F473278
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 384 | 619 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0000615|Ga0495583_0000615_5004_6038 |
| Length | 344 |
| Sequence | MIIEICMKNSIDYRQSWCIIQTTNFANHVKNIHGVFMGTSILELRHLRTLLALKEAGTISRAAQLLNVTQSALSHQVLALERQYDASLFERKSTPVAFTAAGKRLLELATQVLPLVGSAERDLARMASAGSGKLRIAVECHTCFDWLMPSMDALRERWPEVEQDIVSGFQADPVGLLHQDRAEVAIVSELDETETDMVFHPLFEFEMVAILPLGHPCLAKPWLEAQDFAGQALITYPVPDEMLDLVRQVLRPAGVEPPRRTTELTVGMLQLVASGRGFAALPLWAVNGYLERGYVARQRIGPDGLTARLYAVVPKRLAGSAYLADFVQVMRETSLLALPGIRLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 11 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 12 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 13 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 16 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 17 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 18 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 19 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 20 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 21 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 22 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 23 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 24 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 25 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 26 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 27 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 28 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 29 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 30 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 31 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 32 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 33 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 34 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 35 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 36 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 37 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 38 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 39 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 40 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 41 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 42 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 43 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 44 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 45 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 46 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 47 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 48 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 49 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 50 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 51 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 54 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 55 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 71 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 77 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 202 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 228 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 229 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 230 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 231 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 232 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 233 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 234 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 235 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 236 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 237 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 238 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 239 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 340 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 341 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 368 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 382 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.93 |
| Metatranscriptomes | 0 |
| Isolates | 6.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.31 |
| Nodule | 0.46 |
| Rhizoplane | 3.19 |
| Rhizosphere | 61.15 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 12.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000041 | 3300001977 | Bacteria | 12363 |
| 2 | JGI24743J22301_10000136 | 3300001991 | Bacteria | 7419 |
| 3 | JGI24744J21845_10003694 | 3300002077 | Bacteria | 3154 |
| 4 | JGI24033J26618_1000771 | 3300002155 | Bacteria | 3058 |
| 5 | JGI25155J39150_1000143 | 3300002704 | Bacteria | 33448 |
| 6 | JGI25155J39150_1000590 | 3300002704 | Bacteria | 7904 |
| 7 | JGI25156J39149_1000343 | 3300002705 | Bacteria | 30250 |
| 8 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 9 | JGI25162J39368_1005476 | 3300002737 | Bacteria | 2472 |
| 10 | JGI25154J39366_1000131 | 3300002738 | Bacteria | 58847 |
| 11 | JGI25158J39367_1012712 | 3300002739 | Bacteria | 1107 |
| 12 | JGI25157J39369_1000119 | 3300002741 | Bacteria | 67906 |
| 13 | JGI25151J46595_10000490 | 3300003187 | Bacteria | 37505 |
| 14 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 15 | rootH2_10007491 | 3300003320 | Bacteria | 28148 |
| 16 | rootH2_10025857 | 3300003320 | Bacteria | 6326 |
| 17 | rootH2_10037630 | 3300003320 | Bacteria | 8201 |
| 18 | rootL2_10043086 | 3300003322 | Bacteria | 1542 |
| 19 | rootL2_10047190 | 3300003322 | Bacteria | 7548 |
| 20 | rootL2_10080904 | 3300003322 | Bacteria | 8358 |
| 21 | rootL2_10106273 | 3300003322 | Bacteria | 6522 |
| 22 | rootL2_10122240 | 3300003322 | Bacteria | 1454 |
| 23 | rootH1_10034690 | 3300003323 | Bacteria | 21506 |
| 24 | rootH1_10039626 | 3300003323 | Bacteria | 3145 |
| 25 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 26 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 27 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 28 | Ga0055532_1000023 | 3300003758 | Bacteria | 248212 |
| 29 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 30 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 31 | Ga0055525_1000054 | 3300003759 | Bacteria | 216523 |
| 32 | Ga0055526_1003413 | 3300003771 | Bacteria | 10097 |
| 33 | Ga0055537_1009160 | 3300003773 | Bacteria | 2212 |
| 34 | Ga0055524_1000679 | 3300003775 | Bacteria | 23825 |
| 35 | Ga0055524_1006891 | 3300003775 | Bacteria | 4896 |
| 36 | Ga0055536_1001609 | 3300003781 | Bacteria | 13474 |
| 37 | Ga0055536_1006289 | 3300003781 | Bacteria | 5587 |
| 38 | Ga0055534_1005923 | 3300003784 | Bacteria | 3177 |
| 39 | Ga0055528_1019775 | 3300003790 | Bacteria | 2212 |
| 40 | Ga0055530_10004499 | 3300003791 | Bacteria | 7145 |
| 41 | Ga0055530_10009542 | 3300003791 | Bacteria | 3712 |
| 42 | Ga0055530_10032454 | 3300003791 | Bacteria | 1357 |
| 43 | Ga0055540_1001457 | 3300003792 | Bacteria | 14106 |
| 44 | Ga0055531_10001899 | 3300003794 | Bacteria | 14631 |
| 45 | Ga0055531_10001936 | 3300003794 | Bacteria | 14467 |
| 46 | Ga0055531_10002628 | 3300003794 | Bacteria | 11892 |
| 47 | Ga0055531_10020910 | 3300003794 | Bacteria | 2564 |
| 48 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 49 | Ga0065165_1002636 | 3300005262 | Bacteria | 14580 |
| 50 | Ga0065165_1019645 | 3300005262 | Bacteria | 2403 |
| 51 | Ga0065714_10066376 | 3300005288 | Bacteria | 6980 |
| 52 | Ga0065704_10090996 | 3300005289 | Bacteria | 2748 |
| 53 | Ga0065704_10094429 | 3300005289 | Bacteria | 2544 |
| 54 | Ga0070658_10004378 | 3300005327 | Bacteria | 11522 |
| 55 | Ga0070658_10169039 | 3300005327 | Bacteria | 1836 |
| 56 | Ga0070658_10262022 | 3300005327 | Bacteria | 1468 |
| 57 | Ga0070676_10111574 | 3300005328 | Bacteria | 1703 |
| 58 | Ga0070682_100025307 | 3300005337 | Bacteria | 3540 |
| 59 | Ga0068868_100351617 | 3300005338 | Bacteria | 1262 |
| 60 | Ga0070660_100079160 | 3300005339 | Bacteria | 2578 |
| 61 | Ga0070660_100131323 | 3300005339 | Bacteria | 2004 |
| 62 | Ga0070660_100134192 | 3300005339 | Bacteria | 1983 |
| 63 | Ga0070660_100190023 | 3300005339 | Bacteria | 1663 |
| 64 | Ga0070660_100237986 | 3300005339 | Bacteria | 1482 |
| 65 | Ga0070661_100000229 | 3300005344 | Bacteria | 46608 |
| 66 | Ga0070661_100000373 | 3300005344 | Bacteria | 35211 |
| 67 | Ga0070661_100031869 | 3300005344 | Bacteria | 3813 |
| 68 | Ga0070661_100134585 | 3300005344 | Bacteria | 1858 |
| 69 | Ga0070669_100034642 | 3300005353 | Bacteria | 3656 |
| 70 | Ga0070675_100190216 | 3300005354 | Bacteria | 1778 |
| 71 | Ga0070659_100009239 | 3300005366 | Bacteria | 7237 |
| 72 | Ga0070659_100066688 | 3300005366 | Bacteria | 2852 |
| 73 | Ga0070659_100068755 | 3300005366 | Bacteria | 2810 |
| 74 | Ga0070659_100080779 | 3300005366 | Bacteria | 2596 |
| 75 | Ga0070678_100019710 | 3300005456 | Bacteria | 4406 |
| 76 | Ga0070678_100029629 | 3300005456 | Bacteria | 3750 |
| 77 | Ga0070662_100002684 | 3300005457 | Bacteria | 10977 |
| 78 | Ga0070662_100079348 | 3300005457 | Bacteria | 2441 |
| 79 | Ga0068867_100000064 | 3300005459 | Bacteria | 64233 |
| 80 | Ga0070706_100001200 | 3300005467 | Bacteria | 27738 |
| 81 | Ga0070707_100104898 | 3300005468 | Bacteria | 2740 |
| 82 | Ga0070698_100169300 | 3300005471 | Bacteria | 2126 |
| 83 | Ga0070699_100592095 | 3300005518 | Bacteria | 1011 |
| 84 | Ga0068853_100000007 | 3300005539 | Bacteria | 283307 |
| 85 | Ga0068853_100005209 | 3300005539 | Bacteria | 10168 |
| 86 | Ga0068853_100506555 | 3300005539 | Bacteria | 1140 |
| 87 | Ga0070672_100077579 | 3300005543 | Bacteria | 2657 |
| 88 | Ga0070672_100151134 | 3300005543 | Bacteria | 1921 |
| 89 | Ga0068855_100645865 | 3300005563 | Bacteria | 1137 |
| 90 | Ga0070664_100001816 | 3300005564 | Bacteria | 17110 |
| 91 | Ga0070664_100012848 | 3300005564 | Bacteria | 6812 |
| 92 | Ga0070664_100030868 | 3300005564 | Bacteria | 4473 |
| 93 | Ga0070664_100098306 | 3300005564 | Bacteria | 2542 |
| 94 | Ga0068857_100258442 | 3300005577 | Bacteria | 1598 |
| 95 | Ga0068854_100144357 | 3300005578 | Bacteria | 1829 |
| 96 | Ga0068856_100017064 | 3300005614 | Bacteria | 7038 |
| 97 | Ga0068852_100060439 | 3300005616 | Bacteria | 3289 |
| 98 | Ga0068852_100097177 | 3300005616 | Bacteria | 2649 |
| 99 | Ga0068859_100393324 | 3300005617 | Bacteria | 1482 |
| 100 | Ga0068864_100073320 | 3300005618 | Bacteria | 2985 |
| 101 | Ga0068863_100456188 | 3300005841 | Bacteria | 1255 |
| 102 | Ga0081455_10084088 | 3300005937 | Bacteria | 2598 |
| 103 | Ga0081540_1002865 | 3300005983 | Bacteria | 13951 |
| 104 | Ga0075365_10056844 | 3300006038 | Bacteria | 2602 |
| 105 | Ga0075363_100011468 | 3300006048 | Bacteria | 4245 |
| 106 | Ga0075363_100013972 | 3300006048 | Bacteria | 3909 |
| 107 | Ga0075364_10038210 | 3300006051 | Bacteria | 3110 |
| 108 | Ga0075362_10011997 | 3300006177 | Bacteria | 3427 |
| 109 | Ga0075362_10016984 | 3300006177 | Bacteria | 2991 |
| 110 | Ga0075362_10053506 | 3300006177 | Bacteria | 1812 |
| 111 | Ga0075367_10086726 | 3300006178 | Bacteria | 1900 |
| 112 | Ga0075369_10136294 | 3300006186 | Bacteria | 1118 |
| 113 | Ga0075366_10002070 | 3300006195 | Bacteria | 10179 |
| 114 | Ga0075366_10018190 | 3300006195 | Bacteria | 4056 |
| 115 | Ga0075366_10050009 | 3300006195 | Bacteria | 2481 |
| 116 | Ga0075370_10002404 | 3300006353 | Bacteria | 8667 |
| 117 | Ga0075370_10003046 | 3300006353 | Bacteria | 7899 |
| 118 | Ga0075370_10006846 | 3300006353 | Bacteria | 5765 |
| 119 | Ga0075370_10006950 | 3300006353 | Bacteria | 5736 |
