ga0209968_1006559
982 Ga0209982_1003270
983 Ga0210002_1005291
984 Ga0209983_1092780
985 Ga0209588_1004128
986 Ga0209588_1016488
987 Ga0209971_1000203
988 Ga0209966_1000352
989 Ga0209966_1031053
990 Ga0209998_10000178
991 Ga0209974_10012941
992 Ga0209974_10205955
993 Ga0207428_10000336
994 Ga0207428_10029695
995 Ga0207428_10326977
996 Ga0268265_10016759
997 Ga0268265_10017365
998 Ga0268265_10045737
999 Ga0268265_10178760
1000 Ga0268265_10212468
1001 Ga0268264_10109661
1002 Ga0268264_11089258
1003 Ga0307408_100049079
1004 Ga0316575_10023827
1005 Ga0316575_10033285
1006 Ga0316579_10006943
1007 Ga0316576_10192766
1008 Ga0316578_10110053
1009 Ga0307405_10155873
1010 Ga0316577_10333038
1011 Ga0307410_10273316
1012 Ga0307416_100749714
1013 Ga0307411_10340957
1014 Ga0307411_10447219
1015 Ga0316583_10016391
1016 Ga0373948_0122977
1017 Ga0373950_0006630
1018 Ga0373959_0018425
1019 Ga0373926_0282334
1020 Ga0373929_0063987
1021 Ga0373940_0008356
1022 Ga0373944_0098269
1023 Ga0373949_0025434
1024 Ga0373951_0056206
1025 Ga0373936_0092741
1026 Ga0316574_0010503
1027 Ga0373931_0110284
1028 Ga0373947_0033457
1029 Ga0316582_0057262
1030 Ga0316584_0653137
1031 Ga0373925_0292503
1032 Ga0436365_1019957
1033 Ga0436365_1155282
1034 Ga0436361_0287471
1035 Ga0436361_0646384
1036 Ga0436361_0964499
1037 Ga0436362_1127113
1038 Ga0439461_0001987
1039 Ga0439431_0083874
1040 Ga0439441_007428
1041 Ga0439441_054271
1042 Ga0439448_0001352
1043 Ga0439463_024582
1044 Ga0439434_0004174
1045 Ga0439435_0000022
1046 Ga0439444_0045442
1047 Ga0439459_0000745
1048 Ga0439464_0012390
1049 Ga0439460_0001556
1050 Ga0451577_0098067
1051 Ga0451577_0221962
1052 Ga0453683_0064275
1053 Ga0453683_0366095
1054 Ga0466964_0176473
1055 Ga0453684_0014598
1056 Ga0453684_0854246
1057 Ga0453684_0865481
1058 Ga0451576_0110733
1059 Ga0451576_0172786
1060 Ga0451576_0236108
1061 Ga0451576_0346019
1062 Ga0451576_1175579
1063 Ga0466958_0363700
1064 Ga0466967_0231316
1065 Ga0495603_0278296
1066 Ga0495580_0221231
1067 Ga0495594_0110226
1068 Ga0495594_0254558
1069 Ga0495598_0015446
1070 Ga0495656_0003322
1071 Ga0495656_0016177
1072 Ga0495659_0115285
1073 Ga0495676_0103628
1074 Ga0496102_0303708
1075 Ga0496103_0160522
1076 Ga0496106_0853952
1077 Ga0496107_0081958
1078 Ga0496110_0083315
1079 Ga0501031_0031301
1080 Ga0501031_0525988
1081 Ga0501032_0019170
1082 Ga0501032_0032068
1083 Ga0501032_0456997
1084 Ga0501033_0001847
1085 Ga0501033_0005965
1086 Ga0501036_0051217
1087 Ga0501036_0084800
1088 Ga0501036_0116367
1089 Ga0501037_0159058
1090 Ga0501037_0296422
1091 Ga0501037_0300859
1092 Ga0501038_0003895
1093 Ga0501038_0015310
1094 Ga0501038_0016769
1095 Ga0501038_0020030
1096 Ga0501038_0062353
1097 Ga0501038_0083007
1098 Ga0501038_0112662
1099 Ga0501038_0144216
1100 Ga0501038_0186753
1101 Ga0501039_0001408
1102 Ga0501039_0006698
1103 Ga0501039_0166849
1104 Ga0501039_0243066
1105 Ga0501039_0285744
1106 Ga0501039_0305384
1107 Ga0501039_0427890
1108 Ga0501040_0000433
1109 Ga0501040_0002350
1110 Ga0501040_0011471
1111 Ga0501040_0014869
1112 Ga0501040_0201738
1113 Ga0501040_0423128
1114 Ga0501041_0001494
1115 Ga0501041_0001882
1116 Ga0501041_0002356
1117 Ga0501041_0008980
1118 Ga0501041_0032518
1119 Ga0501041_0201232
