F473278

General Info

Members Datasets Scaffolds Average Seq Length
659 384 619 307

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000615|Ga0495583_0000615_5004_6038
Length 344
Sequence MIIEICMKNSIDYRQSWCIIQTTNFANHVKNIHGVFMGTSILELRHLRTLLALKEAGTISRAAQLLNVTQSALSHQVLALERQYDASLFERKSTPVAFTAAGKRLLELATQVLPLVGSAERDLARMASAGSGKLRIAVECHTCFDWLMPSMDALRERWPEVEQDIVSGFQADPVGLLHQDRAEVAIVSELDETETDMVFHPLFEFEMVAILPLGHPCLAKPWLEAQDFAGQALITYPVPDEMLDLVRQVLRPAGVEPPRRTTELTVGMLQLVASGRGFAALPLWAVNGYLERGYVARQRIGPDGLTARLYAVVPKRLAGSAYLADFVQVMRETSLLALPGIRLL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221556 Massilia sp. Root1485 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221652 Acidovorax sp. Root402 Isolate Unclassified
16 2643221658 Variovorax sp. Root411 Isolate Unclassified
17 2643221672 Variovorax sp. Root434 Isolate Unclassified
18 2643221684 Massilia sp. Root133 Isolate Unclassified
19 2643221717 Acidovorax sp. Root267 Isolate Unclassified
20 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
21 2738541337 Pelomonas sp. BT06 Isolate Unclassified
22 2818991436 Collimonas arenae 515 Isolate Unclassified
23 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
24 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
25 2842733646 Variovorax sp. R-72446 Isolate Unclassified
26 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
27 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
28 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
29 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
30 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
31 2885198086 Variovorax sp. 679 Isolate Unclassified
32 2885211737 Variovorax sp. 553 Isolate Unclassified
33 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
34 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
35 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
38 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
39 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
40 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
41 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
42 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
43 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
44 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
47 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
48 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
49 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
56 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
57 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
58 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
76 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
230 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
231 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
234 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
235 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
236 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
237 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
238 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
239 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
340 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
341 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
342 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
382 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.93
Metatranscriptomes 0
Isolates 6.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.31
Nodule 0.46
Rhizoplane 3.19
Rhizosphere 61.15
Stem 0
Stem Tuber 0.15
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000041 3300001977 Bacteria 12363
2 JGI24743J22301_10000136 3300001991 Bacteria 7419
3 JGI24744J21845_10003694 3300002077 Bacteria 3154
4 JGI24033J26618_1000771 3300002155 Bacteria 3058
5 JGI25155J39150_1000143 3300002704 Bacteria 33448
6 JGI25155J39150_1000590 3300002704 Bacteria 7904
7 JGI25156J39149_1000343 3300002705 Bacteria 30250
8 JGI25162J39368_1000001 3300002737 Bacteria 740113
9 JGI25162J39368_1005476 3300002737 Bacteria 2472
10 JGI25154J39366_1000131 3300002738 Bacteria 58847
11 JGI25158J39367_1012712 3300002739 Bacteria 1107
12 JGI25157J39369_1000119 3300002741 Bacteria 67906
13 JGI25151J46595_10000490 3300003187 Bacteria 37505
14 JGI25165J46597_1000001 3300003214 Bacteria 1111887
15 rootH2_10007491 3300003320 Bacteria 28148
16 rootH2_10025857 3300003320 Bacteria 6326
17 rootH2_10037630 3300003320 Bacteria 8201
18 rootL2_10043086 3300003322 Bacteria 1542
19 rootL2_10047190 3300003322 Bacteria 7548
20 rootL2_10080904 3300003322 Bacteria 8358
21 rootL2_10106273 3300003322 Bacteria 6522
22 rootL2_10122240 3300003322 Bacteria 1454
23 rootH1_10034690 3300003323 Bacteria 21506
24 rootH1_10039626 3300003323 Bacteria 3145
25 Ga0055538_1000001 3300003751 Bacteria 1111887
26 Ga0055539_1000001 3300003752 Bacteria 1111887
27 Ga0055533_1000003 3300003756 Bacteria 1111887
28 Ga0055532_1000023 3300003758 Bacteria 248212
29 Ga0055525_1000003 3300003759 Bacteria 962094
30 Ga0055525_1000008 3300003759 Bacteria 604287
31 Ga0055525_1000054 3300003759 Bacteria 216523
32 Ga0055526_1003413 3300003771 Bacteria 10097
33 Ga0055537_1009160 3300003773 Bacteria 2212
34 Ga0055524_1000679 3300003775 Bacteria 23825
35 Ga0055524_1006891 3300003775 Bacteria 4896
36 Ga0055536_1001609 3300003781 Bacteria 13474
37 Ga0055536_1006289 3300003781 Bacteria 5587
38 Ga0055534_1005923 3300003784 Bacteria 3177
39 Ga0055528_1019775 3300003790 Bacteria 2212
40 Ga0055530_10004499 3300003791 Bacteria 7145
41 Ga0055530_10009542 3300003791 Bacteria 3712
42 Ga0055530_10032454 3300003791 Bacteria 1357
43 Ga0055540_1001457 3300003792 Bacteria 14106
44 Ga0055531_10001899 3300003794 Bacteria 14631
45 Ga0055531_10001936 3300003794 Bacteria 14467
46 Ga0055531_10002628 3300003794 Bacteria 11892
47 Ga0055531_10020910 3300003794 Bacteria 2564
48 Ga0055541_1000001 3300003841 Bacteria 1111887
49 Ga0065165_1002636 3300005262 Bacteria 14580
50 Ga0065165_1019645 3300005262 Bacteria 2403
51 Ga0065714_10066376 3300005288 Bacteria 6980
52 Ga0065704_10090996 3300005289 Bacteria 2748
53 Ga0065704_10094429 3300005289 Bacteria 2544
54 Ga0070658_10004378 3300005327 Bacteria 11522
55 Ga0070658_10169039 3300005327 Bacteria 1836
56 Ga0070658_10262022 3300005327 Bacteria 1468
57 Ga0070676_10111574 3300005328 Bacteria 1703
58 Ga0070682_100025307 3300005337 Bacteria 3540
59 Ga0068868_100351617 3300005338 Bacteria 1262
60 Ga0070660_100079160 3300005339 Bacteria 2578
61 Ga0070660_100131323 3300005339 Bacteria 2004
62 Ga0070660_100134192 3300005339 Bacteria 1983
63 Ga0070660_100190023 3300005339 Bacteria 1663
64 Ga0070660_100237986 3300005339 Bacteria 1482
65 Ga0070661_100000229 3300005344 Bacteria 46608
66 Ga0070661_100000373 3300005344 Bacteria 35211
67 Ga0070661_100031869 3300005344 Bacteria 3813
68 Ga0070661_100134585 3300005344 Bacteria 1858
69 Ga0070669_100034642 3300005353 Bacteria 3656
70 Ga0070675_100190216 3300005354 Bacteria 1778
71 Ga0070659_100009239 3300005366 Bacteria 7237
72 Ga0070659_100066688 3300005366 Bacteria 2852
73 Ga0070659_100068755 3300005366 Bacteria 2810
74 Ga0070659_100080779 3300005366 Bacteria 2596
75 Ga0070678_100019710 3300005456 Bacteria 4406
76 Ga0070678_100029629 3300005456 Bacteria 3750
77 Ga0070662_100002684 3300005457 Bacteria 10977
78 Ga0070662_100079348 3300005457 Bacteria 2441
79 Ga0068867_100000064 3300005459 Bacteria 64233
80 Ga0070706_100001200 3300005467 Bacteria 27738
81 Ga0070707_100104898 3300005468 Bacteria 2740
82 Ga0070698_100169300 3300005471 Bacteria 2126
83 Ga0070699_100592095 3300005518 Bacteria 1011
84 Ga0068853_100000007 3300005539 Bacteria 283307
85 Ga0068853_100005209 3300005539 Bacteria 10168
86 Ga0068853_100506555 3300005539 Bacteria 1140
87 Ga0070672_100077579 3300005543 Bacteria 2657
88 Ga0070672_100151134 3300005543 Bacteria 1921
89 Ga0068855_100645865 3300005563 Bacteria 1137
90 Ga0070664_100001816 3300005564 Bacteria 17110
91 Ga0070664_100012848 3300005564 Bacteria 6812
92 Ga0070664_100030868 3300005564 Bacteria 4473
93 Ga0070664_100098306 3300005564 Bacteria 2542
94 Ga0068857_100258442 3300005577 Bacteria 1598
95 Ga0068854_100144357 3300005578 Bacteria 1829
96 Ga0068856_100017064 3300005614 Bacteria 7038
97 Ga0068852_100060439 3300005616 Bacteria 3289
98 Ga0068852_100097177 3300005616 Bacteria 2649
99 Ga0068859_100393324 3300005617 Bacteria 1482
100 Ga0068864_100073320 3300005618 Bacteria 2985
101 Ga0068863_100456188 3300005841 Bacteria 1255
102 Ga0081455_10084088 3300005937 Bacteria 2598
103 Ga0081540_1002865 3300005983 Bacteria 13951
104 Ga0075365_10056844 3300006038 Bacteria 2602
105 Ga0075363_100011468 3300006048 Bacteria 4245
106 Ga0075363_100013972 3300006048 Bacteria 3909
107 Ga0075364_10038210 3300006051 Bacteria 3110
108 Ga0075362_10011997 3300006177 Bacteria 3427
109 Ga0075362_10016984 3300006177 Bacteria 2991
110 Ga0075362_10053506 3300006177 Bacteria 1812
111 Ga0075367_10086726 3300006178 Bacteria 1900
112 Ga0075369_10136294 3300006186 Bacteria 1118
113 Ga0075366_10002070 3300006195 Bacteria 10179
114 Ga0075366_10018190 3300006195 Bacteria 4056
115 Ga0075366_10050009 3300006195 Bacteria 2481
116 Ga0075370_10002404 3300006353 Bacteria 8667
117 Ga0075370_10003046 3300006353 Bacteria 7899
118 Ga0075370_10006846 3300006353 Bacteria 5765
119 Ga0075370_10006950 3300006353 Bacteria 5736
120 Ga0075370_10035598 3300006353 Bacteria 2794
121 Ga0075370_10037374 3300006353 Bacteria 2730
122 Ga0075370_10178506 3300006353 Bacteria 1249
123 Ga0068871_100140675 3300006358 Bacteria 2052
124 Ga0068871_100228440 3300006358 Bacteria 1615
125 Ga0068865_100258204 3300006881 Bacteria 1378
126 Ga0097620_100393291 3300006931 Bacteria 1482
127 Ga0099823_1004429 3300006944 Bacteria 13727
128 Ga0105244_10000775 3300009036 Bacteria 27296
129 Ga0105244_10032662 3300009036 Bacteria 2752
130 Ga0105240_10000309 3300009093 Bacteria 93964
131 Ga0105240_10001031 3300009093 Bacteria 49544
132 Ga0105240_10004684 3300009093 Bacteria 20684
133 Ga0105240_10037144 3300009093 Bacteria 6260
134 Ga0105240_10669087 3300009093 Bacteria 1136
135 Ga0105245_10157103 3300009098 Bacteria 2155
136 Ga0105243_10000088 3300009148 Bacteria 103915
137 Ga0105243_10008623 3300009148 Bacteria 7820
138 Ga0105243_10012543 3300009148 Bacteria 6409
139 Ga0105243_10096423 3300009148 Bacteria 2446
140 Ga0105241_10023068 3300009174 Bacteria 4613
141 Ga0105248_10001682 3300009177 Bacteria 24633
142 Ga0105237_10019363 3300009545 Bacteria 7029
143 Ga0105237_10263516 3300009545 Bacteria 1726
144 Ga0105237_10436498 3300009545 Bacteria 1315
145 Ga0105238_10025233 3300009551 Bacteria 6058
146 Ga0105239_10031152 3300010375 Bacteria 5868
147 Ga0105239_10033461 3300010375 Bacteria 5645
148 Ga0105239_10268419 3300010375 Bacteria 1919
149 Ga0105246_10190782 3300011119 Bacteria 1586
150 Ga0105246_10280588 3300011119 Bacteria 1336
151 Ga0157319_1000001 3300012497 Bacteria 423237
152 Ga0157373_10000471 3300013100 Bacteria 31950
153 Ga0157370_10000554 3300013104 Bacteria 46615
154 Ga0163162_10148710 3300013306 Bacteria 2459
155 Ga0157372_10470984 3300013307 Bacteria 1464
156 Ga0157372_10740060 3300013307 Bacteria 1143