| 120 | Ga0075370_10035598 | 3300006353 | Bacteria | 2794 |
| 121 | Ga0075370_10037374 | 3300006353 | Bacteria | 2730 |
| 122 | Ga0075370_10178506 | 3300006353 | Bacteria | 1249 |
| 123 | Ga0068871_100140675 | 3300006358 | Bacteria | 2052 |
| 124 | Ga0068871_100228440 | 3300006358 | Bacteria | 1615 |
| 125 | Ga0068865_100258204 | 3300006881 | Bacteria | 1378 |
| 126 | Ga0097620_100393291 | 3300006931 | Bacteria | 1482 |
| 127 | Ga0099823_1004429 | 3300006944 | Bacteria | 13727 |
| 128 | Ga0105244_10000775 | 3300009036 | Bacteria | 27296 |
| 129 | Ga0105244_10032662 | 3300009036 | Bacteria | 2752 |
| 130 | Ga0105240_10000309 | 3300009093 | Bacteria | 93964 |
| 131 | Ga0105240_10001031 | 3300009093 | Bacteria | 49544 |
| 132 | Ga0105240_10004684 | 3300009093 | Bacteria | 20684 |
| 133 | Ga0105240_10037144 | 3300009093 | Bacteria | 6260 |
| 134 | Ga0105240_10669087 | 3300009093 | Bacteria | 1136 |
| 135 | Ga0105245_10157103 | 3300009098 | Bacteria | 2155 |
| 136 | Ga0105243_10000088 | 3300009148 | Bacteria | 103915 |
| 137 | Ga0105243_10008623 | 3300009148 | Bacteria | 7820 |
| 138 | Ga0105243_10012543 | 3300009148 | Bacteria | 6409 |
| 139 | Ga0105243_10096423 | 3300009148 | Bacteria | 2446 |
| 140 | Ga0105241_10023068 | 3300009174 | Bacteria | 4613 |
| 141 | Ga0105248_10001682 | 3300009177 | Bacteria | 24633 |
| 142 | Ga0105237_10019363 | 3300009545 | Bacteria | 7029 |
| 143 | Ga0105237_10263516 | 3300009545 | Bacteria | 1726 |
| 144 | Ga0105237_10436498 | 3300009545 | Bacteria | 1315 |
| 145 | Ga0105238_10025233 | 3300009551 | Bacteria | 6058 |
| 146 | Ga0105239_10031152 | 3300010375 | Bacteria | 5868 |
| 147 | Ga0105239_10033461 | 3300010375 | Bacteria | 5645 |
| 148 | Ga0105239_10268419 | 3300010375 | Bacteria | 1919 |
| 149 | Ga0105246_10190782 | 3300011119 | Bacteria | 1586 |
| 150 | Ga0105246_10280588 | 3300011119 | Bacteria | 1336 |
| 151 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 152 | Ga0157373_10000471 | 3300013100 | Bacteria | 31950 |
| 153 | Ga0157370_10000554 | 3300013104 | Bacteria | 46615 |
| 154 | Ga0163162_10148710 | 3300013306 | Bacteria | 2459 |
| 155 | Ga0157372_10470984 | 3300013307 | Bacteria | 1464 |
| 156 | Ga0157372_10740060 | 3300013307 | Bacteria | 1143 |
| 157 | Ga0182008_10026910 | 3300014497 | Bacteria | 2915 |
| 158 | Ga0157377_10010282 | 3300014745 | Bacteria | 4623 |
| 159 | Ga0157376_10036778 | 3300014969 | Bacteria | 3969 |
| 160 | Ga0182006_1001948 | 3300015261 | Bacteria | 11716 |
| 161 | Ga0182006_1012756 | 3300015261 | Bacteria | 3670 |
| 162 | Ga0182007_10001204 | 3300015262 | Bacteria | 14045 |
| 163 | Ga0163161_10019138 | 3300017792 | Bacteria | 4801 |
| 164 | Ga0213872_10000073 | 3300021361 | Bacteria | 91302 |
| 165 | Ga0213872_10024424 | 3300021361 | Bacteria | 2781 |
| 166 | Ga0213875_10001280 | 3300021388 | Bacteria | 16845 |
| 167 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 168 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 169 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 170 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 171 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 172 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 173 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 174 | Ga0209563_100075 | 3300025230 | Bacteria | 216575 |
| 175 | Ga0207427_100467 | 3300025231 | Bacteria | 22139 |
| 176 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 177 | Ga0209437_100208 | 3300025233 | Bacteria | 111481 |
| 178 | Ga0209258_100205 | 3300025242 | Bacteria | 119727 |
| 179 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 180 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 181 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 182 | Ga0209148_1000380 | 3300025254 | Bacteria | 53968 |
| 183 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 184 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 185 | Ga0209233_1015722 | 3300025261 | Bacteria | 2101 |
| 186 | Ga0209455_1002639 | 3300025272 | Bacteria | 6782 |
| 187 | Ga0209676_1000356 | 3300025292 | Bacteria | 86657 |
| 188 | Ga0209676_1010471 | 3300025292 | Bacteria | 3858 |
| 189 | Ga0209050_1000575 | 3300025298 | Bacteria | 59696 |
| 190 | Ga0209050_1001396 | 3300025298 | Bacteria | 26194 |
| 191 | Ga0209050_1001921 | 3300025298 | Bacteria | 19833 |
| 192 | Ga0209050_1006654 | 3300025298 | Bacteria | 6765 |
| 193 | Ga0209256_1001621 | 3300025299 | Bacteria | 21934 |
| 194 | Ga0209256_1002194 | 3300025299 | Bacteria | 16732 |
| 195 | Ga0209051_1000073 | 3300025303 | Bacteria | 208874 |
| 196 | Ga0209051_1001499 | 3300025303 | Bacteria | 19509 |
| 197 | Ga0209051_1005113 | 3300025303 | Bacteria | 7790 |
| 198 | Ga0209051_1010952 | 3300025303 | Bacteria | 4526 |
| 199 | Ga0209051_1025225 | 3300025303 | Bacteria | 2425 |
| 200 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 201 | Ga0209257_1000139 | 3300025304 | Bacteria | 202285 |
| 202 | Ga0209257_1001530 | 3300025304 | Bacteria | 26954 |
| 203 | Ga0209257_1008843 | 3300025304 | Bacteria | 5567 |
| 204 | Ga0209257_1011931 | 3300025304 | Bacteria | 4098 |
| 205 | Ga0209257_1020879 | 3300025304 | Bacteria | 2401 |
| 206 | Ga0207655_1002169 | 3300025728 | Bacteria | 16356 |
| 207 | Ga0207688_10017520 | 3300025901 | Bacteria | 3893 |
| 208 | Ga0207705_10007288 | 3300025909 | Bacteria | 8135 |
| 209 | Ga0207705_10010554 | 3300025909 | Bacteria | 6713 |
| 210 | Ga0207684_10002095 | 3300025910 | Bacteria | 20445 |
| 211 | Ga0207654_10005557 | 3300025911 | Bacteria | 6376 |
| 212 | Ga0207695_10000635 | 3300025913 | Bacteria | 70312 |
| 213 | Ga0207695_10030134 | 3300025913 | Bacteria | 5977 |
| 214 | Ga0207695_10090582 | 3300025913 | Bacteria | 3073 |
| 215 | Ga0207695_10176615 | 3300025913 | Bacteria | 2058 |
| 216 | Ga0207671_10037347 | 3300025914 | Bacteria | 3602 |
| 217 | Ga0207671_10157593 | 3300025914 | Bacteria | 1757 |
| 218 | Ga0207671_10259133 | 3300025914 | Bacteria | 1368 |
| 219 | Ga0207657_10000613 | 3300025919 | Bacteria | 37815 |
| 220 | Ga0207657_10014271 | 3300025919 | Bacteria | 7766 |
| 221 | Ga0207657_10065974 | 3300025919 | Bacteria | 3083 |
| 222 | Ga0207657_10221687 | 3300025919 | Bacteria | 1515 |
| 223 | Ga0207649_10000300 | 3300025920 | Bacteria | 38102 |
| 224 | Ga0207649_10006373 | 3300025920 | Bacteria | 6411 |
| 225 | Ga0207649_10007212 | 3300025920 | Bacteria | 6043 |
| 226 | Ga0207649_10126759 | 3300025920 | Bacteria | 1729 |
| 227 | Ga0207649_10224782 | 3300025920 | Bacteria | 1339 |
| 228 | Ga0207646_10215564 | 3300025922 | Bacteria | 1734 |
| 229 | Ga0207694_10039059 | 3300025924 | Bacteria | 3651 |
| 230 | Ga0207650_10160931 | 3300025925 | Bacteria | 1778 |
| 231 | Ga0207659_10142501 | 3300025926 | Bacteria | 1862 |
| 232 | Ga0207687_10098597 | 3300025927 | Bacteria | 2145 |
| 233 | Ga0207690_10015190 | 3300025932 | Bacteria | 4662 |
| 234 | Ga0207690_10025624 | 3300025932 | Bacteria | 3705 |
| 235 | Ga0207690_10146906 | 3300025932 | Bacteria | 1744 |
| 236 | Ga0207690_10293343 | 3300025932 | Bacteria | 1270 |
| 237 | Ga0207706_10002023 | 3300025933 | Bacteria | 19864 |
| 238 | Ga0207709_10000270 | 3300025935 | Bacteria | 61008 |
| 239 | Ga0207709_10001645 | 3300025935 | Bacteria | 15124 |
| 240 | Ga0207709_10022786 | 3300025935 | Bacteria | 3556 |
| 241 | Ga0207709_10062996 | 3300025935 | Bacteria | 2323 |
| 242 | Ga0207704_10024535 | 3300025938 | Bacteria | 3273 |
| 243 | Ga0207711_10478085 | 3300025941 | Bacteria | 1161 |
| 244 | Ga0207679_10000339 | 3300025945 | Bacteria | 34501 |
| 245 | Ga0207679_10010509 | 3300025945 | Bacteria | 5963 |
| 246 | Ga0207679_10015235 | 3300025945 | Bacteria | 5073 |
| 247 | Ga0207679_10086829 | 3300025945 | Bacteria | 2407 |
| 248 | Ga0207667_10055481 | 3300025949 | Bacteria | 4165 |
| 249 | Ga0207667_10226354 | 3300025949 | Bacteria | 1916 |
| 250 | Ga0207667_10298165 | 3300025949 | Bacteria | 1647 |
| 251 | Ga0207651_10444037 | 3300025960 | Bacteria | 1112 |
| 252 | Ga0207668_10149974 | 3300025972 | Bacteria | 1804 |
| 253 | Ga0207640_10118610 | 3300025981 | Bacteria | 1891 |
| 254 | Ga0207677_10376672 | 3300026023 | Bacteria | 1197 |
| 255 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 256 | Ga0207702_10012461 | 3300026078 | Bacteria | 7077 |
| 257 | Ga0207702_10275279 | 3300026078 | Bacteria | 1589 |
| 258 | Ga0207648_10000192 | 3300026089 | Bacteria | 64301 |
| 259 | Ga0207648_10149923 | 3300026089 | Bacteria | 2057 |
| 260 | Ga0207674_10118585 | 3300026116 | Bacteria | 2616 |
| 261 | Ga0207674_10147538 | 3300026116 | Bacteria | 2310 |
| 262 | Ga0207674_10217362 | 3300026116 | Bacteria | 1859 |
| 263 | Ga0207683_10069070 | 3300026121 | Bacteria | 3120 |
| 264 | Ga0207683_10150787 | 3300026121 | Bacteria | 2098 |
| 265 | Ga0207683_10207547 | 3300026121 | Bacteria | 1782 |
| 266 | Ga0207698_10018339 | 3300026142 | Bacteria | 4766 |
| 267 | Ga0207698_10544940 | 3300026142 | Bacteria | 1136 |
| 268 | Ga0209813_10031496 | 3300027866 | Bacteria | 1566 |
| 269 | Ga0209813_10035726 | 3300027866 | Bacteria | 1489 |
| 270 | Ga0265334_10054267 | 3300028573 | Bacteria | 1528 |
| 271 | Ga0307517_10002278 | 3300028786 | Bacteria | 30957 |
| 272 | Ga0307517_10061642 | 3300028786 | Bacteria | 3544 |
| 273 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 274 | Ga0307515_10037661 | 3300028794 | Bacteria | 7767 |
| 275 | Ga0307515_10124280 | 3300028794 | Bacteria | 2896 |
| 276 | Ga0307515_10125132 | 3300028794 | Bacteria | 2879 |
| 277 | Ga0307515_10173138 | 3300028794 | Bacteria | 2141 |
| 278 | Ga0307515_10332260 | 3300028794 | Bacteria | 1178 |
| 279 | Ga0265330_10000099 | 3300031235 | Bacteria | 72344 |
| 280 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 281 | Ga0265328_10009017 | 3300031239 | Bacteria | 4083 |
| 282 | Ga0265325_10005521 | 3300031241 | Bacteria | 7804 |
| 283 | Ga0265340_10005843 | 3300031247 | Bacteria | 6811 |
| 284 | Ga0265327_10000155 | 3300031251 | Bacteria | 147516 |
| 285 | Ga0265327_10000369 | 3300031251 | Bacteria | 85139 |
| 286 | Ga0307513_10053889 | 3300031456 | Bacteria | 4318 |
| 287 | Ga0307408_100000021 | 3300031548 | Bacteria | 312158 |
| 288 | Ga0307408_100000056 | 3300031548 | Bacteria | 140709 |
| 289 | Ga0307408_100001048 | 3300031548 | Bacteria | 21241 |
| 290 | Ga0307408_100008195 | 3300031548 | Bacteria | 6904 |
| 291 | Ga0307408_100046108 | 3300031548 | Bacteria | 3117 |
| 292 | Ga0307408_100069264 | 3300031548 | Bacteria | 2601 |
| 293 | Ga0307408_100140403 | 3300031548 | Bacteria | 1896 |
| 294 | Ga0307408_100150089 | 3300031548 | Bacteria | 1839 |
| 295 | Ga0307508_10007776 | 3300031616 | Bacteria | 9958 |
| 296 | Ga0307514_10084422 | 3300031649 | Bacteria | 2337 |
| 297 | Ga0265314_10000089 | 3300031711 | Bacteria | 138050 |
| 298 | Ga0307516_10000286 | 3300031730 | Bacteria | 65447 |
| 299 | Ga0307516_10000851 | 3300031730 | Bacteria | 41827 |
| 300 | Ga0307516_10241601 | 3300031730 | Bacteria | 1504 |
| 301 | Ga0307413_10251955 | 3300031824 | Unclassified | 1310 |
| 302 | Ga0307406_10033621 | 3300031901 | Bacteria | 3140 |
| 303 | Ga0307407_10000058 | 3300031903 | Bacteria | 48922 |
| 304 | Ga0307407_10002259 | 3300031903 | Bacteria | 7455 |
| 305 | Ga0307412_10000013 | 3300031911 | Bacteria | 365239 |
| 306 | Ga0307409_100275315 | 3300031995 | Bacteria | 1552 |
| 307 | Ga0307409_100337708 | 3300031995 | Bacteria | 1416 |
| 308 | Ga0307416_100002351 | 3300032002 | Bacteria | 10819 |