1120 Ga0501042_0000865
1121 Ga0501042_0001293
1122 Ga0501042_0008836
1123 Ga0501042_0017485
1124 Ga0501042_0036501
1125 Ga0501042_0069272
1126 Ga0501042_0109980
1127 Ga0501042_0276728
1128 Ga0501042_0753701
1129 Ga0501043_0009538
1130 Ga0501043_0070460
1131 Ga0501043_0116487
1132 Ga0501043_0136405
1133 Ga0501043_0251870
1134 Ga0501043_0322707
1135 Ga0501043_0690503
1136 Ga0501046_0001091
1137 Ga0501046_0006527
1138 Ga0501046_0010686
1139 Ga0501046_0160012
1140 Ga0501046_0264134
1141 Ga0501046_0269272
1142 Ga0501046_0369862
1143 Ga0501046_0612538
1144 Ga0501047_0369574
1145 Ga0501047_0908657
1146 Ga0501048_0014256
1147 Ga0501048_0046960
1148 Ga0501048_0358908
1149 Ga0501067_0125264
1150 Ga0501068_0002856
1151 Ga0501070_0056319
1152 Ga0501070_0176748
1153 Ga0501071_0003390
1154 Ga0501071_0054048
1155 Ga0501071_0064742
1156 Ga0501071_0097237
1157 Ga0501071_0155608
1158 Ga0501071_0437519
1159 Ga0501071_0797811
1160 Ga0501072_0001618
1161 Ga0501072_0005320
1162 Ga0501072_0017840
1163 Ga0501072_0031322
1164 Ga0501072_0054035
1165 Ga0501072_0073074
1166 Ga0501072_0215691
1167 Ga0501072_0723970
1168 Ga0501072_0751211
1169 Ga0501073_0238194
1170 Ga0501074_0005972
1171 Ga0501074_0072973
1172 Ga0501074_0178879
1173 Ga0501075_0000784
1174 Ga0501075_0001596
1175 Ga0501075_0040976
1176 Ga0501075_0047809
1177 Ga0501075_0056118
1178 Ga0501075_0134115
1179 Ga0501075_0360411
1180 Ga0501076_0000906
1181 Ga0501076_0001146
1182 Ga0501076_0001426
1183 Ga0501076_0005526
1184 Ga0501076_0005666
1185 Ga0501076_0018701
1186 Ga0501076_0109615
1187 Ga0501076_0126152
1188 Ga0501076_0274326
1189 Ga0501076_0376087
1190 Ga0501077_0000153
1191 Ga0501077_0010748
1192 Ga0501077_0019048
1193 Ga0501077_0114399
1194 Ga0501077_0117561
1195 Ga0501077_0136715
1196 Ga0501077_0237033
1197 Ga0501079_0000372
1198 Ga0501079_0002133
1199 Ga0501079_0005043
1200 Ga0501079_0005971
1201 Ga0501079_0047905
1202 Ga0501079_0056508
1203 Ga0501079_0088752
1204 Ga0501079_0271638
1205 Ga0501080_0002056
1206 Ga0501080_0042100
1207 Ga0501080_0155146
1208 Ga0501080_0182692
1209 Ga0501080_0218017
1210 Ga0501080_0350280
1211 Ga0501080_0792219
1212 Ga0501081_0000579
1213 Ga0501081_0003684
1214 Ga0501081_0005990
1215 Ga0501081_0010819
1216 Ga0501081_0011191
1217 Ga0501081_0037620
1218 Ga0501081_0063163
1219 Ga0501081_0181494
1220 Ga0501081_0265028
1221 Ga0501081_0269427
1222 Ga0501081_0485256
1223 Ga0501081_0509960
1224 Ga0501083_0025415
1225 Ga0501083_0028657
1226 Ga0501083_0049412
1227 Ga0501083_0059987
1228 Ga0501083_0206899
1229 Ga0501035_0014660
1230 Ga0501035_0115116
1231 Ga0501035_0123862
1232 Ga0501035_0241907
1233 Ga0501035_0915262
1234 Ga0501044_0252764
1235 Ga0501045_0000465
1236 Ga0501045_0002312
1237 Ga0501045_0012456
1238 Ga0501045_0017931
1239 Ga0501045_0053326
1240 Ga0501045_0067106
1241 Ga0501045_0299300
1242 Ga0501045_0359507
1243 nmdc:mga05p37_1225116_c1
1244 nmdc:mga05p37_1355229_c1
1245 nmdc:mga05p37_216213_c1
1246 nmdc:mga05p37_29441_c1
1247 nmdc:mga05p37_479853_c1
1248 nmdc:mga05p37_52256_c1
1249 nmdc:mga05p37_52775_c1
1250 nmdc:mga05p37_599395_c1
1251 nmdc:mga09592_349824_c1
1252 nmdc:mga09592_74605_c1
1253 nmdc:mga09592_8720_c1
1254 nmdc:mga0qj67_1013684_c1
1255 nmdc:mga0qj67_662919_c1