157 Ga0182008_10026910 3300014497 Bacteria 2915
158 Ga0157377_10010282 3300014745 Bacteria 4623
159 Ga0157376_10036778 3300014969 Bacteria 3969
160 Ga0182006_1001948 3300015261 Bacteria 11716
161 Ga0182006_1012756 3300015261 Bacteria 3670
162 Ga0182007_10001204 3300015262 Bacteria 14045
163 Ga0163161_10019138 3300017792 Bacteria 4801
164 Ga0213872_10000073 3300021361 Bacteria 91302
165 Ga0213872_10024424 3300021361 Bacteria 2781
166 Ga0213875_10001280 3300021388 Bacteria 16845
167 Ga0209435_100013 3300025206 Bacteria 366789
168 Ga0209784_100004 3300025224 Bacteria 1378156
169 Ga0209566_100004 3300025225 Bacteria 1531866
170 Ga0209674_100006 3300025226 Bacteria 1531866
171 Ga0209147_100030 3300025229 Bacteria 366789
172 Ga0209563_100003 3300025230 Bacteria 1932942
173 Ga0209563_100009 3300025230 Bacteria 1378156
174 Ga0209563_100075 3300025230 Bacteria 216575
175 Ga0207427_100467 3300025231 Bacteria 22139
176 Ga0209437_100004 3300025233 Bacteria 1378156
177 Ga0209437_100208 3300025233 Bacteria 111481
178 Ga0209258_100205 3300025242 Bacteria 119727
179 Ga0209646_1000034 3300025246 Bacteria 366789
180 Ga0209026_1000022 3300025250 Bacteria 366789
181 Ga0209677_100005 3300025253 Bacteria 1378156
182 Ga0209148_1000380 3300025254 Bacteria 53968
183 Ga0209759_1000018 3300025256 Bacteria 366789
184 Ga0209233_1000005 3300025261 Bacteria 1531866
185 Ga0209233_1015722 3300025261 Bacteria 2101
186 Ga0209455_1002639 3300025272 Bacteria 6782
187 Ga0209676_1000356 3300025292 Bacteria 86657
188 Ga0209676_1010471 3300025292 Bacteria 3858
189 Ga0209050_1000575 3300025298 Bacteria 59696
190 Ga0209050_1001396 3300025298 Bacteria 26194
191 Ga0209050_1001921 3300025298 Bacteria 19833
192 Ga0209050_1006654 3300025298 Bacteria 6765
193 Ga0209256_1001621 3300025299 Bacteria 21934
194 Ga0209256_1002194 3300025299 Bacteria 16732
195 Ga0209051_1000073 3300025303 Bacteria 208874
196 Ga0209051_1001499 3300025303 Bacteria 19509
197 Ga0209051_1005113 3300025303 Bacteria 7790
198 Ga0209051_1010952 3300025303 Bacteria 4526
199 Ga0209051_1025225 3300025303 Bacteria 2425
200 Ga0209257_1000049 3300025304 Bacteria 441224
201 Ga0209257_1000139 3300025304 Bacteria 202285
202 Ga0209257_1001530 3300025304 Bacteria 26954
203 Ga0209257_1008843 3300025304 Bacteria 5567
204 Ga0209257_1011931 3300025304 Bacteria 4098
205 Ga0209257_1020879 3300025304 Bacteria 2401
206 Ga0207655_1002169 3300025728 Bacteria 16356
207 Ga0207688_10017520 3300025901 Bacteria 3893
208 Ga0207705_10007288 3300025909 Bacteria 8135
209 Ga0207705_10010554 3300025909 Bacteria 6713
210 Ga0207684_10002095 3300025910 Bacteria 20445
211 Ga0207654_10005557 3300025911 Bacteria 6376
212 Ga0207695_10000635 3300025913 Bacteria 70312
213 Ga0207695_10030134 3300025913 Bacteria 5977
214 Ga0207695_10090582 3300025913 Bacteria 3073
215 Ga0207695_10176615 3300025913 Bacteria 2058
216 Ga0207671_10037347 3300025914 Bacteria 3602
217 Ga0207671_10157593 3300025914 Bacteria 1757
218 Ga0207671_10259133 3300025914 Bacteria 1368
219 Ga0207657_10000613 3300025919 Bacteria 37815
220 Ga0207657_10014271 3300025919 Bacteria 7766
221 Ga0207657_10065974 3300025919 Bacteria 3083
222 Ga0207657_10221687 3300025919 Bacteria 1515
223 Ga0207649_10000300 3300025920 Bacteria 38102
224 Ga0207649_10006373 3300025920 Bacteria 6411
225 Ga0207649_10007212 3300025920 Bacteria 6043
226 Ga0207649_10126759 3300025920 Bacteria 1729
227 Ga0207649_10224782 3300025920 Bacteria 1339
228 Ga0207646_10215564 3300025922 Bacteria 1734
229 Ga0207694_10039059 3300025924 Bacteria 3651
230 Ga0207650_10160931 3300025925 Bacteria 1778
231 Ga0207659_10142501 3300025926 Bacteria 1862
232 Ga0207687_10098597 3300025927 Bacteria 2145
233 Ga0207690_10015190 3300025932 Bacteria 4662
234 Ga0207690_10025624 3300025932 Bacteria 3705
235 Ga0207690_10146906 3300025932 Bacteria 1744
236 Ga0207690_10293343 3300025932 Bacteria 1270
237 Ga0207706_10002023 3300025933 Bacteria 19864
238 Ga0207709_10000270 3300025935 Bacteria 61008
239 Ga0207709_10001645 3300025935 Bacteria 15124
240 Ga0207709_10022786 3300025935 Bacteria 3556
241 Ga0207709_10062996 3300025935 Bacteria 2323
242 Ga0207704_10024535 3300025938 Bacteria 3273
243 Ga0207711_10478085 3300025941 Bacteria 1161
244 Ga0207679_10000339 3300025945 Bacteria 34501
245 Ga0207679_10010509 3300025945 Bacteria 5963
246 Ga0207679_10015235 3300025945 Bacteria 5073
247 Ga0207679_10086829 3300025945 Bacteria 2407
248 Ga0207667_10055481 3300025949 Bacteria 4165
249 Ga0207667_10226354 3300025949 Bacteria 1916
250 Ga0207667_10298165 3300025949 Bacteria 1647
251 Ga0207651_10444037 3300025960 Bacteria 1112
252 Ga0207668_10149974 3300025972 Bacteria 1804
253 Ga0207640_10118610 3300025981 Bacteria 1891
254 Ga0207677_10376672 3300026023 Bacteria 1197
255 Ga0207639_10000001 3300026041 Bacteria 1431562
256 Ga0207702_10012461 3300026078 Bacteria 7077
257 Ga0207702_10275279 3300026078 Bacteria 1589
258 Ga0207648_10000192 3300026089 Bacteria 64301
259 Ga0207648_10149923 3300026089 Bacteria 2057
260 Ga0207674_10118585 3300026116 Bacteria 2616
261 Ga0207674_10147538 3300026116 Bacteria 2310
262 Ga0207674_10217362 3300026116 Bacteria 1859
263 Ga0207683_10069070 3300026121 Bacteria 3120
264 Ga0207683_10150787 3300026121 Bacteria 2098
265 Ga0207683_10207547 3300026121 Bacteria 1782
266 Ga0207698_10018339 3300026142 Bacteria 4766
267 Ga0207698_10544940 3300026142 Bacteria 1136
268 Ga0209813_10031496 3300027866 Bacteria 1566
269 Ga0209813_10035726 3300027866 Bacteria 1489
270 Ga0265334_10054267 3300028573 Bacteria 1528
271 Ga0307517_10002278 3300028786 Bacteria 30957
272 Ga0307517_10061642 3300028786 Bacteria 3544
273 Ga0307515_10000028 3300028794 Bacteria 368467
274 Ga0307515_10037661 3300028794 Bacteria 7767
275 Ga0307515_10124280 3300028794 Bacteria 2896
276 Ga0307515_10125132 3300028794 Bacteria 2879
277 Ga0307515_10173138 3300028794 Bacteria 2141
278 Ga0307515_10332260 3300028794 Bacteria 1178
279 Ga0265330_10000099 3300031235 Bacteria 72344
280 Ga0265332_10000002 3300031238 Bacteria 709510
281 Ga0265328_10009017 3300031239 Bacteria 4083
282 Ga0265325_10005521 3300031241 Bacteria 7804
283 Ga0265340_10005843 3300031247 Bacteria 6811
284 Ga0265327_10000155 3300031251 Bacteria 147516
285 Ga0265327_10000369 3300031251 Bacteria 85139
286 Ga0307513_10053889 3300031456 Bacteria 4318
287 Ga0307408_100000021 3300031548 Bacteria 312158
288 Ga0307408_100000056 3300031548 Bacteria 140709
289 Ga0307408_100001048 3300031548 Bacteria 21241
290 Ga0307408_100008195 3300031548 Bacteria 6904
291 Ga0307408_100046108 3300031548 Bacteria 3117
292 Ga0307408_100069264 3300031548 Bacteria 2601
293 Ga0307408_100140403 3300031548 Bacteria 1896
294 Ga0307408_100150089 3300031548 Bacteria 1839
295 Ga0307508_10007776 3300031616 Bacteria 9958
296 Ga0307514_10084422 3300031649 Bacteria 2337
297 Ga0265314_10000089 3300031711 Bacteria 138050
298 Ga0307516_10000286 3300031730 Bacteria 65447
299 Ga0307516_10000851 3300031730 Bacteria 41827
300 Ga0307516_10241601 3300031730 Bacteria 1504
301 Ga0307413_10251955 3300031824 Unclassified 1310
302 Ga0307406_10033621 3300031901 Bacteria 3140
303 Ga0307407_10000058 3300031903 Bacteria 48922
304 Ga0307407_10002259 3300031903 Bacteria 7455
305 Ga0307412_10000013 3300031911 Bacteria 365239
306 Ga0307409_100275315 3300031995 Bacteria 1552
307 Ga0307409_100337708 3300031995 Bacteria 1416
308 Ga0307416_100002351 3300032002 Bacteria 10819
309 Ga0307416_100040620 3300032002 Bacteria 3616
310 Ga0307414_10000081 3300032004 Bacteria 87893
311 Ga0307411_10008542 3300032005 Bacteria 5316
312 Ga0307510_10002323 3300033180 Bacteria 21490
313 Ga0307510_10060607 3300033180 Bacteria 3892
314 Ga0373940_0008392 3300035088 Bacteria 2368
315 Ga0373939_0000094 3300035114 Bacteria 27768
316 Ga0373960_0006723 3300035121 Bacteria 2706
317 Ga0373931_0004722 3300035691 Bacteria 6243
318 Ga0395899_0002640 3300037312 Bacteria 14453
319 Ga0395899_0005487 3300037312 Bacteria 9833
320 Ga0395899_0007329 3300037312 Bacteria 8533
321 Ga0395899_0010638 3300037312 Bacteria 7051
322 Ga0395899_0152592 3300037312 Bacteria 1636
323 Ga0395899_0255643 3300037312 Bacteria 1200
324 Ga0395900_0000065 3300037418 Bacteria 196327
325 Ga0395900_0003050 3300037418 Bacteria 18237
326 Ga0395900_0004717 3300037418 Bacteria 14376
327 Ga0395900_0045447 3300037418 Bacteria 4523
328 Ga0395900_0523244 3300037418 Bacteria 1133
329 Ga0395898_0002040 3300037466 Bacteria 25291
330 Ga0395898_0002898 3300037466 Bacteria 19522
331 Ga0395898_0022967 3300037466 Bacteria 6307
332 Ga0395898_0143195 3300037466 Bacteria 2288
333 Ga0395898_0176082 3300037466 Bacteria 2044
334 Ga0395898_0206911 3300037466 Bacteria 1872
335 Ga0395905_0004714 3300037471 Bacteria 14086
336 Ga0395905_0023568 3300037471 Bacteria 5815
337 Ga0395905_0117023 3300037471 Bacteria 2505
338 Ga0395905_0607575 3300037471 Bacteria 995
339 Ga0436364_0828542 3300037853 Bacteria 18870
340 Ga0395901_0000114 3300038443 Bacteria 109241
341 Ga0395901_0001025 3300038443 Bacteria 30229
342 Ga0395901_0046123 3300038443 Bacteria 4525
343 Ga0395901_0260673 3300038443 Bacteria 1804
344 Ga0395901_0263742 3300038443 Bacteria 1792
345 Ga0395901_0387057 3300038443 Bacteria 1438
346 Ga0395901_0625861 3300038443 Bacteria 1082
347 Ga0436361_0033979 3300039447 Bacteria 2770
348 Ga0436361_0736070 3300039447 Bacteria 84726
349 Ga0439465_0035828 3300041413 Bacteria 1592
350 Ga0439448_0021161 3300042005 Bacteria 2016
351 Ga0439450_021970 3300042008 Bacteria 1374
352 Ga0439455_0047424 3300042012 Bacteria 1115
353 Ga0450917_002508 3300042120 Bacteria 1312
354 Ga0450919_003709 3300042121 Bacteria 1898
355 Ga0450888_000898 3300042126 Bacteria 2835
356 Ga0450890_000019 3300042127 Bacteria 45594
357 Ga0450890_001811 3300042127 Bacteria 3028
358 Ga0450891_000115 3300042129 Bacteria 7156
359 Ga0450892_000078 3300042130 Bacteria 10695
360 Ga0450904_000523 3300042139 Bacteria 7348
361 Ga0450889_000177 3300042144 Bacteria 6853
362 Ga0450889_006008 3300042144 Bacteria 1215
363 Ga0450916_002487 3300042530 Bacteria 1961
364 Ga0450918_000283 3300042531 Bacteria 11490
365 Ga0450893_0007158 3300042532 Bacteria 1811
366 Ga0466969_0031618 3300044656 Bacteria 2693
367 Ga0466972_0000111 3300044658 Bacteria 70764
368 Ga0466972_0022353 3300044658 Bacteria 3150
369 Ga0466965_0000099 3300044683 Bacteria 25415
370 Ga0466965_0003561 3300044683 Bacteria 6844
371 Ga0466965_0021808 3300044683 Bacteria 3086
372 Ga0466965_0061910 3300044683 Bacteria 1871
373 Ga0466966_0029352 3300044684 Bacteria 3579
374 Ga0466966_0042881 3300044684 Bacteria 2901
375 Ga0466966_0085868 3300044684 Bacteria 1956
376 Ga0466966_0132965 3300044684 Bacteria 1522
377 Ga0466966_0242868 3300044684 Bacteria 1085
378 Ga0466961_0113827 3300044693 Bacteria 1701
379 Ga0466963_0362719 3300044694 Bacteria 1021
380 Ga0466964_0002257 3300044706 Bacteria 6828
381 Ga0466964_0021297 3300044706 Bacteria 2506
382 Ga0466964_0022851 3300044706 Bacteria 2429
383 Ga0466964_0105194 3300044706 Bacteria 1250
384 Ga0466971_0000034 3300044719 Bacteria 56431
385 Ga0466968_0005833 3300044735 Bacteria 4622
386 Ga0466968_0025800 3300044735 Bacteria 2408
387 Ga0466957_0000005 3300044842 Bacteria 102026