| 309 | Ga0307416_100040620 | 3300032002 | Bacteria | 3616 |
| 310 | Ga0307414_10000081 | 3300032004 | Bacteria | 87893 |
| 311 | Ga0307411_10008542 | 3300032005 | Bacteria | 5316 |
| 312 | Ga0307510_10002323 | 3300033180 | Bacteria | 21490 |
| 313 | Ga0307510_10060607 | 3300033180 | Bacteria | 3892 |
| 314 | Ga0373940_0008392 | 3300035088 | Bacteria | 2368 |
| 315 | Ga0373939_0000094 | 3300035114 | Bacteria | 27768 |
| 316 | Ga0373960_0006723 | 3300035121 | Bacteria | 2706 |
| 317 | Ga0373931_0004722 | 3300035691 | Bacteria | 6243 |
| 318 | Ga0395899_0002640 | 3300037312 | Bacteria | 14453 |
| 319 | Ga0395899_0005487 | 3300037312 | Bacteria | 9833 |
| 320 | Ga0395899_0007329 | 3300037312 | Bacteria | 8533 |
| 321 | Ga0395899_0010638 | 3300037312 | Bacteria | 7051 |
| 322 | Ga0395899_0152592 | 3300037312 | Bacteria | 1636 |
| 323 | Ga0395899_0255643 | 3300037312 | Bacteria | 1200 |
| 324 | Ga0395900_0000065 | 3300037418 | Bacteria | 196327 |
| 325 | Ga0395900_0003050 | 3300037418 | Bacteria | 18237 |
| 326 | Ga0395900_0004717 | 3300037418 | Bacteria | 14376 |
| 327 | Ga0395900_0045447 | 3300037418 | Bacteria | 4523 |
| 328 | Ga0395900_0523244 | 3300037418 | Bacteria | 1133 |
| 329 | Ga0395898_0002040 | 3300037466 | Bacteria | 25291 |
| 330 | Ga0395898_0002898 | 3300037466 | Bacteria | 19522 |
| 331 | Ga0395898_0022967 | 3300037466 | Bacteria | 6307 |
| 332 | Ga0395898_0143195 | 3300037466 | Bacteria | 2288 |
| 333 | Ga0395898_0176082 | 3300037466 | Bacteria | 2044 |
| 334 | Ga0395898_0206911 | 3300037466 | Bacteria | 1872 |
| 335 | Ga0395905_0004714 | 3300037471 | Bacteria | 14086 |
| 336 | Ga0395905_0023568 | 3300037471 | Bacteria | 5815 |
| 337 | Ga0395905_0117023 | 3300037471 | Bacteria | 2505 |
| 338 | Ga0395905_0607575 | 3300037471 | Bacteria | 995 |
| 339 | Ga0436364_0828542 | 3300037853 | Bacteria | 18870 |
| 340 | Ga0395901_0000114 | 3300038443 | Bacteria | 109241 |
| 341 | Ga0395901_0001025 | 3300038443 | Bacteria | 30229 |
| 342 | Ga0395901_0046123 | 3300038443 | Bacteria | 4525 |
| 343 | Ga0395901_0260673 | 3300038443 | Bacteria | 1804 |
| 344 | Ga0395901_0263742 | 3300038443 | Bacteria | 1792 |
| 345 | Ga0395901_0387057 | 3300038443 | Bacteria | 1438 |
| 346 | Ga0395901_0625861 | 3300038443 | Bacteria | 1082 |
| 347 | Ga0436361_0033979 | 3300039447 | Bacteria | 2770 |
| 348 | Ga0436361_0736070 | 3300039447 | Bacteria | 84726 |
| 349 | Ga0439465_0035828 | 3300041413 | Bacteria | 1592 |
| 350 | Ga0439448_0021161 | 3300042005 | Bacteria | 2016 |
| 351 | Ga0439450_021970 | 3300042008 | Bacteria | 1374 |
| 352 | Ga0439455_0047424 | 3300042012 | Bacteria | 1115 |
| 353 | Ga0450917_002508 | 3300042120 | Bacteria | 1312 |
| 354 | Ga0450919_003709 | 3300042121 | Bacteria | 1898 |
| 355 | Ga0450888_000898 | 3300042126 | Bacteria | 2835 |
| 356 | Ga0450890_000019 | 3300042127 | Bacteria | 45594 |
| 357 | Ga0450890_001811 | 3300042127 | Bacteria | 3028 |
| 358 | Ga0450891_000115 | 3300042129 | Bacteria | 7156 |
| 359 | Ga0450892_000078 | 3300042130 | Bacteria | 10695 |
| 360 | Ga0450904_000523 | 3300042139 | Bacteria | 7348 |
| 361 | Ga0450889_000177 | 3300042144 | Bacteria | 6853 |
| 362 | Ga0450889_006008 | 3300042144 | Bacteria | 1215 |
| 363 | Ga0450916_002487 | 3300042530 | Bacteria | 1961 |
| 364 | Ga0450918_000283 | 3300042531 | Bacteria | 11490 |
| 365 | Ga0450893_0007158 | 3300042532 | Bacteria | 1811 |
| 366 | Ga0466969_0031618 | 3300044656 | Bacteria | 2693 |
| 367 | Ga0466972_0000111 | 3300044658 | Bacteria | 70764 |
| 368 | Ga0466972_0022353 | 3300044658 | Bacteria | 3150 |
| 369 | Ga0466965_0000099 | 3300044683 | Bacteria | 25415 |
| 370 | Ga0466965_0003561 | 3300044683 | Bacteria | 6844 |
| 371 | Ga0466965_0021808 | 3300044683 | Bacteria | 3086 |
| 372 | Ga0466965_0061910 | 3300044683 | Bacteria | 1871 |
| 373 | Ga0466966_0029352 | 3300044684 | Bacteria | 3579 |
| 374 | Ga0466966_0042881 | 3300044684 | Bacteria | 2901 |
| 375 | Ga0466966_0085868 | 3300044684 | Bacteria | 1956 |
| 376 | Ga0466966_0132965 | 3300044684 | Bacteria | 1522 |
| 377 | Ga0466966_0242868 | 3300044684 | Bacteria | 1085 |
| 378 | Ga0466961_0113827 | 3300044693 | Bacteria | 1701 |
| 379 | Ga0466963_0362719 | 3300044694 | Bacteria | 1021 |
| 380 | Ga0466964_0002257 | 3300044706 | Bacteria | 6828 |
| 381 | Ga0466964_0021297 | 3300044706 | Bacteria | 2506 |
| 382 | Ga0466964_0022851 | 3300044706 | Bacteria | 2429 |
| 383 | Ga0466964_0105194 | 3300044706 | Bacteria | 1250 |
| 384 | Ga0466971_0000034 | 3300044719 | Bacteria | 56431 |
| 385 | Ga0466968_0005833 | 3300044735 | Bacteria | 4622 |
| 386 | Ga0466968_0025800 | 3300044735 | Bacteria | 2408 |
| 387 | Ga0466957_0000005 | 3300044842 | Bacteria | 102026 |
| 388 | Ga0466957_0001421 | 3300044842 | Bacteria | 12501 |
| 389 | Ga0466957_0018582 | 3300044842 | Bacteria | 4083 |
| 390 | Ga0466960_0022813 | 3300044901 | Bacteria | 2802 |
| 391 | Ga0466959_0010269 | 3300045049 | Bacteria | 6685 |
| 392 | Ga0466959_0032593 | 3300045049 | Bacteria | 3857 |
| 393 | Ga0466959_0038048 | 3300045049 | Bacteria | 3555 |
| 394 | Ga0466959_0042038 | 3300045049 | Bacteria | 3372 |
| 395 | Ga0466959_0292090 | 3300045049 | Bacteria | 1117 |
| 396 | Ga0451576_0085449 | 3300045051 | Bacteria | 3282 |
| 397 | Ga0466958_0256454 | 3300045836 | Bacteria | 1119 |
| 398 | Ga0466967_0017561 | 3300045976 | Bacteria | 5686 |
| 399 | Ga0466967_0512093 | 3300045976 | Bacteria | 1178 |
| 400 | Ga0495592_0024776 | 3300046454 | Bacteria | 4560 |
| 401 | Ga0495590_0102322 | 3300046457 | Bacteria | 1018 |
| 402 | Ga0495638_0028052 | 3300046460 | Bacteria | 3638 |
| 403 | Ga0495638_0101917 | 3300046460 | Bacteria | 1716 |
| 404 | Ga0495638_0121984 | 3300046460 | Bacteria | 1539 |
| 405 | Ga0495651_0002661 | 3300046462 | Bacteria | 13859 |
| 406 | Ga0495653_0018797 | 3300046463 | Bacteria | 5607 |
| 407 | Ga0495605_0001024 | 3300046474 | Bacteria | 18810 |
| 408 | Ga0495605_0041691 | 3300046474 | Bacteria | 2285 |
| 409 | Ga0495584_0002172 | 3300046491 | Bacteria | 11186 |
| 410 | Ga0495584_0024023 | 3300046491 | Bacteria | 3090 |
| 411 | Ga0495607_0000277 | 3300046501 | Bacteria | 55227 |
| 412 | Ga0495607_0001095 | 3300046501 | Bacteria | 24709 |
| 413 | Ga0495607_0013475 | 3300046501 | Bacteria | 5356 |
| 414 | Ga0495583_0000615 | 3300046506 | Bacteria | 48092 |
| 415 | Ga0495606_0011604 | 3300046507 | Bacteria | 7164 |
| 416 | Ga0495606_0021455 | 3300046507 | Bacteria | 4730 |
| 417 | Ga0495608_0020340 | 3300046511 | Bacteria | 4561 |
| 418 | Ga0495610_0020577 | 3300046512 | Bacteria | 3661 |
| 419 | Ga0495616_0000042 | 3300046513 | Bacteria | 120923 |
| 420 | Ga0495616_0001007 | 3300046513 | Bacteria | 20154 |
| 421 | Ga0495616_0001176 | 3300046513 | Bacteria | 18470 |
| 422 | Ga0495616_0027695 | 3300046513 | Bacteria | 3005 |
| 423 | Ga0495616_0035184 | 3300046513 | Bacteria | 2594 |
| 424 | Ga0495618_0006093 | 3300046514 | Bacteria | 7314 |
| 425 | Ga0495618_0281972 | 3300046514 | Bacteria | 1036 |
| 426 | Ga0495620_0065747 | 3300046515 | Bacteria | 1496 |
| 427 | Ga0495628_0000835 | 3300046516 | Bacteria | 28571 |
| 428 | Ga0495628_0153713 | 3300046516 | Bacteria | 1752 |
| 429 | Ga0495630_0324009 | 3300046517 | Bacteria | 1178 |
| 430 | Ga0495631_0000455 | 3300046518 | Bacteria | 27845 |
| 431 | Ga0495631_0052125 | 3300046518 | Bacteria | 1787 |
| 432 | Ga0495632_0015495 | 3300046519 | Bacteria | 4270 |
| 433 | Ga0495637_0006307 | 3300046520 | Bacteria | 5967 |
| 434 | Ga0495643_0000653 | 3300046522 | Bacteria | 41007 |
| 435 | Ga0495643_0001662 | 3300046522 | Bacteria | 19523 |
| 436 | Ga0495648_0002371 | 3300046524 | Bacteria | 17495 |
| 437 | Ga0495663_0011864 | 3300046525 | Bacteria | 2428 |
| 438 | Ga0495642_0000489 | 3300046528 | Bacteria | 20282 |
| 439 | Ga0495642_0021790 | 3300046528 | Bacteria | 2522 |
| 440 | Ga0495652_0034009 | 3300046529 | Bacteria | 4445 |
| 441 | Ga0495654_0010940 | 3300046530 | Bacteria | 4930 |
| 442 | Ga0495654_0014623 | 3300046530 | Bacteria | 4174 |
| 443 | Ga0495598_0078168 | 3300046537 | Bacteria | 1056 |
| 444 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 445 | Ga0495621_0010300 | 3300046539 | Bacteria | 2854 |
| 446 | Ga0495621_0022926 | 3300046539 | Bacteria | 2074 |
| 447 | Ga0495597_0053466 | 3300046542 | Bacteria | 1776 |
| 448 | Ga0495645_0027501 | 3300046543 | Bacteria | 4133 |
| 449 | Ga0495656_0110589 | 3300046615 | Bacteria | 1284 |
| 450 | Ga0495668_0240592 | 3300046616 | Bacteria | 991 |
| 451 | Ga0495625_0008989 | 3300046660 | Bacteria | 8436 |
| 452 | Ga0495661_0000063 | 3300046665 | Bacteria | 129706 |
| 453 | Ga0495661_0003232 | 3300046665 | Bacteria | 12150 |
| 454 | Ga0495661_0022025 | 3300046665 | Bacteria | 4146 |
| 455 | Ga0495661_0109954 | 3300046665 | Bacteria | 1537 |
| 456 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 457 | Ga0495588_0094264 | 3300046674 | Bacteria | 1569 |
| 458 | Ga0495657_0045934 | 3300046675 | Bacteria | 2961 |
| 459 | Ga0495599_0002461 | 3300046678 | Bacteria | 10790 |
| 460 | Ga0495623_0011084 | 3300046679 | Bacteria | 5834 |
| 461 | Ga0495624_0078484 | 3300046690 | Bacteria | 2047 |
| 462 | Ga0495670_0084768 | 3300046691 | Bacteria | 1617 |
| 463 | Ga0495649_0000935 | 3300046694 | Bacteria | 23072 |
| 464 | Ga0495589_0000015 | 3300046794 | Bacteria | 224112 |
| 465 | Ga0495589_0000116 | 3300046794 | Bacteria | 75640 |
| 466 | Ga0495600_0012302 | 3300046809 | Bacteria | 5347 |
| 467 | Ga0495660_0000145 | 3300046810 | Bacteria | 76912 |
| 468 | Ga0495660_0028390 | 3300046810 | Bacteria | 3161 |
| 469 | Ga0495660_0041635 | 3300046810 | Bacteria | 2541 |
| 470 | Ga0495672_0008763 | 3300047320 | Bacteria | 7414 |
| 471 | Ga0495683_0019759 | 3300047323 | Bacteria | 3475 |
| 472 | Ga0495683_0028718 | 3300047323 | Bacteria | 2843 |
| 473 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 474 | Ga0495687_000073 | 3300047443 | Bacteria | 155429 |
| 475 | Ga0495687_000153 | 3300047443 | Bacteria | 105215 |
| 476 | Ga0495687_000891 | 3300047443 | Bacteria | 31449 |
| 477 | Ga0495687_008007 | 3300047443 | Bacteria | 6118 |
| 478 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 479 | Ga0495677_0000215 | 3300047445 | Bacteria | 26322 |
| 480 | Ga0495686_0000190 | 3300047472 | Bacteria | 115114 |
| 481 | Ga0495686_0057965 | 3300047472 | Bacteria | 2416 |
| 482 | Ga0495593_0022644 | 3300047673 | Bacteria | 3498 |
| 483 | Ga0495602_0082414 | 3300048088 | Bacteria | 2699 |
| 484 | Ga0495602_0240335 | 3300048088 | Bacteria | 1355 |
| 485 | Ga0495626_0000128 | 3300048091 | Bacteria | 96772 |
| 486 | Ga0495626_0000171 | 3300048091 | Bacteria | 80200 |
| 487 | Ga0495626_0004823 | 3300048091 | Bacteria | 8131 |
| 488 | Ga0495626_0046048 | 3300048091 | Bacteria | 2033 |
| 489 | Ga0495626_0101201 | 3300048091 | Bacteria | 1256 |
| 490 | Ga0496100_0159660 | 3300048903 | Bacteria | 1615 |
| 491 | Ga0496100_0230432 | 3300048903 | Bacteria | 1363 |
| 492 | Ga0496101_0027041 | 3300048904 | Bacteria | 3991 |
| 493 | Ga0496102_0013533 | 3300048905 | Bacteria | 7069 |
| 494 | Ga0496102_0179741 | 3300048905 | Bacteria | 1993 |
| 495 | Ga0496102_0279371 | 3300048905 | Bacteria | 1574 |
| 496 | Ga0496102_0489560 | 3300048905 | Bacteria | 1151 |
| 497 | Ga0496103_0046056 | 3300048906 | Bacteria | 2692 |
| 498 | Ga0496103_0202074 | 3300048906 | Bacteria | 1278 |
| 499 | Ga0496104_0212165 | 3300048907 | Bacteria | 1848 |
| 500 | Ga0496105_0190750 | 3300048908 | Bacteria | 1676 |