1256 nmdc:mga06r32_104956_c1
1257 nmdc:mga06r32_17225_c1
1258 nmdc:mga06r32_21791_c1
1259 nmdc:mga06r32_663473_c1
1260 nmdc:mga06r32_713910_c1
1261 nmdc:mga06r32_728587_c1
1262 nmdc:mga08y16_1027759_c1
1263 nmdc:mga08y16_40245_c1
1264 nmdc:mga08y16_42961_c1
1265 nmdc:mga08y16_633667_c1
1266 nmdc:mga0n895_126399_c1
1267 nmdc:mga0n895_246230_c1
1268 nmdc:mga0n895_31997_c1
1269 nmdc:mga0n895_35105_c1
1270 nmdc:mga0n895_76859_c1
1271 nmdc:mga0n895_915800_c1
1272 nmdc:mga0rr50_14257_c1
1273 nmdc:mga0rr50_14403_c1
1274 nmdc:mga0rr50_16449_c1
1275 nmdc:mga08x19_139624_c1
1276 nmdc:mga08x19_20956_c1
1277 nmdc:mga08x19_459389_c1
1278 nmdc:mga08x19_9587_c1
1279 nmdc:mga0a205_13678_c1
1280 nmdc:mga0a205_151301_c1
1281 nmdc:mga0a205_19055_c1
1282 nmdc:mga0a205_3718_c1
1283 nmdc:mga0a205_46294_c1
1284 nmdc:mga0a205_63196_c1
1285 nmdc:mga0a205_6750_c1
1286 Ga0501084_0000634
1287 Ga0501084_0002259
1288 Ga0501084_0015687
1289 Ga0501084_0028580
1290 Ga0501084_0037357
1291 Ga0501084_0105238
1292 Ga0501084_0273353
1293 Ga0501084_0358031
1294 Ga0501084_0465168
1295 Ga0590071_027388
1296 Ga0590071_068951
1297 Ga0590075_014917
1298 Ga0590075_082857
1299 Ga0590075_136937
1300 Ga0590077_012414
1301 Ga0590077_093346
1302 Ga0501082_0001161
1303 Ga0501082_0012045
1304 Ga0501082_0012732
1305 Ga0501082_0019215
1306 Ga0501082_0024996
1307 Ga0501082_0043672
1308 Ga0501082_0189319
1309 Ga0501082_0410590
1310 Ga0530510_0000082
1311 Ga0530510_0000158
1312 Ga0530510_0002559
1313 Ga0530510_0006560
1314 Ga0530510_0027428
1315 Ga0530510_0033941
1316 Ga0530510_0048265
1317 Ga0530510_0162002
1318 Ga0530510_0201373
1319 Ga0530510_0321543
1320 Ga0530510_0369024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

1

178

0.94

PF13743

Thioredoxin_5

Thioredoxin

34

172

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.8425 70 180
5cp1-assembly1.cif.gz_A-2 crystal structure of c239s mutant of a novel disulfide oxidoreductase from deinococcus radiodurans 0.8207 2 181
7unn-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda from corynebacterium diphtheriae 0.8111 72 178
7uno-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda, c129s mutant, from corynebacterium diphtheriae 0.8109 72 178
3gl5-assembly1.cif.gz_A-2 crystal structure of probable dsba oxidoreductase sco1869 from streptomyces coelicolor 0.8094 2 180
ID Description Score Start End Superfamily
5cp1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8207 2 181 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8205 2 178 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8111 43 176 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8086 2 177 3.40.30.10
5cp1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.801 2 181 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V6UPN7-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9413 48 180 GO:0016491
AF-A0A352GQH1-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9406 60 176 GO:0016491
AF-A0A7Z9LH74-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.94 29 178 GO:0016491
AF-A0A3N5WNZ9-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9394 73 179 GO:0016491
AF-A0A7C3S3G5-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9374 51 177 GO:0016491

Map