388 Ga0466957_0001421 3300044842 Bacteria 12501
389 Ga0466957_0018582 3300044842 Bacteria 4083
390 Ga0466960_0022813 3300044901 Bacteria 2802
391 Ga0466959_0010269 3300045049 Bacteria 6685
392 Ga0466959_0032593 3300045049 Bacteria 3857
393 Ga0466959_0038048 3300045049 Bacteria 3555
394 Ga0466959_0042038 3300045049 Bacteria 3372
395 Ga0466959_0292090 3300045049 Bacteria 1117
396 Ga0451576_0085449 3300045051 Bacteria 3282
397 Ga0466958_0256454 3300045836 Bacteria 1119
398 Ga0466967_0017561 3300045976 Bacteria 5686
399 Ga0466967_0512093 3300045976 Bacteria 1178
400 Ga0495592_0024776 3300046454 Bacteria 4560
401 Ga0495590_0102322 3300046457 Bacteria 1018
402 Ga0495638_0028052 3300046460 Bacteria 3638
403 Ga0495638_0101917 3300046460 Bacteria 1716
404 Ga0495638_0121984 3300046460 Bacteria 1539
405 Ga0495651_0002661 3300046462 Bacteria 13859
406 Ga0495653_0018797 3300046463 Bacteria 5607
407 Ga0495605_0001024 3300046474 Bacteria 18810
408 Ga0495605_0041691 3300046474 Bacteria 2285
409 Ga0495584_0002172 3300046491 Bacteria 11186
410 Ga0495584_0024023 3300046491 Bacteria 3090
411 Ga0495607_0000277 3300046501 Bacteria 55227
412 Ga0495607_0001095 3300046501 Bacteria 24709
413 Ga0495607_0013475 3300046501 Bacteria 5356
414 Ga0495583_0000615 3300046506 Bacteria 48092
415 Ga0495606_0011604 3300046507 Bacteria 7164
416 Ga0495606_0021455 3300046507 Bacteria 4730
417 Ga0495608_0020340 3300046511 Bacteria 4561
418 Ga0495610_0020577 3300046512 Bacteria 3661
419 Ga0495616_0000042 3300046513 Bacteria 120923
420 Ga0495616_0001007 3300046513 Bacteria 20154
421 Ga0495616_0001176 3300046513 Bacteria 18470
422 Ga0495616_0027695 3300046513 Bacteria 3005
423 Ga0495616_0035184 3300046513 Bacteria 2594
424 Ga0495618_0006093 3300046514 Bacteria 7314
425 Ga0495618_0281972 3300046514 Bacteria 1036
426 Ga0495620_0065747 3300046515 Bacteria 1496
427 Ga0495628_0000835 3300046516 Bacteria 28571
428 Ga0495628_0153713 3300046516 Bacteria 1752
429 Ga0495630_0324009 3300046517 Bacteria 1178
430 Ga0495631_0000455 3300046518 Bacteria 27845
431 Ga0495631_0052125 3300046518 Bacteria 1787
432 Ga0495632_0015495 3300046519 Bacteria 4270
433 Ga0495637_0006307 3300046520 Bacteria 5967
434 Ga0495643_0000653 3300046522 Bacteria 41007
435 Ga0495643_0001662 3300046522 Bacteria 19523
436 Ga0495648_0002371 3300046524 Bacteria 17495
437 Ga0495663_0011864 3300046525 Bacteria 2428
438 Ga0495642_0000489 3300046528 Bacteria 20282
439 Ga0495642_0021790 3300046528 Bacteria 2522
440 Ga0495652_0034009 3300046529 Bacteria 4445
441 Ga0495654_0010940 3300046530 Bacteria 4930
442 Ga0495654_0014623 3300046530 Bacteria 4174
443 Ga0495598_0078168 3300046537 Bacteria 1056
444 Ga0495609_0000001 3300046538 Bacteria 1060094
445 Ga0495621_0010300 3300046539 Bacteria 2854
446 Ga0495621_0022926 3300046539 Bacteria 2074
447 Ga0495597_0053466 3300046542 Bacteria 1776
448 Ga0495645_0027501 3300046543 Bacteria 4133
449 Ga0495656_0110589 3300046615 Bacteria 1284
450 Ga0495668_0240592 3300046616 Bacteria 991
451 Ga0495625_0008989 3300046660 Bacteria 8436
452 Ga0495661_0000063 3300046665 Bacteria 129706
453 Ga0495661_0003232 3300046665 Bacteria 12150
454 Ga0495661_0022025 3300046665 Bacteria 4146
455 Ga0495661_0109954 3300046665 Bacteria 1537
456 Ga0495588_0000052 3300046674 Bacteria 304493
457 Ga0495588_0094264 3300046674 Bacteria 1569
458 Ga0495657_0045934 3300046675 Bacteria 2961
459 Ga0495599_0002461 3300046678 Bacteria 10790
460 Ga0495623_0011084 3300046679 Bacteria 5834
461 Ga0495624_0078484 3300046690 Bacteria 2047
462 Ga0495670_0084768 3300046691 Bacteria 1617
463 Ga0495649_0000935 3300046694 Bacteria 23072
464 Ga0495589_0000015 3300046794 Bacteria 224112
465 Ga0495589_0000116 3300046794 Bacteria 75640
466 Ga0495600_0012302 3300046809 Bacteria 5347
467 Ga0495660_0000145 3300046810 Bacteria 76912
468 Ga0495660_0028390 3300046810 Bacteria 3161
469 Ga0495660_0041635 3300046810 Bacteria 2541
470 Ga0495672_0008763 3300047320 Bacteria 7414
471 Ga0495683_0019759 3300047323 Bacteria 3475
472 Ga0495683_0028718 3300047323 Bacteria 2843
473 Ga0495687_000003 3300047443 Bacteria 859509
474 Ga0495687_000073 3300047443 Bacteria 155429
475 Ga0495687_000153 3300047443 Bacteria 105215
476 Ga0495687_000891 3300047443 Bacteria 31449
477 Ga0495687_008007 3300047443 Bacteria 6118
478 Ga0495677_0000001 3300047445 Bacteria 715000
479 Ga0495677_0000215 3300047445 Bacteria 26322
480 Ga0495686_0000190 3300047472 Bacteria 115114
481 Ga0495686_0057965 3300047472 Bacteria 2416
482 Ga0495593_0022644 3300047673 Bacteria 3498
483 Ga0495602_0082414 3300048088 Bacteria 2699
484 Ga0495602_0240335 3300048088 Bacteria 1355
485 Ga0495626_0000128 3300048091 Bacteria 96772
486 Ga0495626_0000171 3300048091 Bacteria 80200
487 Ga0495626_0004823 3300048091 Bacteria 8131
488 Ga0495626_0046048 3300048091 Bacteria 2033
489 Ga0495626_0101201 3300048091 Bacteria 1256
490 Ga0496100_0159660 3300048903 Bacteria 1615
491 Ga0496100_0230432 3300048903 Bacteria 1363
492 Ga0496101_0027041 3300048904 Bacteria 3991
493 Ga0496102_0013533 3300048905 Bacteria 7069
494 Ga0496102_0179741 3300048905 Bacteria 1993
495 Ga0496102_0279371 3300048905 Bacteria 1574
496 Ga0496102_0489560 3300048905 Bacteria 1151
497 Ga0496103_0046056 3300048906 Bacteria 2692
498 Ga0496103_0202074 3300048906 Bacteria 1278
499 Ga0496104_0212165 3300048907 Bacteria 1848
500 Ga0496105_0190750 3300048908 Bacteria 1676
501 Ga0496105_0357860 3300048908 Bacteria 1165
502 Ga0496106_0037494 3300048909 Bacteria 3626
503 Ga0496107_0180295 3300048910 Bacteria 1568
504 Ga0496107_0379934 3300048910 Bacteria 1051
505 Ga0496109_0266393 3300048912 Bacteria 1614
506 Ga0496112_0206997 3300048915 Bacteria 1919
507 Ga0496113_0011778 3300048916 Bacteria 5856
508 Ga0496113_0193613 3300048916 Bacteria 1614
509 Ga0496114_0085489 3300048917 Bacteria 2672
510 Ga0496115_0217780 3300048918 Bacteria 1576
511 Ga0496116_0006493 3300048919 Bacteria 10598
512 Ga0496118_0010168 3300048921 Bacteria 9347
513 Ga0496118_0032872 3300048921 Bacteria 4264
514 Ga0496118_0137124 3300048921 Bacteria 1559
515 Ga0496121_0034335 3300048924 Bacteria 4567
516 Ga0496121_0046374 3300048924 Bacteria 3721
517 Ga0496121_0051934 3300048924 Bacteria 3448
518 Ga0496121_0306419 3300048924 Bacteria 1075
519 Ga0496122_0001249 3300048925 Bacteria 42658
520 Ga0496122_0008199 3300048925 Bacteria 11351
521 Ga0496122_0032516 3300048925 Bacteria 4312
522 Ga0496122_0123119 3300048925 Bacteria 1667
523 Ga0496123_0002055 3300048926 Bacteria 25979
524 Ga0496123_0014620 3300048926 Bacteria 6489
525 Ga0496124_0004031 3300048927 Bacteria 17468
526 Ga0496124_0032358 3300048927 Bacteria 4618
527 Ga0496124_0062916 3300048927 Bacteria 3103
528 Ga0496124_0089369 3300048927 Bacteria 2515
529 Ga0496124_0113566 3300048927 Bacteria 2176
530 Ga0496125_0000794 3300048928 Bacteria 51484
531 Ga0496125_0007526 3300048928 Bacteria 11575
532 Ga0496125_0101879 3300048928 Bacteria 2111
533 Ga0496126_0079290 3300048929 Bacteria 2907
534 Ga0501031_0000399 3300049568 Bacteria 25380
535 Ga0501032_0113565 3300049569 Bacteria 1792
536 Ga0501033_0000049 3300049570 Bacteria 114610
537 Ga0501037_0035999 3300049573 Bacteria 3649
538 Ga0501038_0000020 3300049574 Bacteria 152738
539 Ga0501038_0000965 3300049574 Bacteria 25774
540 Ga0501039_0002616 3300049575 Bacteria 13436
541 Ga0501043_0003333 3300049579 Bacteria 13230
542 Ga0501043_0006588 3300049579 Bacteria 9307
543 Ga0501047_0008774 3300049581 Bacteria 9540
544 Ga0501067_0008141 3300049583 Bacteria 5824
545 Ga0501070_0001605 3300049586 Bacteria 20058
546 Ga0501198_000012 3300049649 Bacteria 113529
547 Ga0501198_003622 3300049649 Bacteria 2118
548 Ga0501222_000010 3300049662 Bacteria 113536
549 Ga0501227_000022 3300049665 Bacteria 23482
550 Ga0501259_008398 3300049688 Bacteria 1662
551 Ga0501080_0030133 3300049742 Bacteria 5055
552 Ga0501083_0008427 3300049744 Bacteria 7286
553 Ga0501035_0000001 3300049822 Bacteria 1037138
554 Ga0501035_0001329 3300049822 Bacteria 25521
555 Ga0501044_0241917 3300049823 Bacteria 1748
556 Ga0501044_0258980 3300049823 Bacteria 1678
557 Ga0501044_0369845 3300049823 Bacteria 1350
558 nmdc:mga03683_12920_c1 3300050489 Bacteria 3061
559 nmdc:mga03683_29706_c1 3300050489 Bacteria 2181
560 nmdc:mga03n38_33173_c1 3300050490 Bacteria 2194
561 nmdc:mga03n38_9886_c1 3300050490 Bacteria 3487
562 nmdc:mga00v17_139792_c1 3300050491 Bacteria 1552
563 nmdc:mga0yw44_163821_c1 3300050492 Bacteria 1457
564 nmdc:mga0k408_10625_c1 3300050493 Bacteria 4984
565 nmdc:mga0k408_11990_c1 3300050493 Bacteria 4730
566 nmdc:mga0k408_153878_c1 3300050493 Bacteria 1370
567 nmdc:mga06z11_25937_c1 3300050494 Bacteria 2784
568 nmdc:mga04h51_1034_c1 3300050495 Bacteria 6406
569 nmdc:mga07m45_1806_c2 3300050496 Bacteria 8273
570 nmdc:mga07m45_19621_c1 3300050496 Bacteria 3665
571 nmdc:mga07m45_29115_c1 3300050496 Bacteria 3052
572 nmdc:mga07m45_38424_c1 3300050496 Bacteria 2671
573 nmdc:mga07m45_3842_c1 3300050496 Bacteria 7278
574 nmdc:mga07m45_60316_c1 3300050496 Bacteria 2147
575 nmdc:mga07m45_613_c1 3300050496 Bacteria 15202
576 nmdc:mga07m45_83645_c1 3300050496 Bacteria 1824
577 nmdc:mga07m45_94998_c1 3300050496 Bacteria 1710
578 nmdc:mga0sz30_54670_c1 3300050516 Bacteria 1698
579 nmdc:mga0sz30_77545_c1 3300050516 Bacteria 1435
580 Ga0495601_0022375 3300053077 Bacteria 3879
581 Ga0500610_0054751 3300053079 Bacteria 2080
582 Ga0500578_0000002 3300053086 Bacteria 293507
583 Ga0500643_004274 3300053087 Bacteria 6532
584 Ga0500651_0000052 3300053093 Bacteria 76301
585 Ga0500651_0037223 3300053093 Bacteria 3065
586 Ga0500650_0067886 3300053098 Bacteria 1666
587 Ga0500571_000036 3300053110 Bacteria 42725
588 Ga0500594_0001512 3300053118 Bacteria 5052
589 Ga0500594_0002464 3300053118 Bacteria 4026
590 Ga0500595_000547 3300053119 Bacteria 22560
591 Ga0500618_001812 3300053125 Bacteria 8960
592 Ga0500618_002516 3300053125 Bacteria 6840
593 Ga0500626_016230 3300053128 Bacteria 3256
594 Ga0500652_013230 3300053131 Bacteria 2917
595 Ga0500655_000491 3300053133 Bacteria 7989
596 Ga0500655_003558 3300053133 Bacteria 2810
597 Ga0500658_0000033 3300053134 Bacteria 89738
598 Ga0500658_0000040 3300053134 Bacteria 79293
599 Ga0500658_0046925 3300053134 Bacteria 1751
600 Ga0500559_0000122 3300053136 Bacteria 60264
601 Ga0500559_0001672 3300053136 Bacteria 12246
602 Ga0500559_0016472 3300053136 Bacteria 3121
603 Ga0500561_0005762 3300053137 Bacteria 2325
604 Ga0500568_0003399 3300053139 Bacteria 8894
605 Ga0500568_0006960 3300053139 Bacteria 5606
606 Ga0500568_0019381 3300053139 Bacteria 2958
607 Ga0500574_000340 3300053141 Bacteria 5781
608 Ga0500604_0020974 3300053151 Bacteria 1843
609 Ga0500616_0009982 3300053153 Bacteria 5710
610 Ga0500622_0000651 3300053156 Bacteria 30947
611 Ga0500627_0115682 3300053158 Bacteria 1208
612 Ga0500627_0115771 3300053158 Unclassified 1208
613 Ga0500634_0002930 3300053161 Bacteria 7422
614 Ga0500634_0053150 3300053161 Bacteria 2174
615 Ga0500638_010860 3300053162 Bacteria 4011
616 Ga0500645_015567 3300053730 Bacteria 2408
617 Ga0500656_004046 3300053732 Bacteria 1401
618 Ga0500587_001706 3300053739 Bacteria 3125
619 Ga0466962_0000059 3300061719 Bacteria 44944