| 501 | Ga0496105_0357860 | 3300048908 | Bacteria | 1165 |
| 502 | Ga0496106_0037494 | 3300048909 | Bacteria | 3626 |
| 503 | Ga0496107_0180295 | 3300048910 | Bacteria | 1568 |
| 504 | Ga0496107_0379934 | 3300048910 | Bacteria | 1051 |
| 505 | Ga0496109_0266393 | 3300048912 | Bacteria | 1614 |
| 506 | Ga0496112_0206997 | 3300048915 | Bacteria | 1919 |
| 507 | Ga0496113_0011778 | 3300048916 | Bacteria | 5856 |
| 508 | Ga0496113_0193613 | 3300048916 | Bacteria | 1614 |
| 509 | Ga0496114_0085489 | 3300048917 | Bacteria | 2672 |
| 510 | Ga0496115_0217780 | 3300048918 | Bacteria | 1576 |
| 511 | Ga0496116_0006493 | 3300048919 | Bacteria | 10598 |
| 512 | Ga0496118_0010168 | 3300048921 | Bacteria | 9347 |
| 513 | Ga0496118_0032872 | 3300048921 | Bacteria | 4264 |
| 514 | Ga0496118_0137124 | 3300048921 | Bacteria | 1559 |
| 515 | Ga0496121_0034335 | 3300048924 | Bacteria | 4567 |
| 516 | Ga0496121_0046374 | 3300048924 | Bacteria | 3721 |
| 517 | Ga0496121_0051934 | 3300048924 | Bacteria | 3448 |
| 518 | Ga0496121_0306419 | 3300048924 | Bacteria | 1075 |
| 519 | Ga0496122_0001249 | 3300048925 | Bacteria | 42658 |
| 520 | Ga0496122_0008199 | 3300048925 | Bacteria | 11351 |
| 521 | Ga0496122_0032516 | 3300048925 | Bacteria | 4312 |
| 522 | Ga0496122_0123119 | 3300048925 | Bacteria | 1667 |
| 523 | Ga0496123_0002055 | 3300048926 | Bacteria | 25979 |
| 524 | Ga0496123_0014620 | 3300048926 | Bacteria | 6489 |
| 525 | Ga0496124_0004031 | 3300048927 | Bacteria | 17468 |
| 526 | Ga0496124_0032358 | 3300048927 | Bacteria | 4618 |
| 527 | Ga0496124_0062916 | 3300048927 | Bacteria | 3103 |
| 528 | Ga0496124_0089369 | 3300048927 | Bacteria | 2515 |
| 529 | Ga0496124_0113566 | 3300048927 | Bacteria | 2176 |
| 530 | Ga0496125_0000794 | 3300048928 | Bacteria | 51484 |
| 531 | Ga0496125_0007526 | 3300048928 | Bacteria | 11575 |
| 532 | Ga0496125_0101879 | 3300048928 | Bacteria | 2111 |
| 533 | Ga0496126_0079290 | 3300048929 | Bacteria | 2907 |
| 534 | Ga0501031_0000399 | 3300049568 | Bacteria | 25380 |
| 535 | Ga0501032_0113565 | 3300049569 | Bacteria | 1792 |
| 536 | Ga0501033_0000049 | 3300049570 | Bacteria | 114610 |
| 537 | Ga0501037_0035999 | 3300049573 | Bacteria | 3649 |
| 538 | Ga0501038_0000020 | 3300049574 | Bacteria | 152738 |
| 539 | Ga0501038_0000965 | 3300049574 | Bacteria | 25774 |
| 540 | Ga0501039_0002616 | 3300049575 | Bacteria | 13436 |
| 541 | Ga0501043_0003333 | 3300049579 | Bacteria | 13230 |
| 542 | Ga0501043_0006588 | 3300049579 | Bacteria | 9307 |
| 543 | Ga0501047_0008774 | 3300049581 | Bacteria | 9540 |
| 544 | Ga0501067_0008141 | 3300049583 | Bacteria | 5824 |
| 545 | Ga0501070_0001605 | 3300049586 | Bacteria | 20058 |
| 546 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 547 | Ga0501198_003622 | 3300049649 | Bacteria | 2118 |
| 548 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 549 | Ga0501227_000022 | 3300049665 | Bacteria | 23482 |
| 550 | Ga0501259_008398 | 3300049688 | Bacteria | 1662 |
| 551 | Ga0501080_0030133 | 3300049742 | Bacteria | 5055 |
| 552 | Ga0501083_0008427 | 3300049744 | Bacteria | 7286 |
| 553 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 554 | Ga0501035_0001329 | 3300049822 | Bacteria | 25521 |
| 555 | Ga0501044_0241917 | 3300049823 | Bacteria | 1748 |
| 556 | Ga0501044_0258980 | 3300049823 | Bacteria | 1678 |
| 557 | Ga0501044_0369845 | 3300049823 | Bacteria | 1350 |
| 558 | nmdc:mga03683_12920_c1 | 3300050489 | Bacteria | 3061 |
| 559 | nmdc:mga03683_29706_c1 | 3300050489 | Bacteria | 2181 |
| 560 | nmdc:mga03n38_33173_c1 | 3300050490 | Bacteria | 2194 |
| 561 | nmdc:mga03n38_9886_c1 | 3300050490 | Bacteria | 3487 |
| 562 | nmdc:mga00v17_139792_c1 | 3300050491 | Bacteria | 1552 |
| 563 | nmdc:mga0yw44_163821_c1 | 3300050492 | Bacteria | 1457 |
| 564 | nmdc:mga0k408_10625_c1 | 3300050493 | Bacteria | 4984 |
| 565 | nmdc:mga0k408_11990_c1 | 3300050493 | Bacteria | 4730 |
| 566 | nmdc:mga0k408_153878_c1 | 3300050493 | Bacteria | 1370 |
| 567 | nmdc:mga06z11_25937_c1 | 3300050494 | Bacteria | 2784 |
| 568 | nmdc:mga04h51_1034_c1 | 3300050495 | Bacteria | 6406 |
| 569 | nmdc:mga07m45_1806_c2 | 3300050496 | Bacteria | 8273 |
| 570 | nmdc:mga07m45_19621_c1 | 3300050496 | Bacteria | 3665 |
| 571 | nmdc:mga07m45_29115_c1 | 3300050496 | Bacteria | 3052 |
| 572 | nmdc:mga07m45_38424_c1 | 3300050496 | Bacteria | 2671 |
| 573 | nmdc:mga07m45_3842_c1 | 3300050496 | Bacteria | 7278 |
| 574 | nmdc:mga07m45_60316_c1 | 3300050496 | Bacteria | 2147 |
| 575 | nmdc:mga07m45_613_c1 | 3300050496 | Bacteria | 15202 |
| 576 | nmdc:mga07m45_83645_c1 | 3300050496 | Bacteria | 1824 |
| 577 | nmdc:mga07m45_94998_c1 | 3300050496 | Bacteria | 1710 |
| 578 | nmdc:mga0sz30_54670_c1 | 3300050516 | Bacteria | 1698 |
| 579 | nmdc:mga0sz30_77545_c1 | 3300050516 | Bacteria | 1435 |
| 580 | Ga0495601_0022375 | 3300053077 | Bacteria | 3879 |
| 581 | Ga0500610_0054751 | 3300053079 | Bacteria | 2080 |
| 582 | Ga0500578_0000002 | 3300053086 | Bacteria | 293507 |
| 583 | Ga0500643_004274 | 3300053087 | Bacteria | 6532 |
| 584 | Ga0500651_0000052 | 3300053093 | Bacteria | 76301 |
| 585 | Ga0500651_0037223 | 3300053093 | Bacteria | 3065 |
| 586 | Ga0500650_0067886 | 3300053098 | Bacteria | 1666 |
| 587 | Ga0500571_000036 | 3300053110 | Bacteria | 42725 |
| 588 | Ga0500594_0001512 | 3300053118 | Bacteria | 5052 |
| 589 | Ga0500594_0002464 | 3300053118 | Bacteria | 4026 |
| 590 | Ga0500595_000547 | 3300053119 | Bacteria | 22560 |
| 591 | Ga0500618_001812 | 3300053125 | Bacteria | 8960 |
| 592 | Ga0500618_002516 | 3300053125 | Bacteria | 6840 |
| 593 | Ga0500626_016230 | 3300053128 | Bacteria | 3256 |
| 594 | Ga0500652_013230 | 3300053131 | Bacteria | 2917 |
| 595 | Ga0500655_000491 | 3300053133 | Bacteria | 7989 |
| 596 | Ga0500655_003558 | 3300053133 | Bacteria | 2810 |
| 597 | Ga0500658_0000033 | 3300053134 | Bacteria | 89738 |
| 598 | Ga0500658_0000040 | 3300053134 | Bacteria | 79293 |
| 599 | Ga0500658_0046925 | 3300053134 | Bacteria | 1751 |
| 600 | Ga0500559_0000122 | 3300053136 | Bacteria | 60264 |
| 601 | Ga0500559_0001672 | 3300053136 | Bacteria | 12246 |
| 602 | Ga0500559_0016472 | 3300053136 | Bacteria | 3121 |
| 603 | Ga0500561_0005762 | 3300053137 | Bacteria | 2325 |
| 604 | Ga0500568_0003399 | 3300053139 | Bacteria | 8894 |
| 605 | Ga0500568_0006960 | 3300053139 | Bacteria | 5606 |
| 606 | Ga0500568_0019381 | 3300053139 | Bacteria | 2958 |
| 607 | Ga0500574_000340 | 3300053141 | Bacteria | 5781 |
| 608 | Ga0500604_0020974 | 3300053151 | Bacteria | 1843 |
| 609 | Ga0500616_0009982 | 3300053153 | Bacteria | 5710 |
| 610 | Ga0500622_0000651 | 3300053156 | Bacteria | 30947 |
| 611 | Ga0500627_0115682 | 3300053158 | Bacteria | 1208 |
| 612 | Ga0500627_0115771 | 3300053158 | Unclassified | 1208 |
| 613 | Ga0500634_0002930 | 3300053161 | Bacteria | 7422 |
| 614 | Ga0500634_0053150 | 3300053161 | Bacteria | 2174 |
| 615 | Ga0500638_010860 | 3300053162 | Bacteria | 4011 |
| 616 | Ga0500645_015567 | 3300053730 | Bacteria | 2408 |
| 617 | Ga0500656_004046 | 3300053732 | Bacteria | 1401 |
| 618 | Ga0500587_001706 | 3300053739 | Bacteria | 3125 |
| 619 | Ga0466962_0000059 | 3300061719 | Bacteria | 44944 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050516 | nmdc:mga0sz30_77545_c1 | nmdc:mga0sz30_77545_c1_685_1425 | 246 |
| 2 | 3300048091 | Ga0495626_0101201 | Ga0495626_0101201_419_1237 | 255 |
| 3 | 3300026121 | Ga0207683_10150787 | Ga0207683_101507872 | 256 |
| 4 | 3300053730 | Ga0500645_015567 | Ga0500645_015567_80_886 | 268 |
| 5 | 3300006353 | Ga0075370_10037374 | Ga0075370_100373742 | 273 |
| 6 | 3300050496 | nmdc:mga07m45_60316_c1 | nmdc:mga07m45_60316_c1_112_1038 | 273 |
| 7 | 3300046516 | Ga0495628_0153713 | Ga0495628_0153713_897_1733 | 275 |
| 8 | 3300003794 | Ga0055531_10002628 | Ga0055531_100026286 | 277 |
| 9 | 3300025298 | Ga0209050_1006654 | Ga0209050_10066545 | 277 |
| 10 | 3300025304 | Ga0209257_1000049 | Ga0209257_100004931 | 277 |
| 11 | 3300031548 | Ga0307408_100046108 | Ga0307408_1000461082 | 277 |
| 12 | 3300031995 | Ga0307409_100337708 | Ga0307409_1003377082 | 277 |
| 13 | 3300025932 | Ga0207690_10146906 | Ga0207690_101469061 | 278 |
| 14 | 3300006195 | Ga0075366_10002070 | Ga0075366_100020702 | 279 |
| 15 | 3300050493 | nmdc:mga0k408_11990_c1 | nmdc:mga0k408_11990_c1_1308_2249 | 279 |
| 16 | iso_pu_bacteria | 2547132103 | 2547372252 | 280 |
| 17 | 3300038443 | Ga0395901_0260673 | Ga0395901_0260673_21_893 | 283 |
| 18 | 3300045836 | Ga0466958_0256454 | Ga0466958_0256454_17_889 | 283 |
| 19 | 3300005337 | Ga0070682_100025307 | Ga0070682_1000253072 | 284 |
| 20 | 3300025304 | Ga0209257_1020879 | Ga0209257_10208794 | 284 |
| 21 | 3300025925 | Ga0207650_10160931 | Ga0207650_101609311 | 284 |
| 22 | 3300005456 | Ga0070678_100029629 | Ga0070678_1000296292 | 286 |
| 23 | 3300005543 | Ga0070672_100151134 | Ga0070672_1001511341 | 286 |
| 24 | 3300025960 | Ga0207651_10444037 | Ga0207651_104440371 | 286 |
| 25 | 3300028794 | Ga0307515_10037661 | Ga0307515_100376611 | 286 |
| 26 | 3300006195 | Ga0075366_10018190 | Ga0075366_100181902 | 287 |
| 27 | 3300047443 | Ga0495687_000153 | Ga0495687_000153_38404_39327 | 287 |
| 28 | 3300006353 | Ga0075370_10006950 | Ga0075370_100069504 | 288 |
| 29 | 3300046507 | Ga0495606_0021455 | Ga0495606_0021455_1317_2237 | 288 |
| 30 | 3300003322 | rootL2_10080904 | rootL2_100809042 | 289 |
| 31 | 3300006353 | Ga0075370_10035598 | Ga0075370_100355983 | 289 |
| 32 | 3300009148 | Ga0105243_10008623 | Ga0105243_100086232 | 289 |
| 33 | 3300025935 | Ga0207709_10022786 | Ga0207709_100227862 | 289 |
| 34 | 3300028794 | Ga0307515_10125132 | Ga0307515_101251322 | 289 |
| 35 | 3300035088 | Ga0373940_0008392 | Ga0373940_0008392_1374_2297 | 289 |
| 36 | 3300035114 | Ga0373939_0000094 | Ga0373939_0000094_26406_27329 | 289 |
| 37 | 3300035121 | Ga0373960_0006723 | Ga0373960_0006723_1019_1942 | 289 |
| 38 | 3300035691 | Ga0373931_0004722 | Ga0373931_0004722_2040_2963 | 289 |
| 39 | 3300003322 | rootL2_10122240 | rootL2_101222401 | 290 |
| 40 | 3300006195 | Ga0075366_10050009 | Ga0075366_100500092 | 290 |
| 41 | 3300006353 | Ga0075370_10178506 | Ga0075370_101785062 | 290 |
| 42 | 3300031548 | Ga0307408_100000056 | Ga0307408_10000005695 | 290 |
| 43 | 3300042120 | Ga0450917_002508 | Ga0450917_002508_73_996 | 290 |
| 44 | 3300042126 | Ga0450888_000898 | Ga0450888_000898_1049_1972 | 290 |
| 45 | 3300042127 | Ga0450890_001811 | Ga0450890_001811_1061_1984 | 290 |
| 46 | 3300042129 | Ga0450891_000115 | Ga0450891_000115_5041_5964 | 290 |
| 47 | 3300042144 | Ga0450889_000177 | Ga0450889_000177_922_1845 | 290 |
| 48 | 3300042530 | Ga0450916_002487 | Ga0450916_002487_232_1155 | 290 |
| 49 | 3300050496 | nmdc:mga07m45_19621_c1 | nmdc:mga07m45_19621_c1_1160_2083 | 290 |
| 50 | 3300050496 | nmdc:mga07m45_83645_c1 | nmdc:mga07m45_83645_c1_584_1507 | 290 |
| 51 | iso_pu_bacteria | 2894023352 | 2894025860 | 290 |
| 52 | iso_pu_bacteria | 2713897090 | 2715501197 | 291 |
| 53 | iso_pu_bacteria | 2855020534 | 2855022040 | 291 |
| 54 | 3300003759 | Ga0055525_1000054 | Ga0055525_100005442 | 292 |
| 55 | 3300025230 | Ga0209563_100075 | Ga0209563_100075154 | 292 |
| 56 | 3300049573 | Ga0501037_0035999 | Ga0501037_0035999_59_958 | 292 |
| 57 | 3300053134 | Ga0500658_0046925 | Ga0500658_0046925_681_1580 | 292 |
| 58 | 3300053158 | Ga0500627_0115771 | Ga0500627_0115771_194_1093 | 292 |
| 59 | 3300053732 | Ga0500656_004046 | Ga0500656_004046_254_1153 | 292 |
| 60 | iso_pu_bacteria | 2919497567 | 2919497905 | 294 |
| 61 | 3300049688 | Ga0501259_008398 | Ga0501259_008398_14_901 | 295 |
| 62 | 3300021361 | Ga0213872_10000073 | Ga0213872_1000007353 | 296 |
| 63 | 3300039447 | Ga0436361_0736070 | Ga0436361_0736070_36124_37047 | 296 |
| 64 | 3300044683 | Ga0466965_0021808 | Ga0466965_0021808_1300_2190 | 296 |
| 65 | 3300049570 | Ga0501033_0000049 | Ga0501033_0000049_96525_97415 | 296 |
| 66 | 3300049574 | Ga0501038_0000965 | Ga0501038_0000965_12812_13702 | 296 |
| 67 | 3300046517 | Ga0495630_0324009 | Ga0495630_0324009_25_939 | 297 |
| 68 | 3300005288 | Ga0065714_10066376 | Ga0065714_100663763 | 298 |
| 69 | 3300025261 | Ga0209233_1015722 | Ga0209233_10157222 | 298 |
| 70 | iso_pu_bacteria | 2511231003 | 2511250802 | 299 |
| 71 | iso_pu_bacteria | 2818991436 | 2819540611 | 299 |
| 72 | iso_pu_bacteria | 2818991445 | 2819591637 | 299 |
| 73 | 3300002704 | JGI25155J39150_1000143 | JGI25155J39150_10001433 | 300 |
| 74 | 3300002704 | JGI25155J39150_1000590 | JGI25155J39150_10005901 | 300 |
| 75 | 3300002705 | JGI25156J39149_1000343 | JGI25156J39149_100034322 | 300 |
| 76 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001602 | 300 |
| 77 | 3300002737 | JGI25162J39368_1005476 | JGI25162J39368_10054762 | 300 |
| 78 | 3300002738 | JGI25154J39366_1000131 | JGI25154J39366_10001316 | 300 |
| 79 | 3300002741 | JGI25157J39369_1000119 | JGI25157J39369_100011943 | 300 |
| 80 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001587 | 300 |
| 81 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001447 | 300 |
| 82 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001447 | 300 |
| 83 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003587 | 300 |
| 84 | 3300003758 | Ga0055532_1000023 | Ga0055532_1000023156 | 300 |
| 85 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003587 | 300 |
| 86 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001587 | 300 |
| 87 | 3300005339 | Ga0070660_100134192 | Ga0070660_1001341922 | 300 |
| 88 | 3300005344 | Ga0070661_100031869 | Ga0070661_1000318692 | 300 |
| 89 | 3300005366 | Ga0070659_100066688 | Ga0070659_1000666883 | 300 |
| 90 | 3300005564 | Ga0070664_100098306 | Ga0070664_1000983062 | 300 |
| 91 | 3300005616 | Ga0068852_100060439 | Ga0068852_1000604392 | 300 |
| 92 | 3300009093 | Ga0105240_10001031 | Ga0105240_100010313 | 300 |
| 93 | 3300009093 | Ga0105240_10004684 | Ga0105240_100046842 | 300 |
| 94 | 3300009551 | Ga0105238_10025233 | Ga0105238_100252333 | 300 |
| 95 | 3300010375 | Ga0105239_10268419 | Ga0105239_102684192 | 300 |
| 96 | 3300014497 | Ga0182008_10026910 | Ga0182008_100269102 | 300 |
| 97 | 3300015261 | Ga0182006_1012756 | Ga0182006_10127563 | 300 |
| 98 | 3300025206 | Ga0209435_100013 | Ga0209435_100013272 | 300 |
| 99 | 3300025224 | Ga0209784_100004 | Ga0209784_100004582 | 300 |
| 100 | 3300025225 | Ga0209566_100004 | Ga0209566_100004739 | 300 |
| 101 | 3300025226 | Ga0209674_100006 | Ga0209674_100006739 | 300 |
| 102 | 3300025229 | Ga0209147_100030 | Ga0209147_10003084 | 300 |
| 103 | 3300025230 | Ga0209563_100009 | Ga0209563_100009582 | 300 |
| 104 | 3300025231 | Ga0207427_100467 | Ga0207427_1004673 | 300 |
| 105 | 3300025233 | Ga0209437_100004 | Ga0209437_100004582 | 300 |
| 106 | 3300025233 | Ga0209437_100208 | Ga0209437_10020820 | 300 |
| 107 | 3300025242 | Ga0209258_100205 | Ga0209258_10020584 | 300 |
| 108 | 3300025246 | Ga0209646_1000034 | Ga0209646_1000034272 | 300 |
| 109 | 3300025250 | Ga0209026_1000022 | Ga0209026_1000022272 | 300 |
| 110 | 3300025253 | Ga0209677_100005 | Ga0209677_100005582 | 300 |
| 111 | 3300025256 | Ga0209759_1000018 | Ga0209759_1000018272 | 300 |
| 112 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005739 | 300 |
| 113 | 3300025272 | Ga0209455_1002639 | Ga0209455_10026393 | 300 |
| 114 | 3300025913 | Ga0207695_10030134 | Ga0207695_100301343 | 300 |
| 115 | 3300025913 | Ga0207695_10090582 | Ga0207695_100905822 | 300 |
| 116 | 3300025919 | Ga0207657_10065974 | Ga0207657_100659743 | 300 |
| 117 | 3300025924 | Ga0207694_10039059 | Ga0207694_100390592 | 300 |
| 118 | 3300044658 | Ga0466972_0000111 | Ga0466972_0000111_32982_33902 | 300 |
| 119 | 3300044658 | Ga0466972_0022353 | Ga0466972_0022353_1730_2650 | 300 |
| 120 | 3300044683 | Ga0466965_0000099 | Ga0466965_0000099_18716_19636 | 300 |
| 121 | 3300044684 | Ga0466966_0042881 | Ga0466966_0042881_1457_2395 | 300 |
| 122 | 3300044693 | Ga0466961_0113827 | Ga0466961_0113827_86_1024 | 300 |
| 123 | 3300044706 | Ga0466964_0022851 | Ga0466964_0022851_459_1397 | 300 |
| 124 | 3300044706 | Ga0466964_0105194 | Ga0466964_0105194_238_1158 | 300 |
| 125 | 3300044735 | Ga0466968_0025800 | Ga0466968_0025800_1421_2341 | 300 |
| 126 | 3300044842 | Ga0466957_0000005 | Ga0466957_0000005_78327_79265 | 300 |
| 127 | 3300045049 | Ga0466959_0032593 | Ga0466959_0032593_1235_2173 | 300 |
| 128 | 3300046454 | Ga0495592_0024776 | Ga0495592_0024776_1289_2209 | 300 |
| 129 | 3300046462 | Ga0495651_0002661 | Ga0495651_0002661_6425_7345 | 300 |
| 130 | 3300046463 | Ga0495653_0018797 | Ga0495653_0018797_2587_3507 | 300 |
| 131 | 3300046511 | Ga0495608_0020340 | Ga0495608_0020340_624_1544 | 300 |
| 132 | 3300046514 | Ga0495618_0006093 | Ga0495618_0006093_4602_5522 | 300 |
| 133 | 3300046514 | Ga0495618_0281972 | Ga0495618_0281972_83_1003 | 300 |
| 134 | 3300046516 | Ga0495628_0000835 | Ga0495628_0000835_19509_20429 | 300 |
| 135 | 3300046529 | Ga0495652_0034009 | Ga0495652_0034009_1895_2815 | 300 |
| 136 | 3300046675 | Ga0495657_0045934 | Ga0495657_0045934_1784_2704 | 300 |
| 137 | 3300046678 | Ga0495599_0002461 | Ga0495599_0002461_9639_10559 | 300 |
| 138 | 3300046679 | Ga0495623_0011084 | Ga0495623_0011084_383_1303 | 300 |
| 139 | 3300046690 | Ga0495624_0078484 | Ga0495624_0078484_570_1490 | 300 |
| 140 | 3300046809 | Ga0495600_0012302 | Ga0495600_0012302_2572_3492 | 300 |
| 141 | 3300048088 | Ga0495602_0082414 | Ga0495602_0082414_687_1607 | 300 |
| 142 | 3300048088 | Ga0495602_0240335 | Ga0495602_0240335_338_1258 | 300 |
| 143 | 3300048903 | Ga0496100_0159660 | Ga0496100_0159660_581_1501 | 300 |
| 144 | 3300048917 | Ga0496114_0085489 | Ga0496114_0085489_930_1850 | 300 |
| 145 | 3300048919 | Ga0496116_0006493 | Ga0496116_0006493_3500_4420 | 300 |
| 146 | 3300048921 | Ga0496118_0137124 | Ga0496118_0137124_71_991 | 300 |
| 147 | 3300048924 | Ga0496121_0046374 | Ga0496121_0046374_2384_3304 | 300 |
| 148 | 3300048924 | Ga0496121_0051934 | Ga0496121_0051934_786_1706 | 300 |
| 149 | 3300048925 | Ga0496122_0008199 | Ga0496122_0008199_6341_7261 | 300 |
| 150 | 3300048926 | Ga0496123_0002055 | Ga0496123_0002055_4096_5016 | 300 |
| 151 | 3300048928 | Ga0496125_0000794 | Ga0496125_0000794_14163_15083 | 300 |
| 152 | 3300048928 | Ga0496125_0101879 | Ga0496125_0101879_870_1790 | 300 |
| 153 | 3300048929 | Ga0496126_0079290 | Ga0496126_0079290_1021_1941 | 300 |
| 154 | 3300053077 | Ga0495601_0022375 | Ga0495601_0022375_383_1303 | 300 |
| 155 | 3300053119 | Ga0500595_000547 | Ga0500595_000547_19161_20081 | 300 |
| 156 | 3300053125 | Ga0500618_001812 | Ga0500618_001812_5250_6170 | 300 |
| 157 | 3300053141 | Ga0500574_000340 | Ga0500574_000340_2360_3280 | 300 |
| 158 | 3300053161 | Ga0500634_0053150 | Ga0500634_0053150_868_1788 | 300 |
| 159 | iso_pu_bacteria | 2643221544 | 2643745412 | 300 |
| 160 | iso_pu_bacteria | 2643221639 | 2644218010 | 300 |
| 161 | iso_pu_bacteria | 2643221644 | 2644247305 | 300 |
| 162 | iso_pu_bacteria | 2643221646 | 2644258250 | 300 |
| 163 | iso_pu_bacteria | 2738541337 | 2739057146 | 300 |
| 164 | 3300002739 | JGI25158J39367_1012712 | JGI25158J39367_10127121 | 301 |
| 165 | 3300003187 | JGI25151J46595_10000490 | JGI25151J46595_1000049021 | 301 |
| 166 | 3300003322 | rootL2_10043086 | rootL2_100430862 | 301 |
| 167 | 3300003322 | rootL2_10047190 | rootL2_1004719010 | 301 |
| 168 | 3300003322 | rootL2_10106273 | rootL2_101062732 | 301 |
| 169 | 3300003759 | Ga0055525_1000008 | Ga0055525_1000008422 | 301 |
| 170 | 3300003771 | Ga0055526_1003413 | Ga0055526_100341310 | 301 |
| 171 | 3300003773 | Ga0055537_1009160 | Ga0055537_10091602 | 301 |
| 172 | 3300003775 | Ga0055524_1000679 | Ga0055524_100067911 | 301 |
| 173 | 3300003775 | Ga0055524_1006891 | Ga0055524_10068912 | 301 |
| 174 | 3300003781 | Ga0055536_1001609 | Ga0055536_10016096 | 301 |
| 175 | 3300003781 | Ga0055536_1006289 | Ga0055536_10062892 | 301 |
| 176 | 3300003784 | Ga0055534_1005923 | Ga0055534_10059232 | 301 |
| 177 | 3300003790 | Ga0055528_1019775 | Ga0055528_10197752 | 301 |
| 178 | 3300003791 | Ga0055530_10004499 | Ga0055530_100044992 | 301 |
| 179 | 3300003791 | Ga0055530_10032454 | Ga0055530_100324541 | 301 |
| 180 | 3300003792 | Ga0055540_1001457 | Ga0055540_10014578 | 301 |
| 181 | 3300003794 | Ga0055531_10001899 | Ga0055531_1000189912 | 301 |
| 182 | 3300003794 | Ga0055531_10001936 | Ga0055531_100019363 | 301 |
| 183 | 3300003794 | Ga0055531_10020910 | Ga0055531_100209103 | 301 |
| 184 | 3300005262 | Ga0065165_1019645 | Ga0065165_10196453 | 301 |
| 185 | 3300005327 | Ga0070658_10169039 | Ga0070658_101690391 | 301 |
| 186 | 3300005327 | Ga0070658_10262022 | Ga0070658_102620221 | 301 |
| 187 | 3300005339 | Ga0070660_100079160 | Ga0070660_1000791602 | 301 |
| 188 | 3300005339 | Ga0070660_100131323 | Ga0070660_1001313231 | 301 |
| 189 | 3300005339 | Ga0070660_100190023 | Ga0070660_1001900231 | 301 |
| 190 | 3300005339 | Ga0070660_100237986 | Ga0070660_1002379862 | 301 |
| 191 | 3300005344 | Ga0070661_100000229 | Ga0070661_1000002296 | 301 |
| 192 | 3300005353 | Ga0070669_100034642 | Ga0070669_1000346423 | 301 |
| 193 | 3300005354 | Ga0070675_100190216 | Ga0070675_1001902162 | 301 |
| 194 | 3300005366 | Ga0070659_100009239 | Ga0070659_1000092395 | 301 |
| 195 | 3300005366 | Ga0070659_100080779 | Ga0070659_1000807791 | 301 |
| 196 | 3300005457 | Ga0070662_100002684 | Ga0070662_1000026842 | 301 |
| 197 | 3300005457 | Ga0070662_100079348 | Ga0070662_1000793482 | 301 |
| 198 | 3300005467 | Ga0070706_100001200 | Ga0070706_1000012006 | 301 |
| 199 | 3300005468 | Ga0070707_100104898 | Ga0070707_1001048982 | 301 |
| 200 | 3300005471 | Ga0070698_100169300 | Ga0070698_1001693002 | 301 |
| 201 | 3300005518 | Ga0070699_100592095 | Ga0070699_1005920951 | 301 |
| 202 | 3300005539 | Ga0068853_100005209 | Ga0068853_1000052095 | 301 |
| 203 | 3300005539 | Ga0068853_100506555 | Ga0068853_1005065552 | 301 |
| 204 | 3300005543 | Ga0070672_100077579 | Ga0070672_1000775791 | 301 |
| 205 | 3300005563 | Ga0068855_100645865 | Ga0068855_1006458651 | 301 |
| 206 | 3300005564 | Ga0070664_100012848 | Ga0070664_1000128487 | 301 |
| 207 | 3300005564 | Ga0070664_100030868 | Ga0070664_1000308682 | 301 |
| 208 | 3300005577 | Ga0068857_100258442 | Ga0068857_1002584421 | 301 |
| 209 | 3300005578 | Ga0068854_100144357 | Ga0068854_1001443572 | 301 |
| 210 | 3300005616 | Ga0068852_100097177 | Ga0068852_1000971771 | 301 |
| 211 | 3300005617 | Ga0068859_100393324 | Ga0068859_1003933242 | 301 |
| 212 | 3300006048 | Ga0075363_100011468 | Ga0075363_1000114685 | 301 |
| 213 | 3300006048 | Ga0075363_100013972 | Ga0075363_1000139724 | 301 |
| 214 | 3300006051 | Ga0075364_10038210 | Ga0075364_100382102 | 301 |
| 215 | 3300006177 | Ga0075362_10011997 | Ga0075362_100119972 | 301 |
| 216 | 3300006177 | Ga0075362_10053506 | Ga0075362_100535062 | 301 |
| 217 | 3300006178 | Ga0075367_10086726 | Ga0075367_100867262 | 301 |
| 218 | 3300006186 | Ga0075369_10136294 | Ga0075369_101362942 | 301 |