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_77545_c1 nmdc:mga0sz30_77545_c1_685_1425 246
2 3300048091 Ga0495626_0101201 Ga0495626_0101201_419_1237 255
3 3300026121 Ga0207683_10150787 Ga0207683_101507872 256
4 3300053730 Ga0500645_015567 Ga0500645_015567_80_886 268
5 3300006353 Ga0075370_10037374 Ga0075370_100373742 273
6 3300050496 nmdc:mga07m45_60316_c1 nmdc:mga07m45_60316_c1_112_1038 273
7 3300046516 Ga0495628_0153713 Ga0495628_0153713_897_1733 275
8 3300003794 Ga0055531_10002628 Ga0055531_100026286 277
9 3300025298 Ga0209050_1006654 Ga0209050_10066545 277
10 3300025304 Ga0209257_1000049 Ga0209257_100004931 277
11 3300031548 Ga0307408_100046108 Ga0307408_1000461082 277
12 3300031995 Ga0307409_100337708 Ga0307409_1003377082 277
13 3300025932 Ga0207690_10146906 Ga0207690_101469061 278
14 3300006195 Ga0075366_10002070 Ga0075366_100020702 279
15 3300050493 nmdc:mga0k408_11990_c1 nmdc:mga0k408_11990_c1_1308_2249 279
16 iso_pu_bacteria 2547132103 2547372252 280
17 3300038443 Ga0395901_0260673 Ga0395901_0260673_21_893 283
18 3300045836 Ga0466958_0256454 Ga0466958_0256454_17_889 283
19 3300005337 Ga0070682_100025307 Ga0070682_1000253072 284
20 3300025304 Ga0209257_1020879 Ga0209257_10208794 284
21 3300025925 Ga0207650_10160931 Ga0207650_101609311 284
22 3300005456 Ga0070678_100029629 Ga0070678_1000296292 286
23 3300005543 Ga0070672_100151134 Ga0070672_1001511341 286
24 3300025960 Ga0207651_10444037 Ga0207651_104440371 286
25 3300028794 Ga0307515_10037661 Ga0307515_100376611 286
26 3300006195 Ga0075366_10018190 Ga0075366_100181902 287
27 3300047443 Ga0495687_000153 Ga0495687_000153_38404_39327 287
28 3300006353 Ga0075370_10006950 Ga0075370_100069504 288
29 3300046507 Ga0495606_0021455 Ga0495606_0021455_1317_2237 288
30 3300003322 rootL2_10080904 rootL2_100809042 289
31 3300006353 Ga0075370_10035598 Ga0075370_100355983 289
32 3300009148 Ga0105243_10008623 Ga0105243_100086232 289
33 3300025935 Ga0207709_10022786 Ga0207709_100227862 289
34 3300028794 Ga0307515_10125132 Ga0307515_101251322 289
35 3300035088 Ga0373940_0008392 Ga0373940_0008392_1374_2297 289
36 3300035114 Ga0373939_0000094 Ga0373939_0000094_26406_27329 289
37 3300035121 Ga0373960_0006723 Ga0373960_0006723_1019_1942 289
38 3300035691 Ga0373931_0004722 Ga0373931_0004722_2040_2963 289
39 3300003322 rootL2_10122240 rootL2_101222401 290
40 3300006195 Ga0075366_10050009 Ga0075366_100500092 290
41 3300006353 Ga0075370_10178506 Ga0075370_101785062 290
42 3300031548 Ga0307408_100000056 Ga0307408_10000005695 290
43 3300042120 Ga0450917_002508 Ga0450917_002508_73_996 290
44 3300042126 Ga0450888_000898 Ga0450888_000898_1049_1972 290
45 3300042127 Ga0450890_001811 Ga0450890_001811_1061_1984 290
46 3300042129 Ga0450891_000115 Ga0450891_000115_5041_5964 290
47 3300042144 Ga0450889_000177 Ga0450889_000177_922_1845 290
48 3300042530 Ga0450916_002487 Ga0450916_002487_232_1155 290
49 3300050496 nmdc:mga07m45_19621_c1 nmdc:mga07m45_19621_c1_1160_2083 290
50 3300050496 nmdc:mga07m45_83645_c1 nmdc:mga07m45_83645_c1_584_1507 290
51 iso_pu_bacteria 2894023352 2894025860 290
52 iso_pu_bacteria 2713897090 2715501197 291
53 iso_pu_bacteria 2855020534 2855022040 291
54 3300003759 Ga0055525_1000054 Ga0055525_100005442 292
55 3300025230 Ga0209563_100075 Ga0209563_100075154 292
56 3300049573 Ga0501037_0035999 Ga0501037_0035999_59_958 292
57 3300053134 Ga0500658_0046925 Ga0500658_0046925_681_1580 292
58 3300053158 Ga0500627_0115771 Ga0500627_0115771_194_1093 292
59 3300053732 Ga0500656_004046 Ga0500656_004046_254_1153 292
60 iso_pu_bacteria 2919497567 2919497905 294
61 3300049688 Ga0501259_008398 Ga0501259_008398_14_901 295
62 3300021361 Ga0213872_10000073 Ga0213872_1000007353 296
63 3300039447 Ga0436361_0736070 Ga0436361_0736070_36124_37047 296
64 3300044683 Ga0466965_0021808 Ga0466965_0021808_1300_2190 296
65 3300049570 Ga0501033_0000049 Ga0501033_0000049_96525_97415 296
66 3300049574 Ga0501038_0000965 Ga0501038_0000965_12812_13702 296
67 3300046517 Ga0495630_0324009 Ga0495630_0324009_25_939 297
68 3300005288 Ga0065714_10066376 Ga0065714_100663763 298
69 3300025261 Ga0209233_1015722 Ga0209233_10157222 298
70 iso_pu_bacteria 2511231003 2511250802 299
71 iso_pu_bacteria 2818991436 2819540611 299
72 iso_pu_bacteria 2818991445 2819591637 299
73 3300002704 JGI25155J39150_1000143 JGI25155J39150_10001433 300
74 3300002704 JGI25155J39150_1000590 JGI25155J39150_10005901 300
75 3300002705 JGI25156J39149_1000343 JGI25156J39149_100034322 300
76 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001602 300
77 3300002737 JGI25162J39368_1005476 JGI25162J39368_10054762 300
78 3300002738 JGI25154J39366_1000131 JGI25154J39366_10001316 300
79 3300002741 JGI25157J39369_1000119 JGI25157J39369_100011943 300
80 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001587 300
81 3300003751 Ga0055538_1000001 Ga0055538_1000001447 300
82 3300003752 Ga0055539_1000001 Ga0055539_1000001447 300
83 3300003756 Ga0055533_1000003 Ga0055533_1000003587 300
84 3300003758 Ga0055532_1000023 Ga0055532_1000023156 300
85 3300003759 Ga0055525_1000003 Ga0055525_1000003587 300
86 3300003841 Ga0055541_1000001 Ga0055541_1000001587 300
87 3300005339 Ga0070660_100134192 Ga0070660_1001341922 300
88 3300005344 Ga0070661_100031869 Ga0070661_1000318692 300
89 3300005366 Ga0070659_100066688 Ga0070659_1000666883 300
90 3300005564 Ga0070664_100098306 Ga0070664_1000983062 300
91 3300005616 Ga0068852_100060439 Ga0068852_1000604392 300
92 3300009093 Ga0105240_10001031 Ga0105240_100010313 300
93 3300009093 Ga0105240_10004684 Ga0105240_100046842 300
94 3300009551 Ga0105238_10025233 Ga0105238_100252333 300
95 3300010375 Ga0105239_10268419 Ga0105239_102684192 300
96 3300014497 Ga0182008_10026910 Ga0182008_100269102 300
97 3300015261 Ga0182006_1012756 Ga0182006_10127563 300
98 3300025206 Ga0209435_100013 Ga0209435_100013272 300
99 3300025224 Ga0209784_100004 Ga0209784_100004582 300
100 3300025225 Ga0209566_100004 Ga0209566_100004739 300
101 3300025226 Ga0209674_100006 Ga0209674_100006739 300
102 3300025229 Ga0209147_100030 Ga0209147_10003084 300
103 3300025230 Ga0209563_100009 Ga0209563_100009582 300
104 3300025231 Ga0207427_100467 Ga0207427_1004673 300
105 3300025233 Ga0209437_100004 Ga0209437_100004582 300
106 3300025233 Ga0209437_100208 Ga0209437_10020820 300
107 3300025242 Ga0209258_100205 Ga0209258_10020584 300
108 3300025246 Ga0209646_1000034 Ga0209646_1000034272 300
109 3300025250 Ga0209026_1000022 Ga0209026_1000022272 300
110 3300025253 Ga0209677_100005 Ga0209677_100005582 300
111 3300025256 Ga0209759_1000018 Ga0209759_1000018272 300
112 3300025261 Ga0209233_1000005 Ga0209233_1000005739 300
113 3300025272 Ga0209455_1002639 Ga0209455_10026393 300
114 3300025913 Ga0207695_10030134 Ga0207695_100301343 300
115 3300025913 Ga0207695_10090582 Ga0207695_100905822 300
116 3300025919 Ga0207657_10065974 Ga0207657_100659743 300
117 3300025924 Ga0207694_10039059 Ga0207694_100390592 300
118 3300044658 Ga0466972_0000111 Ga0466972_0000111_32982_33902 300
119 3300044658 Ga0466972_0022353 Ga0466972_0022353_1730_2650 300
120 3300044683 Ga0466965_0000099 Ga0466965_0000099_18716_19636 300
121 3300044684 Ga0466966_0042881 Ga0466966_0042881_1457_2395 300
122 3300044693 Ga0466961_0113827 Ga0466961_0113827_86_1024 300
123 3300044706 Ga0466964_0022851 Ga0466964_0022851_459_1397 300
124 3300044706 Ga0466964_0105194 Ga0466964_0105194_238_1158 300
125 3300044735 Ga0466968_0025800 Ga0466968_0025800_1421_2341 300
126 3300044842 Ga0466957_0000005 Ga0466957_0000005_78327_79265 300
127 3300045049 Ga0466959_0032593 Ga0466959_0032593_1235_2173 300
128 3300046454 Ga0495592_0024776 Ga0495592_0024776_1289_2209 300
129 3300046462 Ga0495651_0002661 Ga0495651_0002661_6425_7345 300
130 3300046463 Ga0495653_0018797 Ga0495653_0018797_2587_3507 300
131 3300046511 Ga0495608_0020340 Ga0495608_0020340_624_1544 300
132 3300046514 Ga0495618_0006093 Ga0495618_0006093_4602_5522 300
133 3300046514 Ga0495618_0281972 Ga0495618_0281972_83_1003 300
134 3300046516 Ga0495628_0000835 Ga0495628_0000835_19509_20429 300
135 3300046529 Ga0495652_0034009 Ga0495652_0034009_1895_2815 300
136 3300046675 Ga0495657_0045934 Ga0495657_0045934_1784_2704 300
137 3300046678 Ga0495599_0002461 Ga0495599_0002461_9639_10559 300
138 3300046679 Ga0495623_0011084 Ga0495623_0011084_383_1303 300
139 3300046690 Ga0495624_0078484 Ga0495624_0078484_570_1490 300
140 3300046809 Ga0495600_0012302 Ga0495600_0012302_2572_3492 300
141 3300048088 Ga0495602_0082414 Ga0495602_0082414_687_1607 300
142 3300048088 Ga0495602_0240335 Ga0495602_0240335_338_1258 300
143 3300048903 Ga0496100_0159660 Ga0496100_0159660_581_1501 300
144 3300048917 Ga0496114_0085489 Ga0496114_0085489_930_1850 300
145 3300048919 Ga0496116_0006493 Ga0496116_0006493_3500_4420 300
146 3300048921 Ga0496118_0137124 Ga0496118_0137124_71_991 300
147 3300048924 Ga0496121_0046374 Ga0496121_0046374_2384_3304 300
148 3300048924 Ga0496121_0051934 Ga0496121_0051934_786_1706 300
149 3300048925 Ga0496122_0008199 Ga0496122_0008199_6341_7261 300
150 3300048926 Ga0496123_0002055 Ga0496123_0002055_4096_5016 300
151 3300048928 Ga0496125_0000794 Ga0496125_0000794_14163_15083 300
152 3300048928 Ga0496125_0101879 Ga0496125_0101879_870_1790 300
153 3300048929 Ga0496126_0079290 Ga0496126_0079290_1021_1941 300
154 3300053077 Ga0495601_0022375 Ga0495601_0022375_383_1303 300
155 3300053119 Ga0500595_000547 Ga0500595_000547_19161_20081 300
156 3300053125 Ga0500618_001812 Ga0500618_001812_5250_6170 300
157 3300053141 Ga0500574_000340 Ga0500574_000340_2360_3280 300
158 3300053161 Ga0500634_0053150 Ga0500634_0053150_868_1788 300
159 iso_pu_bacteria 2643221544 2643745412 300
160 iso_pu_bacteria 2643221639 2644218010 300
161 iso_pu_bacteria 2643221644 2644247305 300
162 iso_pu_bacteria 2643221646 2644258250 300
163 iso_pu_bacteria 2738541337 2739057146 300
164 3300002739 JGI25158J39367_1012712 JGI25158J39367_10127121 301
165 3300003187 JGI25151J46595_10000490 JGI25151J46595_1000049021 301
166 3300003322 rootL2_10043086 rootL2_100430862 301
167 3300003322 rootL2_10047190 rootL2_1004719010 301