| 219 | 3300006353 | Ga0075370_10003046 | Ga0075370_100030467 | 301 |
| 220 | 3300006353 | Ga0075370_10006846 | Ga0075370_100068462 | 301 |
| 221 | 3300006358 | Ga0068871_100140675 | Ga0068871_1001406752 | 301 |
| 222 | 3300006358 | Ga0068871_100228440 | Ga0068871_1002284402 | 301 |
| 223 | 3300006931 | Ga0097620_100393291 | Ga0097620_1003932912 | 301 |
| 224 | 3300006944 | Ga0099823_1004429 | Ga0099823_10044297 | 301 |
| 225 | 3300009036 | Ga0105244_10000775 | Ga0105244_1000077511 | 301 |
| 226 | 3300009036 | Ga0105244_10032662 | Ga0105244_100326623 | 301 |
| 227 | 3300009093 | Ga0105240_10037144 | Ga0105240_100371447 | 301 |
| 228 | 3300009148 | Ga0105243_10012543 | Ga0105243_100125432 | 301 |
| 229 | 3300009148 | Ga0105243_10096423 | Ga0105243_100964232 | 301 |
| 230 | 3300009174 | Ga0105241_10023068 | Ga0105241_100230682 | 301 |
| 231 | 3300009545 | Ga0105237_10019363 | Ga0105237_100193634 | 301 |
| 232 | 3300009545 | Ga0105237_10263516 | Ga0105237_102635162 | 301 |
| 233 | 3300010375 | Ga0105239_10033461 | Ga0105239_100334615 | 301 |
| 234 | 3300011119 | Ga0105246_10190782 | Ga0105246_101907822 | 301 |
| 235 | 3300011119 | Ga0105246_10280588 | Ga0105246_102805881 | 301 |
| 236 | 3300012497 | Ga0157319_1000001 | Ga0157319_100000130 | 301 |
| 237 | 3300013306 | Ga0163162_10148710 | Ga0163162_101487102 | 301 |
| 238 | 3300013307 | Ga0157372_10740060 | Ga0157372_107400601 | 301 |
| 239 | 3300015261 | Ga0182006_1001948 | Ga0182006_10019482 | 301 |
| 240 | 3300015262 | Ga0182007_10001204 | Ga0182007_100012049 | 301 |
| 241 | 3300017792 | Ga0163161_10019138 | Ga0163161_100191382 | 301 |
| 242 | 3300021361 | Ga0213872_10024424 | Ga0213872_100244241 | 301 |
| 243 | 3300025230 | Ga0209563_100003 | Ga0209563_1000031506 | 301 |
| 244 | 3300025254 | Ga0209148_1000380 | Ga0209148_100038012 | 301 |
| 245 | 3300025292 | Ga0209676_1000356 | Ga0209676_100035622 | 301 |
| 246 | 3300025292 | Ga0209676_1010471 | Ga0209676_10104712 | 301 |
| 247 | 3300025298 | Ga0209050_1000575 | Ga0209050_100057519 | 301 |
| 248 | 3300025298 | Ga0209050_1001396 | Ga0209050_10013967 | 301 |
| 249 | 3300025299 | Ga0209256_1001621 | Ga0209256_10016213 | 301 |
| 250 | 3300025299 | Ga0209256_1002194 | Ga0209256_100219410 | 301 |
| 251 | 3300025303 | Ga0209051_1000073 | Ga0209051_100007370 | 301 |
| 252 | 3300025303 | Ga0209051_1001499 | Ga0209051_10014999 | 301 |
| 253 | 3300025303 | Ga0209051_1010952 | Ga0209051_10109522 | 301 |
| 254 | 3300025303 | Ga0209051_1025225 | Ga0209051_10252252 | 301 |
| 255 | 3300025304 | Ga0209257_1000139 | Ga0209257_1000139195 | 301 |
| 256 | 3300025304 | Ga0209257_1001530 | Ga0209257_10015303 | 301 |
| 257 | 3300025304 | Ga0209257_1008843 | Ga0209257_10088432 | 301 |
| 258 | 3300025304 | Ga0209257_1011931 | Ga0209257_10119314 | 301 |
| 259 | 3300025728 | Ga0207655_1002169 | Ga0207655_100216912 | 301 |
| 260 | 3300025909 | Ga0207705_10007288 | Ga0207705_100072884 | 301 |
| 261 | 3300025910 | Ga0207684_10002095 | Ga0207684_100020954 | 301 |
| 262 | 3300025911 | Ga0207654_10005557 | Ga0207654_100055572 | 301 |
| 263 | 3300025913 | Ga0207695_10176615 | Ga0207695_101766152 | 301 |
| 264 | 3300025914 | Ga0207671_10037347 | Ga0207671_100373472 | 301 |
| 265 | 3300025914 | Ga0207671_10157593 | Ga0207671_101575932 | 301 |
| 266 | 3300025919 | Ga0207657_10000613 | Ga0207657_100006132 | 301 |
| 267 | 3300025919 | Ga0207657_10014271 | Ga0207657_100142715 | 301 |
| 268 | 3300025919 | Ga0207657_10221687 | Ga0207657_102216873 | 301 |
| 269 | 3300025920 | Ga0207649_10007212 | Ga0207649_100072124 | 301 |
| 270 | 3300025920 | Ga0207649_10126759 | Ga0207649_101267593 | 301 |
| 271 | 3300025920 | Ga0207649_10224782 | Ga0207649_102247821 | 301 |
| 272 | 3300025922 | Ga0207646_10215564 | Ga0207646_102155642 | 301 |
| 273 | 3300025926 | Ga0207659_10142501 | Ga0207659_101425012 | 301 |
| 274 | 3300025932 | Ga0207690_10015190 | Ga0207690_100151904 | 301 |
| 275 | 3300025932 | Ga0207690_10025624 | Ga0207690_100256242 | 301 |
| 276 | 3300025932 | Ga0207690_10293343 | Ga0207690_102933432 | 301 |
| 277 | 3300025933 | Ga0207706_10002023 | Ga0207706_100020233 | 301 |
| 278 | 3300025935 | Ga0207709_10001645 | Ga0207709_1000164514 | 301 |
| 279 | 3300025935 | Ga0207709_10062996 | Ga0207709_100629962 | 301 |
| 280 | 3300025941 | Ga0207711_10478085 | Ga0207711_104780851 | 301 |
| 281 | 3300025945 | Ga0207679_10000339 | Ga0207679_1000033913 | 301 |
| 282 | 3300025945 | Ga0207679_10015235 | Ga0207679_100152353 | 301 |
| 283 | 3300025945 | Ga0207679_10086829 | Ga0207679_100868292 | 301 |
| 284 | 3300025949 | Ga0207667_10055481 | Ga0207667_100554816 | 301 |
| 285 | 3300025949 | Ga0207667_10226354 | Ga0207667_102263542 | 301 |
| 286 | 3300025949 | Ga0207667_10298165 | Ga0207667_102981652 | 301 |
| 287 | 3300025972 | Ga0207668_10149974 | Ga0207668_101499742 | 301 |
| 288 | 3300025981 | Ga0207640_10118610 | Ga0207640_101186102 | 301 |
| 289 | 3300026078 | Ga0207702_10275279 | Ga0207702_102752792 | 301 |
| 290 | 3300026089 | Ga0207648_10149923 | Ga0207648_101499232 | 301 |
| 291 | 3300026116 | Ga0207674_10118585 | Ga0207674_101185852 | 301 |
| 292 | 3300026116 | Ga0207674_10147538 | Ga0207674_101475383 | 301 |
| 293 | 3300026116 | Ga0207674_10217362 | Ga0207674_102173622 | 301 |
| 294 | 3300026121 | Ga0207683_10207547 | Ga0207683_102075472 | 301 |
| 295 | 3300026142 | Ga0207698_10018339 | Ga0207698_100183392 | 301 |
| 296 | 3300026142 | Ga0207698_10544940 | Ga0207698_105449401 | 301 |
| 297 | 3300027866 | Ga0209813_10035726 | Ga0209813_100357262 | 301 |
| 298 | 3300028573 | Ga0265334_10054267 | Ga0265334_100542672 | 301 |
| 299 | 3300028786 | Ga0307517_10002278 | Ga0307517_100022782 | 301 |
| 300 | 3300028786 | Ga0307517_10061642 | Ga0307517_100616422 | 301 |
| 301 | 3300028794 | Ga0307515_10000028 | Ga0307515_1000002873 | 301 |
| 302 | 3300028794 | Ga0307515_10124280 | Ga0307515_101242802 | 301 |
| 303 | 3300028794 | Ga0307515_10173138 | Ga0307515_101731382 | 301 |
| 304 | 3300028794 | Ga0307515_10332260 | Ga0307515_103322601 | 301 |
| 305 | 3300031235 | Ga0265330_10000099 | Ga0265330_100000995 | 301 |
| 306 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002574 | 301 |
| 307 | 3300031239 | Ga0265328_10009017 | Ga0265328_100090172 | 301 |
| 308 | 3300031241 | Ga0265325_10005521 | Ga0265325_100055215 | 301 |
| 309 | 3300031247 | Ga0265340_10005843 | Ga0265340_100058436 | 301 |
| 310 | 3300031251 | Ga0265327_10000155 | Ga0265327_1000015578 | 301 |
| 311 | 3300031456 | Ga0307513_10053889 | Ga0307513_100538894 | 301 |
| 312 | 3300031548 | Ga0307408_100069264 | Ga0307408_1000692641 | 301 |
| 313 | 3300031548 | Ga0307408_100140403 | Ga0307408_1001404032 | 301 |
| 314 | 3300031548 | Ga0307408_100150089 | Ga0307408_1001500892 | 301 |
| 315 | 3300031616 | Ga0307508_10007776 | Ga0307508_100077764 | 301 |
| 316 | 3300031649 | Ga0307514_10084422 | Ga0307514_100844222 | 301 |
| 317 | 3300031711 | Ga0265314_10000089 | Ga0265314_1000008984 | 301 |
| 318 | 3300031730 | Ga0307516_10000286 | Ga0307516_100002865 | 301 |
| 319 | 3300031730 | Ga0307516_10000851 | Ga0307516_1000085111 | 301 |
| 320 | 3300031730 | Ga0307516_10241601 | Ga0307516_102416011 | 301 |
| 321 | 3300032002 | Ga0307416_100040620 | Ga0307416_1000406201 | 301 |
| 322 | 3300033180 | Ga0307510_10002323 | Ga0307510_1000232314 | 301 |
| 323 | 3300033180 | Ga0307510_10060607 | Ga0307510_100606073 | 301 |
| 324 | 3300037312 | Ga0395899_0002640 | Ga0395899_0002640_98_1036 | 301 |
| 325 | 3300037312 | Ga0395899_0005487 | Ga0395899_0005487_2653_3585 | 301 |
| 326 | 3300037312 | Ga0395899_0007329 | Ga0395899_0007329_610_1542 | 301 |
| 327 | 3300037312 | Ga0395899_0152592 | Ga0395899_0152592_201_1139 | 301 |
| 328 | 3300037312 | Ga0395899_0255643 | Ga0395899_0255643_98_1036 | 301 |
| 329 | 3300037418 | Ga0395900_0000065 | Ga0395900_0000065_89981_90919 | 301 |
| 330 | 3300037418 | Ga0395900_0003050 | Ga0395900_0003050_9984_10922 | 301 |
| 331 | 3300037418 | Ga0395900_0004717 | Ga0395900_0004717_10778_11710 | 301 |
| 332 | 3300037418 | Ga0395900_0045447 | Ga0395900_0045447_3265_4197 | 301 |
| 333 | 3300037418 | Ga0395900_0523244 | Ga0395900_0523244_55_993 | 301 |
| 334 | 3300037466 | Ga0395898_0002040 | Ga0395898_0002040_14131_15063 | 301 |
| 335 | 3300037466 | Ga0395898_0022967 | Ga0395898_0022967_134_1066 | 301 |
| 336 | 3300037466 | Ga0395898_0143195 | Ga0395898_0143195_150_1088 | 301 |
| 337 | 3300037466 | Ga0395898_0176082 | Ga0395898_0176082_55_993 | 301 |
| 338 | 3300037466 | Ga0395898_0206911 | Ga0395898_0206911_173_1111 | 301 |
| 339 | 3300037471 | Ga0395905_0004714 | Ga0395905_0004714_12762_13688 | 301 |
| 340 | 3300037471 | Ga0395905_0023568 | Ga0395905_0023568_4344_5282 | 301 |
| 341 | 3300037471 | Ga0395905_0117023 | Ga0395905_0117023_900_1826 | 301 |
| 342 | 3300037471 | Ga0395905_0607575 | Ga0395905_0607575_13_951 | 301 |
| 343 | 3300038443 | Ga0395901_0000114 | Ga0395901_0000114_24702_25640 | 301 |
| 344 | 3300038443 | Ga0395901_0001025 | Ga0395901_0001025_29252_30184 | 301 |
| 345 | 3300038443 | Ga0395901_0046123 | Ga0395901_0046123_3579_4511 | 301 |
| 346 | 3300038443 | Ga0395901_0263742 | Ga0395901_0263742_171_1109 | 301 |
| 347 | 3300038443 | Ga0395901_0387057 | Ga0395901_0387057_294_1226 | 301 |
| 348 | 3300038443 | Ga0395901_0625861 | Ga0395901_0625861_107_1045 | 301 |
| 349 | 3300039447 | Ga0436361_0033979 | Ga0436361_0033979_1815_2738 | 301 |
| 350 | 3300041413 | Ga0439465_0035828 | Ga0439465_0035828_571_1509 | 301 |
| 351 | 3300042005 | Ga0439448_0021161 | Ga0439448_0021161_33_971 | 301 |
| 352 | 3300042008 | Ga0439450_021970 | Ga0439450_021970_304_1236 | 301 |
| 353 | 3300042012 | Ga0439455_0047424 | Ga0439455_0047424_37_975 | 301 |
| 354 | 3300042121 | Ga0450919_003709 | Ga0450919_003709_527_1450 | 301 |
| 355 | 3300042139 | Ga0450904_000523 | Ga0450904_000523_2624_3550 | 301 |
| 356 | 3300042531 | Ga0450918_000283 | Ga0450918_000283_5488_6411 | 301 |
| 357 | 3300044656 | Ga0466969_0031618 | Ga0466969_0031618_89_1027 | 301 |
| 358 | 3300044683 | Ga0466965_0003561 | Ga0466965_0003561_2015_2953 | 301 |
| 359 | 3300044683 | Ga0466965_0061910 | Ga0466965_0061910_794_1720 | 301 |
| 360 | 3300044684 | Ga0466966_0029352 | Ga0466966_0029352_733_1671 | 301 |
| 361 | 3300044684 | Ga0466966_0085868 | Ga0466966_0085868_843_1781 | 301 |
| 362 | 3300044684 | Ga0466966_0132965 | Ga0466966_0132965_65_1003 | 301 |
| 363 | 3300044684 | Ga0466966_0242868 | Ga0466966_0242868_83_1021 | 301 |
| 364 | 3300044694 | Ga0466963_0362719 | Ga0466963_0362719_56_994 | 301 |
| 365 | 3300044706 | Ga0466964_0002257 | Ga0466964_0002257_4167_5105 | 301 |
| 366 | 3300044706 | Ga0466964_0021297 | Ga0466964_0021297_749_1681 | 301 |
| 367 | 3300044735 | Ga0466968_0005833 | Ga0466968_0005833_308_1246 | 301 |
| 368 | 3300044842 | Ga0466957_0001421 | Ga0466957_0001421_4583_5509 | 301 |
| 369 | 3300044842 | Ga0466957_0018582 | Ga0466957_0018582_1672_2610 | 301 |
| 370 | 3300044901 | Ga0466960_0022813 | Ga0466960_0022813_1481_2407 | 301 |
| 371 | 3300045049 | Ga0466959_0010269 | Ga0466959_0010269_4755_5693 | 301 |
| 372 | 3300045049 | Ga0466959_0038048 | Ga0466959_0038048_2291_3229 | 301 |
| 373 | 3300045049 | Ga0466959_0042038 | Ga0466959_0042038_2231_3169 | 301 |
| 374 | 3300045049 | Ga0466959_0292090 | Ga0466959_0292090_53_991 | 301 |
| 375 | 3300045051 | Ga0451576_0085449 | Ga0451576_0085449_1621_2544 | 301 |
| 376 | 3300045976 | Ga0466967_0017561 | Ga0466967_0017561_2514_3446 | 301 |
| 377 | 3300045976 | Ga0466967_0512093 | Ga0466967_0512093_188_1126 | 301 |
| 378 | 3300046457 | Ga0495590_0102322 | Ga0495590_0102322_33_971 | 301 |
| 379 | 3300046460 | Ga0495638_0028052 | Ga0495638_0028052_1689_2615 | 301 |
| 380 | 3300046460 | Ga0495638_0101917 | Ga0495638_0101917_197_1120 | 301 |
| 381 | 3300046460 | Ga0495638_0121984 | Ga0495638_0121984_32_958 | 301 |
| 382 | 3300046474 | Ga0495605_0001024 | Ga0495605_0001024_840_1778 | 301 |
| 383 | 3300046474 | Ga0495605_0041691 | Ga0495605_0041691_977_1912 | 301 |
| 384 | 3300046491 | Ga0495584_0002172 | Ga0495584_0002172_89_1027 | 301 |
| 385 | 3300046491 | Ga0495584_0024023 | Ga0495584_0024023_1197_2132 | 301 |
| 386 | 3300046501 | Ga0495607_0000277 | Ga0495607_0000277_41961_42896 | 301 |
| 387 | 3300046501 | Ga0495607_0001095 | Ga0495607_0001095_6739_7677 | 301 |
| 388 | 3300046501 | Ga0495607_0013475 | Ga0495607_0013475_2295_3233 | 301 |
| 389 | 3300046506 | Ga0495583_0000615 | Ga0495583_0000615_5004_6038 | 301 |
| 390 | 3300046507 | Ga0495606_0011604 | Ga0495606_0011604_1900_2838 | 301 |
| 391 | 3300046512 | Ga0495610_0020577 | Ga0495610_0020577_1461_2387 | 301 |
| 392 | 3300046513 | Ga0495616_0000042 | Ga0495616_0000042_15234_16160 | 301 |
| 393 | 3300046513 | Ga0495616_0001007 | Ga0495616_0001007_8224_9150 | 301 |
| 394 | 3300046513 | Ga0495616_0001176 | Ga0495616_0001176_5228_6163 | 301 |
| 395 | 3300046513 | Ga0495616_0027695 | Ga0495616_0027695_1899_2837 | 301 |
| 396 | 3300046513 | Ga0495616_0035184 | Ga0495616_0035184_331_1269 | 301 |
| 397 | 3300046518 | Ga0495631_0000455 | Ga0495631_0000455_18048_18974 | 301 |
| 398 | 3300046520 | Ga0495637_0006307 | Ga0495637_0006307_751_1677 | 301 |
| 399 | 3300046522 | Ga0495643_0000653 | Ga0495643_0000653_19153_20079 | 301 |
| 400 | 3300046522 | Ga0495643_0001662 | Ga0495643_0001662_16223_17161 | 301 |
| 401 | 3300046524 | Ga0495648_0002371 | Ga0495648_0002371_1044_1982 | 301 |
| 402 | 3300046525 | Ga0495663_0011864 | Ga0495663_0011864_1418_2344 | 301 |
| 403 | 3300046528 | Ga0495642_0000489 | Ga0495642_0000489_12877_13815 | 301 |
| 404 | 3300046528 | Ga0495642_0021790 | Ga0495642_0021790_1519_2454 | 301 |
| 405 | 3300046530 | Ga0495654_0010940 | Ga0495654_0010940_533_1459 | 301 |
| 406 | 3300046530 | Ga0495654_0014623 | Ga0495654_0014623_1977_3011 | 301 |
| 407 | 3300046537 | Ga0495598_0078168 | Ga0495598_0078168_46_972 | 301 |
| 408 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_951016_951951 | 301 |
| 409 | 3300046539 | Ga0495621_0010300 | Ga0495621_0010300_600_1523 | 301 |
| 410 | 3300046539 | Ga0495621_0022926 | Ga0495621_0022926_672_1598 | 301 |
| 411 | 3300046543 | Ga0495645_0027501 | Ga0495645_0027501_89_1027 | 301 |
| 412 | 3300046615 | Ga0495656_0110589 | Ga0495656_0110589_10_936 | 301 |
| 413 | 3300046616 | Ga0495668_0240592 | Ga0495668_0240592_40_963 | 301 |
| 414 | 3300046665 | Ga0495661_0000063 | Ga0495661_0000063_22959_23894 | 301 |
| 415 | 3300046665 | Ga0495661_0003232 | Ga0495661_0003232_1652_2590 | 301 |
| 416 | 3300046665 | Ga0495661_0022025 | Ga0495661_0022025_310_1248 | 301 |
| 417 | 3300046665 | Ga0495661_0109954 | Ga0495661_0109954_135_1073 | 301 |
| 418 | 3300046674 | Ga0495588_0000052 | Ga0495588_0000052_145230_146168 | 301 |
| 419 | 3300046674 | Ga0495588_0094264 | Ga0495588_0094264_204_1130 | 301 |
| 420 | 3300046691 | Ga0495670_0084768 | Ga0495670_0084768_360_1286 | 301 |
| 421 | 3300046794 | Ga0495589_0000015 | Ga0495589_0000015_89327_90262 | 301 |
| 422 | 3300046794 | Ga0495589_0000116 | Ga0495589_0000116_12473_13411 | 301 |
| 423 | 3300046810 | Ga0495660_0000145 | Ga0495660_0000145_62230_63168 | 301 |
| 424 | 3300046810 | Ga0495660_0041635 | Ga0495660_0041635_637_1575 | 301 |
| 425 | 3300047320 | Ga0495672_0008763 | Ga0495672_0008763_5414_6352 | 301 |
| 426 | 3300047323 | Ga0495683_0019759 | Ga0495683_0019759_956_1894 | 301 |
| 427 | 3300047323 | Ga0495683_0028718 | Ga0495683_0028718_983_1918 | 301 |
| 428 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_548850_549785 | 301 |
| 429 | 3300047443 | Ga0495687_000073 | Ga0495687_000073_14549_15487 | 301 |
| 430 | 3300047443 | Ga0495687_000891 | Ga0495687_000891_17033_17971 | 301 |
| 431 | 3300047445 | Ga0495677_0000001 | Ga0495677_0000001_609369_610304 | 301 |
| 432 | 3300047445 | Ga0495677_0000215 | Ga0495677_0000215_22917_23855 | 301 |
| 433 | 3300047472 | Ga0495686_0000190 | Ga0495686_0000190_111692_112618 | 301 |
| 434 | 3300047472 | Ga0495686_0057965 | Ga0495686_0057965_250_1173 | 301 |
| 435 | 3300047673 | Ga0495593_0022644 | Ga0495593_0022644_620_1546 | 301 |
| 436 | 3300048091 | Ga0495626_0000128 | Ga0495626_0000128_85473_86408 | 301 |
| 437 | 3300048091 | Ga0495626_0000171 | Ga0495626_0000171_62230_63168 | 301 |
| 438 | 3300048091 | Ga0495626_0004823 | Ga0495626_0004823_1675_2601 | 301 |
| 439 | 3300048091 | Ga0495626_0046048 | Ga0495626_0046048_139_1065 | 301 |
| 440 | 3300048903 | Ga0496100_0230432 | Ga0496100_0230432_35_973 | 301 |
| 441 | 3300048904 | Ga0496101_0027041 | Ga0496101_0027041_486_1418 | 301 |
| 442 | 3300048905 | Ga0496102_0013533 | Ga0496102_0013533_2475_3398 | 301 |
| 443 | 3300048905 | Ga0496102_0179741 | Ga0496102_0179741_304_1230 | 301 |
| 444 | 3300048905 | Ga0496102_0279371 | Ga0496102_0279371_470_1396 | 301 |
| 445 | 3300048905 | Ga0496102_0489560 | Ga0496102_0489560_94_1026 | 301 |
| 446 | 3300048906 | Ga0496103_0046056 | Ga0496103_0046056_1276_2202 | 301 |
| 447 | 3300048906 | Ga0496103_0202074 | Ga0496103_0202074_150_1088 | 301 |
| 448 | 3300048907 | Ga0496104_0212165 | Ga0496104_0212165_241_1173 | 301 |
| 449 | 3300048908 | Ga0496105_0190750 | Ga0496105_0190750_439_1377 | 301 |
| 450 | 3300048909 | Ga0496106_0037494 | Ga0496106_0037494_1793_2731 | 301 |
| 451 | 3300048910 | Ga0496107_0180295 | Ga0496107_0180295_440_1378 | 301 |
| 452 | 3300048910 | Ga0496107_0379934 | Ga0496107_0379934_62_994 | 301 |
| 453 | 3300048912 | Ga0496109_0266393 | Ga0496109_0266393_39_1007 | 301 |
| 454 | 3300048916 | Ga0496113_0011778 | Ga0496113_0011778_4779_5717 | 301 |
| 455 | 3300048918 | Ga0496115_0217780 | Ga0496115_0217780_200_1132 | 301 |
| 456 | 3300048921 | Ga0496118_0010168 | Ga0496118_0010168_7242_8168 | 301 |
| 457 | 3300048921 | Ga0496118_0032872 | Ga0496118_0032872_443_1381 | 301 |
| 458 | 3300048924 | Ga0496121_0034335 | Ga0496121_0034335_1467_2405 | 301 |
| 459 | 3300048924 | Ga0496121_0306419 | Ga0496121_0306419_96_1022 | 301 |
| 460 | 3300048925 | Ga0496122_0001249 | Ga0496122_0001249_1396_2334 | 301 |
| 461 | 3300048925 | Ga0496122_0032516 | Ga0496122_0032516_2413_3339 | 301 |
| 462 | 3300048925 | Ga0496122_0123119 | Ga0496122_0123119_246_1184 | 301 |
| 463 | 3300048926 | Ga0496123_0014620 | Ga0496123_0014620_2275_3213 | 301 |
| 464 | 3300048927 | Ga0496124_0004031 | Ga0496124_0004031_11602_12540 | 301 |
| 465 | 3300048927 | Ga0496124_0032358 | Ga0496124_0032358_421_1347 | 301 |
| 466 | 3300048927 | Ga0496124_0062916 | Ga0496124_0062916_24_962 | 301 |
| 467 | 3300048927 | Ga0496124_0089369 | Ga0496124_0089369_199_1137 | 301 |
| 468 | 3300048927 | Ga0496124_0113566 | Ga0496124_0113566_1102_2040 | 301 |
| 469 | 3300048928 | Ga0496125_0007526 | Ga0496125_0007526_3366_4292 | 301 |
| 470 | 3300049649 | Ga0501198_000012 | Ga0501198_000012_10362_11285 | 301 |
| 471 | 3300049662 | Ga0501222_000010 | Ga0501222_000010_10368_11291 | 301 |
| 472 | 3300049822 | Ga0501035_0001329 | Ga0501035_0001329_2781_3719 | 301 |
| 473 | 3300049823 | Ga0501044_0369845 | Ga0501044_0369845_100_1038 | 301 |
| 474 | 3300050489 | nmdc:mga03683_12920_c1 | nmdc:mga03683_12920_c1_1789_2712 | 301 |
| 475 | 3300050489 | nmdc:mga03683_29706_c1 | nmdc:mga03683_29706_c1_605_1531 | 301 |
| 476 | 3300050490 | nmdc:mga03n38_9886_c1 | nmdc:mga03n38_9886_c1_37_963 | 301 |
| 477 | 3300050491 | nmdc:mga00v17_139792_c1 | nmdc:mga00v17_139792_c1_503_1426 | 301 |
| 478 | 3300050493 | nmdc:mga0k408_10625_c1 | nmdc:mga0k408_10625_c1_2663_3589 | 301 |
| 479 | 3300050494 | nmdc:mga06z11_25937_c1 | nmdc:mga06z11_25937_c1_591_1514 | 301 |
| 480 | 3300050496 | nmdc:mga07m45_1806_c2 | nmdc:mga07m45_1806_c2_5226_6152 | 301 |
| 481 | 3300050496 | nmdc:mga07m45_29115_c1 | nmdc:mga07m45_29115_c1_1833_2756 | 301 |
| 482 | 3300050496 | nmdc:mga07m45_38424_c1 | nmdc:mga07m45_38424_c1_496_1419 | 301 |
| 483 | 3300050496 | nmdc:mga07m45_3842_c1 | nmdc:mga07m45_3842_c1_3392_4315 | 301 |
| 484 | 3300050496 | nmdc:mga07m45_94998_c1 | nmdc:mga07m45_94998_c1_307_1233 | 301 |
| 485 | 3300050516 | nmdc:mga0sz30_54670_c1 | nmdc:mga0sz30_54670_c1_185_1108 | 301 |
| 486 | 3300053079 | Ga0500610_0054751 | Ga0500610_0054751_1101_2027 | 301 |
| 487 | 3300053087 | Ga0500643_004274 | Ga0500643_004274_4158_5084 | 301 |
| 488 | 3300053093 | Ga0500651_0000052 | Ga0500651_0000052_53527_54453 | 301 |
| 489 | 3300053093 | Ga0500651_0037223 | Ga0500651_0037223_1487_2410 | 301 |
| 490 | 3300053110 | Ga0500571_000036 | Ga0500571_000036_8203_9129 | 301 |
| 491 | 3300053118 | Ga0500594_0001512 | Ga0500594_0001512_1165_2091 | 301 |
| 492 | 3300053118 | Ga0500594_0002464 | Ga0500594_0002464_2306_3229 | 301 |
| 493 | 3300053128 | Ga0500626_016230 | Ga0500626_016230_1247_2173 | 301 |
| 494 | 3300053131 | Ga0500652_013230 | Ga0500652_013230_576_1499 | 301 |
| 495 | 3300053133 | Ga0500655_000491 | Ga0500655_000491_3670_4596 | 301 |
| 496 | 3300053133 | Ga0500655_003558 | Ga0500655_003558_1098_2021 | 301 |
| 497 | 3300053134 | Ga0500658_0000033 | Ga0500658_0000033_50963_51889 | 301 |
| 498 | 3300053134 | Ga0500658_0000040 | Ga0500658_0000040_44342_45268 | 301 |
| 499 | 3300053136 | Ga0500559_0000122 | Ga0500559_0000122_27208_28131 | 301 |
| 500 | 3300053136 | Ga0500559_0001672 | Ga0500559_0001672_4587_5513 | 301 |
| 501 | 3300053137 | Ga0500561_0005762 | Ga0500561_0005762_1232_2158 | 301 |
| 502 | 3300053139 | Ga0500568_0003399 | Ga0500568_0003399_6117_7043 | 301 |
| 503 | 3300053139 | Ga0500568_0019381 | Ga0500568_0019381_389_1312 | 301 |
| 504 | 3300053156 | Ga0500622_0000651 | Ga0500622_0000651_9299_10222 | 301 |
| 505 | 3300053158 | Ga0500627_0115682 | Ga0500627_0115682_90_1013 | 301 |
| 506 | 3300053161 | Ga0500634_0002930 | Ga0500634_0002930_2871_3797 | 301 |
| 507 | 3300053162 | Ga0500638_010860 | Ga0500638_010860_2299_3225 | 301 |
| 508 | 3300053739 | Ga0500587_001706 | Ga0500587_001706_1254_2177 | 301 |
| 509 | iso_pu_bacteria | 2513020051 | 2513229741 | 301 |
| 510 | iso_pu_bacteria | 2547132374 | 2548497548 | 301 |
| 511 | iso_pu_bacteria | 2643221556 | 2643797323 | 301 |
| 512 | iso_pu_bacteria | 2643221570 | 2643866466 | 301 |
| 513 | iso_pu_bacteria | 2643221596 | 2643993237 | 301 |
| 514 | iso_pu_bacteria | 2643221652 | 2644294172 | 301 |
| 515 | iso_pu_bacteria | 2643221658 | 2644329572 | 301 |
| 516 | iso_pu_bacteria | 2643221672 | 2644398351 | 301 |
| 517 | iso_pu_bacteria | 2643221684 | 2644474135 | 301 |
| 518 | iso_pu_bacteria | 2643221717 | 2644646176 | 301 |
| 519 | iso_pu_bacteria | 2831265667 | 2831270459 | 301 |
| 520 | iso_pu_bacteria | 2842733646 | 2842735605 | 301 |
| 521 | iso_pu_bacteria | 2885192300 | 2885194084 | 301 |
| 522 | iso_pu_bacteria | 2885198086 | 2885199701 | 301 |
| 523 | iso_pu_bacteria | 2885211737 | 2885213352 | 301 |
| 524 | iso_pu_bacteria | 2928084124 | 2928088925 | 301 |
| 525 | iso_pu_bacteria | 2928115317 | 2928119917 | 301 |
| 526 | iso_pu_bacteria | 2990710928 | 2990712328 | 301 |
| 527 | iso_pu_bacteria | 8047673197 | 8047675030 | 301 |