168 3300003322 rootL2_10106273 rootL2_101062732 301
169 3300003759 Ga0055525_1000008 Ga0055525_1000008422 301
170 3300003771 Ga0055526_1003413 Ga0055526_100341310 301
171 3300003773 Ga0055537_1009160 Ga0055537_10091602 301
172 3300003775 Ga0055524_1000679 Ga0055524_100067911 301
173 3300003775 Ga0055524_1006891 Ga0055524_10068912 301
174 3300003781 Ga0055536_1001609 Ga0055536_10016096 301
175 3300003781 Ga0055536_1006289 Ga0055536_10062892 301
176 3300003784 Ga0055534_1005923 Ga0055534_10059232 301
177 3300003790 Ga0055528_1019775 Ga0055528_10197752 301
178 3300003791 Ga0055530_10004499 Ga0055530_100044992 301
179 3300003791 Ga0055530_10032454 Ga0055530_100324541 301
180 3300003792 Ga0055540_1001457 Ga0055540_10014578 301
181 3300003794 Ga0055531_10001899 Ga0055531_1000189912 301
182 3300003794 Ga0055531_10001936 Ga0055531_100019363 301
183 3300003794 Ga0055531_10020910 Ga0055531_100209103 301
184 3300005262 Ga0065165_1019645 Ga0065165_10196453 301
185 3300005327 Ga0070658_10169039 Ga0070658_101690391 301
186 3300005327 Ga0070658_10262022 Ga0070658_102620221 301
187 3300005339 Ga0070660_100079160 Ga0070660_1000791602 301
188 3300005339 Ga0070660_100131323 Ga0070660_1001313231 301
189 3300005339 Ga0070660_100190023 Ga0070660_1001900231 301
190 3300005339 Ga0070660_100237986 Ga0070660_1002379862 301
191 3300005344 Ga0070661_100000229 Ga0070661_1000002296 301
192 3300005353 Ga0070669_100034642 Ga0070669_1000346423 301
193 3300005354 Ga0070675_100190216 Ga0070675_1001902162 301
194 3300005366 Ga0070659_100009239 Ga0070659_1000092395 301
195 3300005366 Ga0070659_100080779 Ga0070659_1000807791 301
196 3300005457 Ga0070662_100002684 Ga0070662_1000026842 301
197 3300005457 Ga0070662_100079348 Ga0070662_1000793482 301
198 3300005467 Ga0070706_100001200 Ga0070706_1000012006 301
199 3300005468 Ga0070707_100104898 Ga0070707_1001048982 301
200 3300005471 Ga0070698_100169300 Ga0070698_1001693002 301
201 3300005518 Ga0070699_100592095 Ga0070699_1005920951 301
202 3300005539 Ga0068853_100005209 Ga0068853_1000052095 301
203 3300005539 Ga0068853_100506555 Ga0068853_1005065552 301
204 3300005543 Ga0070672_100077579 Ga0070672_1000775791 301
205 3300005563 Ga0068855_100645865 Ga0068855_1006458651 301
206 3300005564 Ga0070664_100012848 Ga0070664_1000128487 301
207 3300005564 Ga0070664_100030868 Ga0070664_1000308682 301
208 3300005577 Ga0068857_100258442 Ga0068857_1002584421 301
209 3300005578 Ga0068854_100144357 Ga0068854_1001443572 301
210 3300005616 Ga0068852_100097177 Ga0068852_1000971771 301
211 3300005617 Ga0068859_100393324 Ga0068859_1003933242 301
212 3300006048 Ga0075363_100011468 Ga0075363_1000114685 301
213 3300006048 Ga0075363_100013972 Ga0075363_1000139724 301
214 3300006051 Ga0075364_10038210 Ga0075364_100382102 301
215 3300006177 Ga0075362_10011997 Ga0075362_100119972 301
216 3300006177 Ga0075362_10053506 Ga0075362_100535062 301
217 3300006178 Ga0075367_10086726 Ga0075367_100867262 301
218 3300006186 Ga0075369_10136294 Ga0075369_101362942 301
219 3300006353 Ga0075370_10003046 Ga0075370_100030467 301
220 3300006353 Ga0075370_10006846 Ga0075370_100068462 301
221 3300006358 Ga0068871_100140675 Ga0068871_1001406752 301
222 3300006358 Ga0068871_100228440 Ga0068871_1002284402 301
223 3300006931 Ga0097620_100393291 Ga0097620_1003932912 301
224 3300006944 Ga0099823_1004429 Ga0099823_10044297 301
225 3300009036 Ga0105244_10000775 Ga0105244_1000077511 301
226 3300009036 Ga0105244_10032662 Ga0105244_100326623 301
227 3300009093 Ga0105240_10037144 Ga0105240_100371447 301
228 3300009148 Ga0105243_10012543 Ga0105243_100125432 301
229 3300009148 Ga0105243_10096423 Ga0105243_100964232 301
230 3300009174 Ga0105241_10023068 Ga0105241_100230682 301
231 3300009545 Ga0105237_10019363 Ga0105237_100193634 301
232 3300009545 Ga0105237_10263516 Ga0105237_102635162 301
233 3300010375 Ga0105239_10033461 Ga0105239_100334615 301
234 3300011119 Ga0105246_10190782 Ga0105246_101907822 301
235 3300011119 Ga0105246_10280588 Ga0105246_102805881 301
236 3300012497 Ga0157319_1000001 Ga0157319_100000130 301
237 3300013306 Ga0163162_10148710 Ga0163162_101487102 301
238 3300013307 Ga0157372_10740060 Ga0157372_107400601 301
239 3300015261 Ga0182006_1001948 Ga0182006_10019482 301
240 3300015262 Ga0182007_10001204 Ga0182007_100012049 301
241 3300017792 Ga0163161_10019138 Ga0163161_100191382 301
242 3300021361 Ga0213872_10024424 Ga0213872_100244241 301
243 3300025230 Ga0209563_100003 Ga0209563_1000031506 301
244 3300025254 Ga0209148_1000380 Ga0209148_100038012 301
245 3300025292 Ga0209676_1000356 Ga0209676_100035622 301
246 3300025292 Ga0209676_1010471 Ga0209676_10104712 301
247 3300025298 Ga0209050_1000575 Ga0209050_100057519 301
248 3300025298 Ga0209050_1001396 Ga0209050_10013967 301
249 3300025299 Ga0209256_1001621 Ga0209256_10016213 301
250 3300025299 Ga0209256_1002194 Ga0209256_100219410 301
251 3300025303 Ga0209051_1000073 Ga0209051_100007370 301
252 3300025303 Ga0209051_1001499 Ga0209051_10014999 301
253 3300025303 Ga0209051_1010952 Ga0209051_10109522 301
254 3300025303 Ga0209051_1025225 Ga0209051_10252252 301
255 3300025304 Ga0209257_1000139 Ga0209257_1000139195 301
256 3300025304 Ga0209257_1001530 Ga0209257_10015303 301
257 3300025304 Ga0209257_1008843 Ga0209257_10088432 301
258 3300025304 Ga0209257_1011931 Ga0209257_10119314 301
259 3300025728 Ga0207655_1002169 Ga0207655_100216912 301
260 3300025909 Ga0207705_10007288 Ga0207705_100072884 301
261 3300025910 Ga0207684_10002095 Ga0207684_100020954 301
262 3300025911 Ga0207654_10005557 Ga0207654_100055572 301
263 3300025913 Ga0207695_10176615 Ga0207695_101766152 301
264 3300025914 Ga0207671_10037347 Ga0207671_100373472 301
265 3300025914 Ga0207671_10157593 Ga0207671_101575932 301
266 3300025919 Ga0207657_10000613 Ga0207657_100006132 301
267 3300025919 Ga0207657_10014271 Ga0207657_100142715 301
268 3300025919 Ga0207657_10221687 Ga0207657_102216873 301
269 3300025920 Ga0207649_10007212 Ga0207649_100072124 301
270 3300025920 Ga0207649_10126759 Ga0207649_101267593 301
271 3300025920 Ga0207649_10224782 Ga0207649_102247821 301
272 3300025922 Ga0207646_10215564 Ga0207646_102155642 301
273 3300025926 Ga0207659_10142501 Ga0207659_101425012 301
274 3300025932 Ga0207690_10015190 Ga0207690_100151904 301
275 3300025932 Ga0207690_10025624 Ga0207690_100256242 301
276 3300025932 Ga0207690_10293343 Ga0207690_102933432 301
277 3300025933 Ga0207706_10002023 Ga0207706_100020233 301
278 3300025935 Ga0207709_10001645 Ga0207709_1000164514 301
279 3300025935 Ga0207709_10062996 Ga0207709_100629962 301
280 3300025941 Ga0207711_10478085 Ga0207711_104780851 301
281 3300025945 Ga0207679_10000339 Ga0207679_1000033913 301
282 3300025945 Ga0207679_10015235 Ga0207679_100152353 301
283 3300025945 Ga0207679_10086829 Ga0207679_100868292 301
284 3300025949 Ga0207667_10055481 Ga0207667_100554816 301
285 3300025949 Ga0207667_10226354 Ga0207667_102263542 301
286 3300025949 Ga0207667_10298165 Ga0207667_102981652 301
287 3300025972 Ga0207668_10149974 Ga0207668_101499742 301
288 3300025981 Ga0207640_10118610 Ga0207640_101186102 301
289 3300026078 Ga0207702_10275279 Ga0207702_102752792 301
290 3300026089 Ga0207648_10149923 Ga0207648_101499232 301
291 3300026116 Ga0207674_10118585 Ga0207674_101185852 301
292 3300026116 Ga0207674_10147538 Ga0207674_101475383 301
293 3300026116 Ga0207674_10217362 Ga0207674_102173622 301
294 3300026121 Ga0207683_10207547 Ga0207683_102075472 301
295 3300026142 Ga0207698_10018339 Ga0207698_100183392 301
296 3300026142 Ga0207698_10544940 Ga0207698_105449401 301
297 3300027866 Ga0209813_10035726 Ga0209813_100357262 301
298 3300028573 Ga0265334_10054267 Ga0265334_100542672 301
299 3300028786 Ga0307517_10002278 Ga0307517_100022782 301
300 3300028786 Ga0307517_10061642 Ga0307517_100616422 301
301 3300028794 Ga0307515_10000028 Ga0307515_1000002873 301
302 3300028794 Ga0307515_10124280 Ga0307515_101242802 301
303 3300028794 Ga0307515_10173138 Ga0307515_101731382 301
304 3300028794 Ga0307515_10332260 Ga0307515_103322601 301
305 3300031235 Ga0265330_10000099 Ga0265330_100000995 301
306 3300031238 Ga0265332_10000002 Ga0265332_10000002574 301
307 3300031239 Ga0265328_10009017 Ga0265328_100090172 301
308 3300031241 Ga0265325_10005521 Ga0265325_100055215 301
309 3300031247 Ga0265340_10005843 Ga0265340_100058436 301
310 3300031251 Ga0265327_10000155 Ga0265327_1000015578 301
311 3300031456 Ga0307513_10053889 Ga0307513_100538894 301
312 3300031548 Ga0307408_100069264 Ga0307408_1000692641 301
313 3300031548 Ga0307408_100140403 Ga0307408_1001404032 301
314 3300031548 Ga0307408_100150089 Ga0307408_1001500892 301
315 3300031616 Ga0307508_10007776 Ga0307508_100077764 301
316 3300031649 Ga0307514_10084422 Ga0307514_100844222 301
317 3300031711 Ga0265314_10000089 Ga0265314_1000008984 301
318 3300031730 Ga0307516_10000286 Ga0307516_100002865 301
319 3300031730 Ga0307516_10000851 Ga0307516_1000085111 301
320 3300031730 Ga0307516_10241601 Ga0307516_102416011 301
321 3300032002 Ga0307416_100040620 Ga0307416_1000406201 301
322 3300033180 Ga0307510_10002323 Ga0307510_1000232314 301
323 3300033180 Ga0307510_10060607 Ga0307510_100606073 301
324 3300037312 Ga0395899_0002640 Ga0395899_0002640_98_1036 301
325 3300037312 Ga0395899_0005487 Ga0395899_0005487_2653_3585 301
326 3300037312 Ga0395899_0007329 Ga0395899_0007329_610_1542 301
327 3300037312 Ga0395899_0152592 Ga0395899_0152592_201_1139 301
328 3300037312 Ga0395899_0255643 Ga0395899_0255643_98_1036 301
329 3300037418 Ga0395900_0000065 Ga0395900_0000065_89981_90919 301
330 3300037418 Ga0395900_0003050 Ga0395900_0003050_9984_10922 301
331 3300037418 Ga0395900_0004717 Ga0395900_0004717_10778_11710 301
332 3300037418 Ga0395900_0045447 Ga0395900_0045447_3265_4197 301
333 3300037418 Ga0395900_0523244 Ga0395900_0523244_55_993 301
334 3300037466 Ga0395898_0002040 Ga0395898_0002040_14131_15063 301
335 3300037466 Ga0395898_0022967 Ga0395898_0022967_134_1066 301
336 3300037466 Ga0395898_0143195 Ga0395898_0143195_150_1088 301
337 3300037466 Ga0395898_0176082 Ga0395898_0176082_55_993 301
338 3300037466 Ga0395898_0206911 Ga0395898_0206911_173_1111 301
339 3300037471 Ga0395905_0004714 Ga0395905_0004714_12762_13688 301
340 3300037471 Ga0395905_0023568 Ga0395905_0023568_4344_5282 301
341 3300037471 Ga0395905_0117023 Ga0395905_0117023_900_1826 301
342 3300037471 Ga0395905_0607575 Ga0395905_0607575_13_951 301
343 3300038443 Ga0395901_0000114 Ga0395901_0000114_24702_25640 301
344 3300038443 Ga0395901_0001025 Ga0395901_0001025_29252_30184 301
345 3300038443 Ga0395901_0046123 Ga0395901_0046123_3579_4511 301
346 3300038443 Ga0395901_0263742 Ga0395901_0263742_171_1109 301
347 3300038443 Ga0395901_0387057 Ga0395901_0387057_294_1226 301
348 3300038443 Ga0395901_0625861 Ga0395901_0625861_107_1045 301
349 3300039447 Ga0436361_0033979 Ga0436361_0033979_1815_2738 301
350 3300041413 Ga0439465_0035828 Ga0439465_0035828_571_1509 301
351 3300042005 Ga0439448_0021161 Ga0439448_0021161_33_971 301
352 3300042008 Ga0439450_021970 Ga0439450_021970_304_1236 301
353 3300042012 Ga0439455_0047424 Ga0439455_0047424_37_975 301
354 3300042121 Ga0450919_003709 Ga0450919_003709_527_1450 301
355 3300042139 Ga0450904_000523 Ga0450904_000523_2624_3550 301
356 3300042531 Ga0450918_000283 Ga0450918_000283_5488_6411 301
357 3300044656 Ga0466969_0031618 Ga0466969_0031618_89_1027 301
358 3300044683 Ga0466965_0003561 Ga0466965_0003561_2015_2953 301
359 3300044683 Ga0466965_0061910 Ga0466965_0061910_794_1720 301
360 3300044684 Ga0466966_0029352 Ga0466966_0029352_733_1671 301
361 3300044684 Ga0466966_0085868 Ga0466966_0085868_843_1781 301
362 3300044684 Ga0466966_0132965 Ga0466966_0132965_65_1003 301
363 3300044684 Ga0466966_0242868 Ga0466966_0242868_83_1021 301
364 3300044694 Ga0466963_0362719 Ga0466963_0362719_56_994 301
365 3300044706 Ga0466964_0002257 Ga0466964_0002257_4167_5105 301
366 3300044706 Ga0466964_0021297 Ga0466964_0021297_749_1681 301
367 3300044735 Ga0466968_0005833 Ga0466968_0005833_308_1246 301
368 3300044842 Ga0466957_0001421 Ga0466957_0001421_4583_5509 301
369 3300044842 Ga0466957_0018582 Ga0466957_0018582_1672_2610 301
370 3300044901 Ga0466960_0022813 Ga0466960_0022813_1481_2407 301
371 3300045049 Ga0466959_0010269 Ga0466959_0010269_4755_5693 301
372 3300045049 Ga0466959_0038048 Ga0466959_0038048_2291_3229 301
373 3300045049 Ga0466959_0042038 Ga0466959_0042038_2231_3169 301
374 3300045049 Ga0466959_0292090 Ga0466959_0292090_53_991 301
375 3300045051 Ga0451576_0085449 Ga0451576_0085449_1621_2544 301
376 3300045976 Ga0466967_0017561 Ga0466967_0017561_2514_3446 301
377 3300045976 Ga0466967_0512093 Ga0466967_0512093_188_1126 301
378 3300046457 Ga0495590_0102322 Ga0495590_0102322_33_971 301
379 3300046460 Ga0495638_0028052 Ga0495638_0028052_1689_2615 301
380 3300046460 Ga0495638_0101917 Ga0495638_0101917_197_1120 301
381 3300046460 Ga0495638_0121984 Ga0495638_0121984_32_958 301
382 3300046474 Ga0495605_0001024 Ga0495605_0001024_840_1778 301
383 3300046474 Ga0495605_0041691 Ga0495605_0041691_977_1912 301
384 3300046491 Ga0495584_0002172 Ga0495584_0002172_89_1027 301
385 3300046491 Ga0495584_0024023 Ga0495584_0024023_1197_2132 301
386 3300046501 Ga0495607_0000277 Ga0495607_0000277_41961_42896 301
387 3300046501 Ga0495607_0001095 Ga0495607_0001095_6739_7677 301
388 3300046501 Ga0495607_0013475 Ga0495607_0013475_2295_3233 301
389 3300046506 Ga0495583_0000615 Ga0495583_0000615_5004_6038 301
390 3300046507 Ga0495606_0011604 Ga0495606_0011604_1900_2838 301
391 3300046512 Ga0495610_0020577 Ga0495610_0020577_1461_2387 301
392 3300046513 Ga0495616_0000042 Ga0495616_0000042_15234_16160 301
393 3300046513 Ga0495616_0001007 Ga0495616_0001007_8224_9150 301
394 3300046513 Ga0495616_0001176 Ga0495616_0001176_5228_6163 301
395 3300046513 Ga0495616_0027695 Ga0495616_0027695_1899_2837 301
396 3300046513 Ga0495616_0035184 Ga0495616_0035184_331_1269 301
397 3300046518 Ga0495631_0000455 Ga0495631_0000455_18048_18974 301
398 3300046520 Ga0495637_0006307 Ga0495637_0006307_751_1677 301
399 3300046522 Ga0495643_0000653 Ga0495643_0000653_19153_20079 301
400 3300046522 Ga0495643_0001662 Ga0495643_0001662_16223_17161 301
401 3300046524 Ga0495648_0002371 Ga0495648_0002371_1044_1982 301
402 3300046525 Ga0495663_0011864 Ga0495663_0011864_1418_2344 301
403 3300046528 Ga0495642_0000489 Ga0495642_0000489_12877_13815 301
404 3300046528 Ga0495642_0021790 Ga0495642_0021790_1519_2454 301
405 3300046530 Ga0495654_0010940 Ga0495654_0010940_533_1459 301
406 3300046530 Ga0495654_0014623 Ga0495654_0014623_1977_3011 301
407 3300046537 Ga0495598_0078168 Ga0495598_0078168_46_972 301
408 3300046538 Ga0495609_0000001 Ga0495609_0000001_951016_951951 301
409 3300046539 Ga0495621_0010300 Ga0495621_0010300_600_1523 301
410 3300046539 Ga0495621_0022926 Ga0495621_0022926_672_1598 301
411 3300046543 Ga0495645_0027501 Ga0495645_0027501_89_1027 301
412 3300046615 Ga0495656_0110589 Ga0495656_0110589_10_936 301
413 3300046616 Ga0495668_0240592 Ga0495668_0240592_40_963 301
414 3300046665 Ga0495661_0000063 Ga0495661_0000063_22959_23894 301
415 3300046665 Ga0495661_0003232 Ga0495661_0003232_1652_2590 301
416 3300046665 Ga0495661_0022025 Ga0495661_0022025_310_1248 301
417 3300046665 Ga0495661_0109954 Ga0495661_0109954_135_1073 301
418 3300046674 Ga0495588_0000052 Ga0495588_0000052_145230_146168 301
419 3300046674 Ga0495588_0094264 Ga0495588_0094264_204_1130 301
420 3300046691 Ga0495670_0084768 Ga0495670_0084768_360_1286 301
421 3300046794 Ga0495589_0000015 Ga0495589_0000015_89327_90262 301
422 3300046794 Ga0495589_0000116 Ga0495589_0000116_12473_13411 301
423 3300046810 Ga0495660_0000145 Ga0495660_0000145_62230_63168 301
424 3300046810 Ga0495660_0041635 Ga0495660_0041635_637_1575 301
425 3300047320 Ga0495672_0008763 Ga0495672_0008763_5414_6352 301
426 3300047323 Ga0495683_0019759 Ga0495683_0019759_956_1894 301
427 3300047323 Ga0495683_0028718 Ga0495683_0028718_983_1918 301
428 3300047443 Ga0495687_000003 Ga0495687_000003_548850_549785 301
429 3300047443 Ga0495687_000073 Ga0495687_000073_14549_15487 301
430 3300047443 Ga0495687_000891 Ga0495687_000891_17033_17971 301
431 3300047445 Ga0495677_0000001 Ga0495677_0000001_609369_610304 301
432 3300047445 Ga0495677_0000215 Ga0495677_0000215_22917_23855 301
433 3300047472 Ga0495686_0000190 Ga0495686_0000190_111692_112618 301
434 3300047472 Ga0495686_0057965 Ga0495686_0057965_250_1173 301
435 3300047673 Ga0495593_0022644 Ga0495593_0022644_620_1546 301
436 3300048091 Ga0495626_0000128 Ga0495626_0000128_85473_86408 301
437 3300048091 Ga0495626_0000171 Ga0495626_0000171_62230_63168 301
438 3300048091 Ga0495626_0004823 Ga0495626_0004823_1675_2601 301
439 3300048091 Ga0495626_0046048 Ga0495626_0046048_139_1065 301
440 3300048903 Ga0496100_0230432 Ga0496100_0230432_35_973 301
441 3300048904 Ga0496101_0027041 Ga0496101_0027041_486_1418 301
442 3300048905 Ga0496102_0013533 Ga0496102_0013533_2475_3398 301
443 3300048905 Ga0496102_0179741 Ga0496102_0179741_304_1230 301
444 3300048905 Ga0496102_0279371 Ga0496102_0279371_470_1396 301
445 3300048905 Ga0496102_0489560 Ga0496102_0489560_94_1026 301
446 3300048906 Ga0496103_0046056 Ga0496103_0046056_1276_2202 301
447 3300048906 Ga0496103_0202074 Ga0496103_0202074_150_1088 301
448 3300048907 Ga0496104_0212165 Ga0496104_0212165_241_1173 301
449 3300048908 Ga0496105_0190750 Ga0496105_0190750_439_1377 301
450 3300048909 Ga0496106_0037494 Ga0496106_0037494_1793_2731 301
451 3300048910 Ga0496107_0180295 Ga0496107_0180295_440_1378 301
452 3300048910 Ga0496107_0379934 Ga0496107_0379934_62_994 301
453 3300048912 Ga0496109_0266393 Ga0496109_0266393_39_1007 301
454 3300048916 Ga0496113_0011778 Ga0496113_0011778_4779_5717 301
455 3300048918 Ga0496115_0217780 Ga0496115_0217780_200_1132 301
456 3300048921 Ga0496118_0010168 Ga0496118_0010168_7242_8168 301
457 3300048921 Ga0496118_0032872 Ga0496118_0032872_443_1381 301
458 3300048924 Ga0496121_0034335 Ga0496121_0034335_1467_2405 301
459 3300048924 Ga0496121_0306419 Ga0496121_0306419_96_1022 301
460 3300048925 Ga0496122_0001249 Ga0496122_0001249_1396_2334 301
461 3300048925 Ga0496122_0032516 Ga0496122_0032516_2413_3339 301
462 3300048925 Ga0496122_0123119 Ga0496122_0123119_246_1184 301
463 3300048926 Ga0496123_0014620 Ga0496123_0014620_2275_3213 301
464 3300048927 Ga0496124_0004031 Ga0496124_0004031_11602_12540 301
465 3300048927 Ga0496124_0032358 Ga0496124_0032358_421_1347 301
466 3300048927 Ga0496124_0062916 Ga0496124_0062916_24_962 301
467 3300048927 Ga0496124_0089369 Ga0496124_0089369_199_1137 301
468 3300048927 Ga0496124_0113566 Ga0496124_0113566_1102_2040 301
469 3300048928 Ga0496125_0007526 Ga0496125_0007526_3366_4292 301
470 3300049649 Ga0501198_000012 Ga0501198_000012_10362_11285 301
471 3300049662 Ga0501222_000010 Ga0501222_000010_10368_11291 301
472 3300049822 Ga0501035_0001329 Ga0501035_0001329_2781_3719 301
473 3300049823 Ga0501044_0369845 Ga0501044_0369845_100_1038 301
474 3300050489 nmdc:mga03683_12920_c1 nmdc:mga03683_12920_c1_1789_2712 301
475 3300050489 nmdc:mga03683_29706_c1 nmdc:mga03683_29706_c1_605_1531 301
476 3300050490 nmdc:mga03n38_9886_c1 nmdc:mga03n38_9886_c1_37_963 301
477 3300050491 nmdc:mga00v17_139792_c1 nmdc:mga00v17_139792_c1_503_1426 301
478 3300050493 nmdc:mga0k408_10625_c1 nmdc:mga0k408_10625_c1_2663_3589 301
479 3300050494 nmdc:mga06z11_25937_c1 nmdc:mga06z11_25937_c1_591_1514 301
480 3300050496 nmdc:mga07m45_1806_c2 nmdc:mga07m45_1806_c2_5226_6152 301
481 3300050496 nmdc:mga07m45_29115_c1 nmdc:mga07m45_29115_c1_1833_2756 301
482 3300050496 nmdc:mga07m45_38424_c1 nmdc:mga07m45_38424_c1_496_1419 301
483 3300050496 nmdc:mga07m45_3842_c1 nmdc:mga07m45_3842_c1_3392_4315 301
484 3300050496 nmdc:mga07m45_94998_c1 nmdc:mga07m45_94998_c1_307_1233 301
485 3300050516 nmdc:mga0sz30_54670_c1 nmdc:mga0sz30_54670_c1_185_1108 301
486 3300053079 Ga0500610_0054751 Ga0500610_0054751_1101_2027 301
487 3300053087 Ga0500643_004274 Ga0500643_004274_4158_5084 301
488 3300053093 Ga0500651_0000052 Ga0500651_0000052_53527_54453 301
489 3300053093 Ga0500651_0037223 Ga0500651_0037223_1487_2410 301
490 3300053110 Ga0500571_000036 Ga0500571_000036_8203_9129 301
491 3300053118 Ga0500594_0001512 Ga0500594_0001512_1165_2091 301
492 3300053118 Ga0500594_0002464 Ga0500594_0002464_2306_3229 301
493 3300053128 Ga0500626_016230 Ga0500626_016230_1247_2173 301
494 3300053131 Ga0500652_013230 Ga0500652_013230_576_1499 301
495 3300053133 Ga0500655_000491 Ga0500655_000491_3670_4596 301
496 3300053133 Ga0500655_003558 Ga0500655_003558_1098_2021 301
497 3300053134 Ga0500658_0000033 Ga0500658_0000033_50963_51889 301
498 3300053134 Ga0500658_0000040 Ga0500658_0000040_44342_45268 301
499 3300053136 Ga0500559_0000122 Ga0500559_0000122_27208_28131 301
500 3300053136 Ga0500559_0001672 Ga0500559_0001672_4587_5513 301
501 3300053137 Ga0500561_0005762 Ga0500561_0005762_1232_2158 301
502 3300053139 Ga0500568_0003399 Ga0500568_0003399_6117_7043 301
503 3300053139 Ga0500568_0019381 Ga0500568_0019381_389_1312 301
504 3300053156 Ga0500622_0000651 Ga0500622_0000651_9299_10222 301
505 3300053158 Ga0500627_0115682 Ga0500627_0115682_90_1013 301
506 3300053161 Ga0500634_0002930 Ga0500634_0002930_2871_3797 301
507 3300053162 Ga0500638_010860 Ga0500638_010860_2299_3225 301
508 3300053739 Ga0500587_001706 Ga0500587_001706_1254_2177 301
509 iso_pu_bacteria 2513020051 2513229741 301
510 iso_pu_bacteria 2547132374 2548497548 301
511 iso_pu_bacteria 2643221556 2643797323 301
512 iso_pu_bacteria 2643221570 2643866466 301
513 iso_pu_bacteria 2643221596 2643993237 301
514 iso_pu_bacteria 2643221652 2644294172 301
515 iso_pu_bacteria 2643221658 2644329572 301
516 iso_pu_bacteria 2643221672 2644398351 301
517 iso_pu_bacteria 2643221684 2644474135 301
518 iso_pu_bacteria 2643221717 2644646176 301
519 iso_pu_bacteria 2831265667 2831270459 301
520 iso_pu_bacteria 2842733646 2842735605 301
521 iso_pu_bacteria 2885192300 2885194084 301
522 iso_pu_bacteria 2885198086 2885199701 301
523 iso_pu_bacteria 2885211737 2885213352 301
524 iso_pu_bacteria 2928084124 2928088925 301
525 iso_pu_bacteria 2928115317 2928119917 301
526 iso_pu_bacteria 2990710928 2990712328 301
527 iso_pu_bacteria 8047673197 8047675030 301
528 iso_pu_bacteria 2904479285 2904480936 302
529 3300005618 Ga0068864_100073320 Ga0068864_1000733202 303
530 3300005841 Ga0068863_100456188 Ga0068863_1004561882 303
531 3300009177 Ga0105248_10001682 Ga0105248_100016823 303
532 3300048908 Ga0496105_0357860 Ga0496105_0357860_84_1016 303
533 3300048915 Ga0496112_0206997 Ga0496112_0206997_543_1475 303
534 3300048916 Ga0496113_0193613 Ga0496113_0193613_72_1004 303
535 3300053125 Ga0500618_002516 Ga0500618_002516_490_1422 303
536 iso_pu_bacteria 2846037992 2846041057 303
537 3300001991 JGI24743J22301_10000136 JGI24743J22301_100001366 304
538 3300002077 JGI24744J21845_10003694 JGI24744J21845_100036942 304
539 3300003320 rootH2_10025857 rootH2_100258574 304
540 3300003320 rootH2_10037630 rootH2_100376303 304
541 3300003323 rootH1_10034690 rootH1_1003469012 304
542 3300003323 rootH1_10039626 rootH1_100396263 304
543 3300003791 Ga0055530_10009542 Ga0055530_100095422 304
544 3300005262 Ga0065165_1002636 Ga0065165_100263610 304
545 3300005327 Ga0070658_10004378 Ga0070658_100043788 304
546 3300005539 Ga0068853_100000007 Ga0068853_100000007138 304
547 3300005614 Ga0068856_100017064 Ga0068856_1000170642 304
548 3300006038 Ga0075365_10056844 Ga0075365_100568442 304
549 3300006177 Ga0075362_10016984 Ga0075362_100169842 304
550 3300006353 Ga0075370_10002404 Ga0075370_100024044 304
551 3300009093 Ga0105240_10000309 Ga0105240_1000030923 304
552 3300009545 Ga0105237_10436498 Ga0105237_104364982 304
553 3300010375 Ga0105239_10031152 Ga0105239_100311527 304
554 3300013100 Ga0157373_10000471 Ga0157373_100004719 304
555 3300013104 Ga0157370_10000554 Ga0157370_1000055413 304
556 3300013307 Ga0157372_10470984 Ga0157372_104709841 304
557 3300021388 Ga0213875_10001280 Ga0213875_1000128017 304
558 3300025298 Ga0209050_1001921 Ga0209050_100192113 304
559 3300025303 Ga0209051_1005113 Ga0209051_10051136 304
560 3300025901 Ga0207688_10017520 Ga0207688_100175202 304
561 3300025909 Ga0207705_10010554 Ga0207705_100105542 304
562 3300025913 Ga0207695_10000635 Ga0207695_1000063523 304
563 3300025914 Ga0207671_10259133 Ga0207671_102591331 304
564 3300026041 Ga0207639_10000001 Ga0207639_1000000184 304
565 3300026078 Ga0207702_10012461 Ga0207702_100124616 304
566 3300027866 Ga0209813_10031496 Ga0209813_100314962 304
567 3300031548 Ga0307408_100000021 Ga0307408_100000021170 304
568 3300031548 Ga0307408_100008195 Ga0307408_1000081955 304
569 3300031824 Ga0307413_10251955 Ga0307413_102519551 304
570 3300031903 Ga0307407_10000058 Ga0307407_1000005820 304
571 3300031903 Ga0307407_10002259 Ga0307407_100022593 304
572 3300031911 Ga0307412_10000013 Ga0307412_1000001315 304
573 3300032002 Ga0307416_100002351 Ga0307416_1000023514 304
574 3300032004 Ga0307414_10000081 Ga0307414_1000008110 304
575 3300032005 Ga0307411_10008542 Ga0307411_100085424 304
576 3300037312 Ga0395899_0010638 Ga0395899_0010638_2287_3201 304
577 3300037466 Ga0395898_0002898 Ga0395898_0002898_14033_14947 304
578 3300037853 Ga0436364_0828542 Ga0436364_0828542_2983_3918 304
579 3300042127 Ga0450890_000019 Ga0450890_000019_24938_25852 304
580 3300042130 Ga0450892_000078 Ga0450892_000078_6574_7488 304
581 3300042532 Ga0450893_0007158 Ga0450893_0007158_285_1199 304
582 3300044719 Ga0466971_0000034 Ga0466971_0000034_39510_40436 304
583 3300046515 Ga0495620_0065747 Ga0495620_0065747_68_1021 304
584 3300046518 Ga0495631_0052125 Ga0495631_0052125_306_1259 304
585 3300046519 Ga0495632_0015495 Ga0495632_0015495_1054_2007 304
586 3300046542 Ga0495597_0053466 Ga0495597_0053466_64_1017 304
587 3300046660 Ga0495625_0008989 Ga0495625_0008989_5871_6824 304
588 3300046694 Ga0495649_0000935 Ga0495649_0000935_7807_8760 304
589 3300046810 Ga0495660_0028390 Ga0495660_0028390_184_1137 304
590 3300047443 Ga0495687_008007 Ga0495687_008007_2265_3218 304
591 3300049568 Ga0501031_0000399 Ga0501031_0000399_6895_7821 304
592 3300049569 Ga0501032_0113565 Ga0501032_0113565_547_1473 304
593 3300049575 Ga0501039_0002616 Ga0501039_0002616_8817_9743 304
594 3300049579 Ga0501043_0003333 Ga0501043_0003333_9150_10076 304
595 3300049579 Ga0501043_0006588 Ga0501043_0006588_5231_6157 304
596 3300049581 Ga0501047_0008774 Ga0501047_0008774_3151_4077 304
597 3300049586 Ga0501070_0001605 Ga0501070_0001605_7306_8232 304
598 3300049665 Ga0501227_000022 Ga0501227_000022_3887_4801 304
599 3300049742 Ga0501080_0030133 Ga0501080_0030133_955_1890 304
600 3300049744 Ga0501083_0008427 Ga0501083_0008427_4729_5643 304
601 3300049822 Ga0501035_0000001 Ga0501035_0000001_76440_77366 304
602 3300049823 Ga0501044_0241917 Ga0501044_0241917_609_1535 304
603 3300049823 Ga0501044_0258980 Ga0501044_0258980_365_1291 304
604 3300050490 nmdc:mga03n38_33173_c1 nmdc:mga03n38_33173_c1_895_1848 304
605 3300050492 nmdc:mga0yw44_163821_c1 nmdc:mga0yw44_163821_c1_377_1330 304
606 3300050493 nmdc:mga0k408_153878_c1 nmdc:mga0k408_153878_c1_296_1249 304
607 3300050495 nmdc:mga04h51_1034_c1 nmdc:mga04h51_1034_c1_107_1060 304
608 3300050496 nmdc:mga07m45_613_c1 nmdc:mga07m45_613_c1_9605_10558 304
609 3300053086 Ga0500578_0000002 Ga0500578_0000002_77114_78049 304
610 3300053098 Ga0500650_0067886 Ga0500650_0067886_53_1006 304
611 3300053139 Ga0500568_0006960 Ga0500568_0006960_2458_3411 304
612 3300053151 Ga0500604_0020974 Ga0500604_0020974_696_1631 304
613 3300053153 Ga0500616_0009982 Ga0500616_0009982_4074_5009 304
614 3300061719 Ga0466962_0000059 Ga0466962_0000059_33722_34648 304
615 iso_pu_bacteria 2643221592 2643969547 304
616 iso_pu_bacteria 2643221625 2644143845 304
617 iso_pu_bacteria 2643221648 2644276447 304
618 iso_pu_bacteria 2843690924 2843694338 304
619 iso_pu_bacteria 2846033681 2846036221 304
620 iso_pu_bacteria 2998344455 2998348228 304
621 3300002155 JGI24033J26618_1000771 JGI24033J26618_10007712 305
622 3300003320 rootH2_10007491 rootH2_1000749115 305
623 3300005289 Ga0065704_10090996 Ga0065704_100909962 305
624 3300005289 Ga0065704_10094429 Ga0065704_100944291 305
625 3300005344 Ga0070661_100000373 Ga0070661_10000037315 305
626 3300005366 Ga0070659_100068755 Ga0070659_1000687553 305
627 3300005456 Ga0070678_100019710 Ga0070678_1000197103 305
628 3300009093 Ga0105240_10669087 Ga0105240_106690872 305
629 3300025920 Ga0207649_10000300 Ga0207649_1000030023 305
630 3300026121 Ga0207683_10069070 Ga0207683_100690702 305
631 3300031251 Ga0265327_10000369 Ga0265327_1000036918 305
632 3300031548 Ga0307408_100001048 Ga0307408_10000104813 305
633 3300031901 Ga0307406_10033621 Ga0307406_100336213 305
634 3300031995 Ga0307409_100275315 Ga0307409_1002753151 305
635 3300049574 Ga0501038_0000020 Ga0501038_0000020_60984_61901 305
636 3300049583 Ga0501067_0008141 Ga0501067_0008141_4099_5016 305
637 3300049649 Ga0501198_003622 Ga0501198_003622_450_1394 305
638 3300005937 Ga0081455_10084088 Ga0081455_100840882 306
639 3300005983 Ga0081540_1002865 Ga0081540_10028656 306
640 3300053136 Ga0500559_0016472 Ga0500559_0016472_140_1087 306
641 3300001977 JGI24746J21847_1000041 JGI24746J21847_10000412 307
642 3300005328 Ga0070676_10111574 Ga0070676_101115742 307
643 3300005338 Ga0068868_100351617 Ga0068868_1003516171 307
644 3300005344 Ga0070661_100134585 Ga0070661_1001345851 307
645 3300005459 Ga0068867_100000064 Ga0068867_10000006415 307
646 3300005564 Ga0070664_100001816 Ga0070664_1000018163 307
647 3300006881 Ga0068865_100258204 Ga0068865_1002582042 307
648 3300009098 Ga0105245_10157103 Ga0105245_101571032 307
649 3300009148 Ga0105243_10000088 Ga0105243_1000008846 307
650 3300014745 Ga0157377_10010282 Ga0157377_100102822 307
651 3300014969 Ga0157376_10036778 Ga0157376_100367784 307
652 3300025920 Ga0207649_10006373 Ga0207649_100063733 307
653 3300025927 Ga0207687_10098597 Ga0207687_100985972 307
654 3300025935 Ga0207709_10000270 Ga0207709_1000027016 307
655 3300025938 Ga0207704_10024535 Ga0207704_100245353 307
656 3300025945 Ga0207679_10010509 Ga0207679_100105092 307
657 3300026023 Ga0207677_10376672 Ga0207677_103766721 307
658 3300026089 Ga0207648_10000192 Ga0207648_1000019215 307
659 3300042144 Ga0450889_006008 Ga0450889_006008_204_1130 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

44

103

0.98

PF03466

LysR_substrate

LysR substrate binding domain

127

334

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ab6-assembly1.cif.gz_A regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis 0.9555 91 306
4ab6-assembly1.cif.gz_B regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis 0.9541 92 305
4ab6-assembly1.cif.gz_A regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis 0.9512 91 306
4ab6-assembly1.cif.gz_B regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis 0.9497 92 305
4ab5-assembly1.cif.gz_A regulatory domain structure of nmb2055 (metr) a lysr family regulator from n. meningitidis 0.9379 92 305
ID Description Score Start End Superfamily
af_P0A9F9_160_263_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9713 164 261 3.40.190.10
4ab5B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9668 164 265 3.40.190.10
4ab6B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9528 92 305 3.40.190.10
af_P9WMF5_6_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9453 2 75 1.10.10.10
4ab6B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9439 92 305 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7C5BP07-F1-model_v4 LysR family transcriptional regulator 0.8413 134 294 GO:0000976
GO:0006355
AF-A1B1R1-F1-model_v4 LysR, substrate-binding protein 0.8328 156 292 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A1G1G3G6-F1-model_v4 LysR substrate-binding domain-containing protein 0.832 91 292 GO:0000976
GO:0006355
AF-A0A645EH23-F1-model_v4 HTH-type transcriptional regulator GltC 0.8275 135 292 GO:0003677
GO:0005829
GO:0006355
AF-A0A3T1DZX0-F1-model_v4 deleted 0.8258 134 299

Feature Viewer

pLDDT pTM Quality
93.01 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map