| 528 | iso_pu_bacteria | 2904479285 | 2904480936 | 302 |
| 529 | 3300005618 | Ga0068864_100073320 | Ga0068864_1000733202 | 303 |
| 530 | 3300005841 | Ga0068863_100456188 | Ga0068863_1004561882 | 303 |
| 531 | 3300009177 | Ga0105248_10001682 | Ga0105248_100016823 | 303 |
| 532 | 3300048908 | Ga0496105_0357860 | Ga0496105_0357860_84_1016 | 303 |
| 533 | 3300048915 | Ga0496112_0206997 | Ga0496112_0206997_543_1475 | 303 |
| 534 | 3300048916 | Ga0496113_0193613 | Ga0496113_0193613_72_1004 | 303 |
| 535 | 3300053125 | Ga0500618_002516 | Ga0500618_002516_490_1422 | 303 |
| 536 | iso_pu_bacteria | 2846037992 | 2846041057 | 303 |
| 537 | 3300001991 | JGI24743J22301_10000136 | JGI24743J22301_100001366 | 304 |
| 538 | 3300002077 | JGI24744J21845_10003694 | JGI24744J21845_100036942 | 304 |
| 539 | 3300003320 | rootH2_10025857 | rootH2_100258574 | 304 |
| 540 | 3300003320 | rootH2_10037630 | rootH2_100376303 | 304 |
| 541 | 3300003323 | rootH1_10034690 | rootH1_1003469012 | 304 |
| 542 | 3300003323 | rootH1_10039626 | rootH1_100396263 | 304 |
| 543 | 3300003791 | Ga0055530_10009542 | Ga0055530_100095422 | 304 |
| 544 | 3300005262 | Ga0065165_1002636 | Ga0065165_100263610 | 304 |
| 545 | 3300005327 | Ga0070658_10004378 | Ga0070658_100043788 | 304 |
| 546 | 3300005539 | Ga0068853_100000007 | Ga0068853_100000007138 | 304 |
| 547 | 3300005614 | Ga0068856_100017064 | Ga0068856_1000170642 | 304 |
| 548 | 3300006038 | Ga0075365_10056844 | Ga0075365_100568442 | 304 |
| 549 | 3300006177 | Ga0075362_10016984 | Ga0075362_100169842 | 304 |
| 550 | 3300006353 | Ga0075370_10002404 | Ga0075370_100024044 | 304 |
| 551 | 3300009093 | Ga0105240_10000309 | Ga0105240_1000030923 | 304 |
| 552 | 3300009545 | Ga0105237_10436498 | Ga0105237_104364982 | 304 |
| 553 | 3300010375 | Ga0105239_10031152 | Ga0105239_100311527 | 304 |
| 554 | 3300013100 | Ga0157373_10000471 | Ga0157373_100004719 | 304 |
| 555 | 3300013104 | Ga0157370_10000554 | Ga0157370_1000055413 | 304 |
| 556 | 3300013307 | Ga0157372_10470984 | Ga0157372_104709841 | 304 |
| 557 | 3300021388 | Ga0213875_10001280 | Ga0213875_1000128017 | 304 |
| 558 | 3300025298 | Ga0209050_1001921 | Ga0209050_100192113 | 304 |
| 559 | 3300025303 | Ga0209051_1005113 | Ga0209051_10051136 | 304 |
| 560 | 3300025901 | Ga0207688_10017520 | Ga0207688_100175202 | 304 |
| 561 | 3300025909 | Ga0207705_10010554 | Ga0207705_100105542 | 304 |
| 562 | 3300025913 | Ga0207695_10000635 | Ga0207695_1000063523 | 304 |
| 563 | 3300025914 | Ga0207671_10259133 | Ga0207671_102591331 | 304 |
| 564 | 3300026041 | Ga0207639_10000001 | Ga0207639_1000000184 | 304 |
| 565 | 3300026078 | Ga0207702_10012461 | Ga0207702_100124616 | 304 |
| 566 | 3300027866 | Ga0209813_10031496 | Ga0209813_100314962 | 304 |
| 567 | 3300031548 | Ga0307408_100000021 | Ga0307408_100000021170 | 304 |
| 568 | 3300031548 | Ga0307408_100008195 | Ga0307408_1000081955 | 304 |
| 569 | 3300031824 | Ga0307413_10251955 | Ga0307413_102519551 | 304 |
| 570 | 3300031903 | Ga0307407_10000058 | Ga0307407_1000005820 | 304 |
| 571 | 3300031903 | Ga0307407_10002259 | Ga0307407_100022593 | 304 |
| 572 | 3300031911 | Ga0307412_10000013 | Ga0307412_1000001315 | 304 |
| 573 | 3300032002 | Ga0307416_100002351 | Ga0307416_1000023514 | 304 |
| 574 | 3300032004 | Ga0307414_10000081 | Ga0307414_1000008110 | 304 |
| 575 | 3300032005 | Ga0307411_10008542 | Ga0307411_100085424 | 304 |
| 576 | 3300037312 | Ga0395899_0010638 | Ga0395899_0010638_2287_3201 | 304 |
| 577 | 3300037466 | Ga0395898_0002898 | Ga0395898_0002898_14033_14947 | 304 |
| 578 | 3300037853 | Ga0436364_0828542 | Ga0436364_0828542_2983_3918 | 304 |
| 579 | 3300042127 | Ga0450890_000019 | Ga0450890_000019_24938_25852 | 304 |
| 580 | 3300042130 | Ga0450892_000078 | Ga0450892_000078_6574_7488 | 304 |
| 581 | 3300042532 | Ga0450893_0007158 | Ga0450893_0007158_285_1199 | 304 |
| 582 | 3300044719 | Ga0466971_0000034 | Ga0466971_0000034_39510_40436 | 304 |
| 583 | 3300046515 | Ga0495620_0065747 | Ga0495620_0065747_68_1021 | 304 |
| 584 | 3300046518 | Ga0495631_0052125 | Ga0495631_0052125_306_1259 | 304 |
| 585 | 3300046519 | Ga0495632_0015495 | Ga0495632_0015495_1054_2007 | 304 |
| 586 | 3300046542 | Ga0495597_0053466 | Ga0495597_0053466_64_1017 | 304 |
| 587 | 3300046660 | Ga0495625_0008989 | Ga0495625_0008989_5871_6824 | 304 |
| 588 | 3300046694 | Ga0495649_0000935 | Ga0495649_0000935_7807_8760 | 304 |
| 589 | 3300046810 | Ga0495660_0028390 | Ga0495660_0028390_184_1137 | 304 |
| 590 | 3300047443 | Ga0495687_008007 | Ga0495687_008007_2265_3218 | 304 |
| 591 | 3300049568 | Ga0501031_0000399 | Ga0501031_0000399_6895_7821 | 304 |
| 592 | 3300049569 | Ga0501032_0113565 | Ga0501032_0113565_547_1473 | 304 |
| 593 | 3300049575 | Ga0501039_0002616 | Ga0501039_0002616_8817_9743 | 304 |
| 594 | 3300049579 | Ga0501043_0003333 | Ga0501043_0003333_9150_10076 | 304 |
| 595 | 3300049579 | Ga0501043_0006588 | Ga0501043_0006588_5231_6157 | 304 |
| 596 | 3300049581 | Ga0501047_0008774 | Ga0501047_0008774_3151_4077 | 304 |
| 597 | 3300049586 | Ga0501070_0001605 | Ga0501070_0001605_7306_8232 | 304 |
| 598 | 3300049665 | Ga0501227_000022 | Ga0501227_000022_3887_4801 | 304 |
| 599 | 3300049742 | Ga0501080_0030133 | Ga0501080_0030133_955_1890 | 304 |
| 600 | 3300049744 | Ga0501083_0008427 | Ga0501083_0008427_4729_5643 | 304 |
| 601 | 3300049822 | Ga0501035_0000001 | Ga0501035_0000001_76440_77366 | 304 |
| 602 | 3300049823 | Ga0501044_0241917 | Ga0501044_0241917_609_1535 | 304 |
| 603 | 3300049823 | Ga0501044_0258980 | Ga0501044_0258980_365_1291 | 304 |
| 604 | 3300050490 | nmdc:mga03n38_33173_c1 | nmdc:mga03n38_33173_c1_895_1848 | 304 |
| 605 | 3300050492 | nmdc:mga0yw44_163821_c1 | nmdc:mga0yw44_163821_c1_377_1330 | 304 |
| 606 | 3300050493 | nmdc:mga0k408_153878_c1 | nmdc:mga0k408_153878_c1_296_1249 | 304 |
| 607 | 3300050495 | nmdc:mga04h51_1034_c1 | nmdc:mga04h51_1034_c1_107_1060 | 304 |
| 608 | 3300050496 | nmdc:mga07m45_613_c1 | nmdc:mga07m45_613_c1_9605_10558 | 304 |
| 609 | 3300053086 | Ga0500578_0000002 | Ga0500578_0000002_77114_78049 | 304 |
| 610 | 3300053098 | Ga0500650_0067886 | Ga0500650_0067886_53_1006 | 304 |
| 611 | 3300053139 | Ga0500568_0006960 | Ga0500568_0006960_2458_3411 | 304 |
| 612 | 3300053151 | Ga0500604_0020974 | Ga0500604_0020974_696_1631 | 304 |
| 613 | 3300053153 | Ga0500616_0009982 | Ga0500616_0009982_4074_5009 | 304 |
| 614 | 3300061719 | Ga0466962_0000059 | Ga0466962_0000059_33722_34648 | 304 |
| 615 | iso_pu_bacteria | 2643221592 | 2643969547 | 304 |
| 616 | iso_pu_bacteria | 2643221625 | 2644143845 | 304 |
| 617 | iso_pu_bacteria | 2643221648 | 2644276447 | 304 |
| 618 | iso_pu_bacteria | 2843690924 | 2843694338 | 304 |
| 619 | iso_pu_bacteria | 2846033681 | 2846036221 | 304 |
| 620 | iso_pu_bacteria | 2998344455 | 2998348228 | 304 |
| 621 | 3300002155 | JGI24033J26618_1000771 | JGI24033J26618_10007712 | 305 |
| 622 | 3300003320 | rootH2_10007491 | rootH2_1000749115 | 305 |
| 623 | 3300005289 | Ga0065704_10090996 | Ga0065704_100909962 | 305 |
| 624 | 3300005289 | Ga0065704_10094429 | Ga0065704_100944291 | 305 |
| 625 | 3300005344 | Ga0070661_100000373 | Ga0070661_10000037315 | 305 |
| 626 | 3300005366 | Ga0070659_100068755 | Ga0070659_1000687553 | 305 |
| 627 | 3300005456 | Ga0070678_100019710 | Ga0070678_1000197103 | 305 |
| 628 | 3300009093 | Ga0105240_10669087 | Ga0105240_106690872 | 305 |
| 629 | 3300025920 | Ga0207649_10000300 | Ga0207649_1000030023 | 305 |
| 630 | 3300026121 | Ga0207683_10069070 | Ga0207683_100690702 | 305 |
| 631 | 3300031251 | Ga0265327_10000369 | Ga0265327_1000036918 | 305 |
| 632 | 3300031548 | Ga0307408_100001048 | Ga0307408_10000104813 | 305 |
| 633 | 3300031901 | Ga0307406_10033621 | Ga0307406_100336213 | 305 |
| 634 | 3300031995 | Ga0307409_100275315 | Ga0307409_1002753151 | 305 |
| 635 | 3300049574 | Ga0501038_0000020 | Ga0501038_0000020_60984_61901 | 305 |
| 636 | 3300049583 | Ga0501067_0008141 | Ga0501067_0008141_4099_5016 | 305 |
| 637 | 3300049649 | Ga0501198_003622 | Ga0501198_003622_450_1394 | 305 |
| 638 | 3300005937 | Ga0081455_10084088 | Ga0081455_100840882 | 306 |
| 639 | 3300005983 | Ga0081540_1002865 | Ga0081540_10028656 | 306 |
| 640 | 3300053136 | Ga0500559_0016472 | Ga0500559_0016472_140_1087 | 306 |
| 641 | 3300001977 | JGI24746J21847_1000041 | JGI24746J21847_10000412 | 307 |
| 642 | 3300005328 | Ga0070676_10111574 | Ga0070676_101115742 | 307 |
| 643 | 3300005338 | Ga0068868_100351617 | Ga0068868_1003516171 | 307 |
| 644 | 3300005344 | Ga0070661_100134585 | Ga0070661_1001345851 | 307 |
| 645 | 3300005459 | Ga0068867_100000064 | Ga0068867_10000006415 | 307 |
| 646 | 3300005564 | Ga0070664_100001816 | Ga0070664_1000018163 | 307 |
| 647 | 3300006881 | Ga0068865_100258204 | Ga0068865_1002582042 | 307 |
| 648 | 3300009098 | Ga0105245_10157103 | Ga0105245_101571032 | 307 |
| 649 | 3300009148 | Ga0105243_10000088 | Ga0105243_1000008846 | 307 |
| 650 | 3300014745 | Ga0157377_10010282 | Ga0157377_100102822 | 307 |
| 651 | 3300014969 | Ga0157376_10036778 | Ga0157376_100367784 | 307 |
| 652 | 3300025920 | Ga0207649_10006373 | Ga0207649_100063733 | 307 |
| 653 | 3300025927 | Ga0207687_10098597 | Ga0207687_100985972 | 307 |
| 654 | 3300025935 | Ga0207709_10000270 | Ga0207709_1000027016 | 307 |
| 655 | 3300025938 | Ga0207704_10024535 | Ga0207704_100245353 | 307 |
| 656 | 3300025945 | Ga0207679_10010509 | Ga0207679_100105092 | 307 |
| 657 | 3300026023 | Ga0207677_10376672 | Ga0207677_103766721 | 307 |
| 658 | 3300026089 | Ga0207648_10000192 | Ga0207648_1000019215 | 307 |
| 659 | 3300042144 | Ga0450889_006008 | Ga0450889_006008_204_1130 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ab6-assembly1.cif.gz_A | regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis | 0.9555 | 91 | 306 |
| 4ab6-assembly1.cif.gz_B | regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis | 0.9541 | 92 | 305 |
| 4ab6-assembly1.cif.gz_A | regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis | 0.9512 | 91 | 306 |
| 4ab6-assembly1.cif.gz_B | regulatory domain structure of nmb2055 (metr), c103s c106s mutant, a lysr family regulator from n. meningitidis | 0.9497 | 92 | 305 |
| 4ab5-assembly1.cif.gz_A | regulatory domain structure of nmb2055 (metr) a lysr family regulator from n. meningitidis | 0.9379 | 92 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9F9_160_263_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9713 | 164 | 261 | 3.40.190.10 |
| 4ab5B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9668 | 164 | 265 | 3.40.190.10 |
| 4ab6B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9528 | 92 | 305 | 3.40.190.10 |
| af_P9WMF5_6_80_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9453 | 2 | 75 | 1.10.10.10 |
| 4ab6B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9439 | 92 | 305 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5BP07-F1-model_v4 | LysR family transcriptional regulator | 0.8413 | 134 | 294 |
GO:0000976
GO:0006355 |
| AF-A1B1R1-F1-model_v4 | LysR, substrate-binding protein | 0.8328 | 156 | 292 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |
| AF-A0A1G1G3G6-F1-model_v4 | LysR substrate-binding domain-containing protein | 0.832 | 91 | 292 |
GO:0000976
GO:0006355 |
| AF-A0A645EH23-F1-model_v4 | HTH-type transcriptional regulator GltC | 0.8275 | 135 | 292 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-A0A3T1DZX0-F1-model_v4 | deleted | 0.8258 | 134 | 299 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar