F473260

General Info

Members Datasets Scaffolds Average Seq Length
659 376 1294 237

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10088744|Ga0307410_100887442
Length 276
Sequence LHFDDTGAAGRHGIDSNPPVQDRFPAFRTALDNGRRLAGDATLFEGFYKVRFQLGAAVGRSVMYARDGRMLGGNSAFAHIGTYEKRDDGVDIVIQTVRHNPDPNYRAMAGTDDATLLATGRADGNRYRFEGSLKELPGVAFHSVMTPIEQDAVPIAGGVGAGGILNGLYSIHIRMLDGVAGGLTGIMLLNEGRILGGDASFYYLGSYTSENGRWKGQILNQEHTPAMGENPIFGGREIGIGFSGTCDEKGALLEATALAGKRSLRMTAVLKLMHGV

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
313 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
314 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
315 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
323 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
324 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
328 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
329 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
334 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
337 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
338 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
339 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
340 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
341 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
342 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
343 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
344 2791355199
345 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
346 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
347 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
348 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
349 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
350 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
351 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
352 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
353 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
354 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
355 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
356 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
357 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
358 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
359 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
360 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
361 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
362 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
363 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
364 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
365 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
366 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
367 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
368 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
369 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
370 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
371 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
372 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
373 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
374 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
375 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
376 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 0
Isolates 6.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.14
Nodule 4.4
Rhizoplane 3.34
Rhizosphere 70.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10088744 3300031852 Bacteria 2190
2 JGI25406J46586_10000281 3300003203 Bacteria 22733
3 rootL2_10035197 3300003322 Bacteria 6888
4 JGI25160J50197_1031852 3300003354 Bacteria 1350
5 JGI25404J52841_10022917 3300003659 Bacteria 1348
6 Ga0055543_1028812 3300004625 Bacteria 977
7 Ga0065165_1000780 3300005262 Bacteria 42673
8 Ga0070676_10188988 3300005328 Bacteria 1343
9 Ga0070683_100136351 3300005329 Bacteria 2324
10 Ga0070680_100012011 3300005336 Bacteria 6719
11 Ga0070680_100035867 3300005336 Bacteria 4005
12 Ga0070689_100648972 3300005340 Bacteria 918
13 Ga0070691_10211773 3300005341 Bacteria 1023
14 Ga0070687_100128144 3300005343 Bacteria 1461
15 Ga0070687_100189393 3300005343 Bacteria 1238
16 Ga0070668_100004427 3300005347 Bacteria 10427
17 Ga0070668_100069820 3300005347 Bacteria 2734
18 Ga0070667_100068727 3300005367 Bacteria 3014
19 Ga0070667_100364275 3300005367 Bacteria 1311
20 Ga0070709_10003412 3300005434 Bacteria 8529
21 Ga0070709_10048106 3300005434 Bacteria 2659
22 Ga0070709_10088552 3300005434 Bacteria 2036
23 Ga0070714_100008226 3300005435 Bacteria 8128
24 Ga0070713_100012323 3300005436 Bacteria 6266
25 Ga0070713_100044873 3300005436 Bacteria 3620
26 Ga0070713_100119074 3300005436 Bacteria 2313
27 Ga0070713_100487424 3300005436 Bacteria 1162
28 Ga0070710_10000481 3300005437 Bacteria 18743
29 Ga0070711_100015478 3300005439 Bacteria 4828
30 Ga0070711_100023942 3300005439 Bacteria 3978
31 Ga0070700_100059919 3300005441 Bacteria 2398
32 Ga0070663_100024749 3300005455 Bacteria 4045
33 Ga0070663_100294194 3300005455 Bacteria 1298
34 Ga0070678_100051598 3300005456 Bacteria 2982
35 Ga0070662_100023503 3300005457 Bacteria 4234
36 Ga0070681_10014221 3300005458 Bacteria 7920
37 Ga0070681_10168200 3300005458 Bacteria 2114
38 Ga0070681_10622741 3300005458 Bacteria 994
39 Ga0070681_10800771 3300005458 Bacteria 859
40 Ga0068867_100022027 3300005459 Bacteria 4552
41 Ga0070685_10282670 3300005466 Bacteria 1111
42 Ga0070706_100319849 3300005467 Bacteria 1447
43 Ga0070698_100024412 3300005471 Bacteria 6310
44 Ga0070679_100014275 3300005530 Bacteria 7626
45 Ga0070679_100051845 3300005530 Bacteria 4087
46 Ga0070679_100058689 3300005530 Bacteria 3834
47 Ga0070679_100257029 3300005530 Bacteria 1702
48 Ga0070684_100016386 3300005535 Bacteria 6056
49 Ga0070684_100325182 3300005535 Bacteria 1413
50 Ga0068853_100074705 3300005539 Bacteria 2957
51 Ga0068853_100240232 3300005539 Bacteria 1660
52 Ga0068853_100361737 3300005539 Bacteria 1352
53 Ga0070672_100022894 3300005543 Bacteria 4597
54 Ga0070672_100174923 3300005543 Bacteria 1787
55 Ga0070696_100355284 3300005546 Bacteria 1136
56 Ga0070693_100184712 3300005547 Bacteria 1345
57 Ga0070665_100055387 3300005548 Bacteria 3977
58 Ga0070665_100069970 3300005548 Bacteria 3516
59 Ga0070665_100216232 3300005548 Bacteria 1917
60 Ga0070665_100374632 3300005548 Bacteria 1431
61 Ga0068855_100009212 3300005563 Bacteria 11925
62 Ga0068855_100140785 3300005563 Bacteria 2750
63 Ga0068855_100142424 3300005563 Bacteria 2731
64 Ga0068855_100499656 3300005563 Bacteria 1322
65 Ga0068855_100505495 3300005563 Bacteria 1313
66 Ga0068854_100299338 3300005578 Bacteria 1301
67 Ga0068854_100322565 3300005578 Bacteria 1256
68 Ga0068854_100322723 3300005578 Bacteria 1256
69 Ga0068854_100721956 3300005578 Bacteria 862
70 Ga0068856_100064451 3300005614 Bacteria 3621
71 Ga0068856_100160646 3300005614 Bacteria 2257
72 Ga0068856_100185506 3300005614 Bacteria 2094
73 Ga0068856_100235458 3300005614 Bacteria 1846
74 Ga0070702_100010378 3300005615 Bacteria 4585
75 Ga0068852_100011773 3300005616 Bacteria 6605
76 Ga0068852_100129219 3300005616 Bacteria 2324
77 Ga0068852_100521336 3300005616 Bacteria 1186
78 Ga0068859_100100349 3300005617 Bacteria 2950
79 Ga0068859_100373581 3300005617 Bacteria 1521
80 Ga0068864_100009206 3300005618 Bacteria 8144
81 Ga0068866_10020587 3300005718 Bacteria 3024
82 Ga0068866_10265073 3300005718 Bacteria 1057
83 Ga0068861_100019200 3300005719 Bacteria 4883
84 Ga0068861_100472666 3300005719 Bacteria 1128
85 Ga0068851_10107770 3300005834 Bacteria 1485
86 Ga0068858_100211471 3300005842 Bacteria 1835
87 Ga0068860_100000210 3300005843 Bacteria 91495
88 Ga0068860_100050997 3300005843 Bacteria 3938
89 Ga0068860_100281358 3300005843 Bacteria 1626
90 Ga0068860_100472009 3300005843 Bacteria 1250
91 Ga0068862_100056434 3300005844 Bacteria 3365
92 Ga0068862_100065432 3300005844 Bacteria 3131
93 Ga0081455_10001807 3300005937 Bacteria 25790
94 Ga0081455_10006641 3300005937 Bacteria 12368
95 Ga0081455_10019881 3300005937 Bacteria 6341
96 Ga0081455_10022228 3300005937 Bacteria 5933
97 Ga0081455_10042247 3300005937 Bacteria 4002
98 Ga0081540_1002695 3300005983 Bacteria 14445
99 Ga0081540_1005053 3300005983 Bacteria 9898
100 Ga0081540_1005406 3300005983 Bacteria 9536
101 Ga0081540_1006654 3300005983 Bacteria 8369
102 Ga0081540_1007202 3300005983 Bacteria 7978
103 Ga0081540_1040804 3300005983 Bacteria 2414
104 Ga0081540_1046557 3300005983 Bacteria 2189
105 Ga0081540_1047694 3300005983 Bacteria 2152
106 Ga0081540_1088580 3300005983 Bacteria 1368
107 Ga0081539_10001902 3300005985 Bacteria 32363
108 Ga0081539_10017089 3300005985 Bacteria 5120
109 Ga0070717_10003071 3300006028 Bacteria 11903
110 Ga0075365_10058844 3300006038 Bacteria 2559
111 Ga0075365_10175380 3300006038 Bacteria 1497
112 Ga0075364_10048221 3300006051 Bacteria 2775
113 Ga0075364_10058757 3300006051 Bacteria 2520
114 Ga0070716_100062135 3300006173 Bacteria 2164
115 Ga0070712_100066018 3300006175 Bacteria 2570
116 Ga0070712_100095956 3300006175 Bacteria 2182
117 Ga0075362_10038875 3300006177 Bacteria 2090
118 Ga0075367_10040989 3300006178 Bacteria 2705
119 Ga0075369_10021793 3300006186 Bacteria 2637
120 Ga0075369_10113460 3300006186 Bacteria 1222
121 Ga0075366_10062243 3300006195 Bacteria 2218
122 Ga0075366_10143193 3300006195 Bacteria 1446
123 Ga0075366_10159348 3300006195 Bacteria 1367
124 Ga0097621_100290069 3300006237 Bacteria 1442
125 Ga0097621_100333022 3300006237 Bacteria 1347
126 Ga0075370_10037080 3300006353 Bacteria 2740
127 Ga0068871_100206750 3300006358 Bacteria 1697
128 Ga0097620_100100347 3300006931 Bacteria 2950
129 Ga0097620_100373547 3300006931 Bacteria 1521
130 Ga0075435_100049691 3300007076 Bacteria 3373
131 Ga0099795_10114182 3300007788 Bacteria 1074
132 Ga0105240_10004178 3300009093 Bacteria 22127
133 Ga0105240_10009326 3300009093 Bacteria 13913
134 Ga0105240_10047043 3300009093 Bacteria 5461
135 Ga0105240_10073286 3300009093 Bacteria 4228
136 Ga0105240_10220784 3300009093 Bacteria 2208
137 Ga0111539_10119427 3300009094 Bacteria 3090
138 Ga0105245_10016807 3300009098 Bacteria 6389
139 Ga0105245_10025000 3300009098 Bacteria 5249
140 Ga0105245_10592191 3300009098 Bacteria 1134
141 Ga0105245_11152303 3300009098 Bacteria 822
142 Ga0105247_10074788 3300009101 Bacteria 2125
143 Ga0105247_10111268 3300009101 Bacteria 1763
144 Ga0105247_10236057 3300009101 Bacteria 1244
145 Ga0105247_10268899 3300009101 Bacteria 1172
146 Ga0114129_10282753 3300009147 Bacteria 2216
147 Ga0105243_10026499 3300009148 Bacteria 4437
148 Ga0105241_10003119 3300009174 Bacteria 12334
149 Ga0105241_10008364 3300009174 Bacteria 7620
150 Ga0105241_10128069 3300009174 Bacteria 2052
151 Ga0105242_10097650 3300009176 Bacteria 2483
152 Ga0105242_10116558 3300009176 Bacteria 2285
153 Ga0105242_10282620 3300009176 Bacteria 1508
154 Ga0105237_10026824 3300009545 Bacteria 5888
155 Ga0105237_10040705 3300009545 Bacteria 4686
156 Ga0105237_10126924 3300009545 Bacteria 2545
157 Ga0105237_10143735 3300009545 Bacteria 2380
158 Ga0105237_10168724 3300009545 Bacteria 2188
159 Ga0105237_10306609 3300009545 Bacteria 1591
160 Ga0105238_10147488 3300009551 Bacteria 2329
161 Ga0105249_10146558 3300009553 Bacteria 2269
162 Ga0105249_10183790 3300009553 Bacteria 2036
163 Ga0105249_10449560 3300009553 Bacteria 1327
164 Ga0099796_10037600 3300010159 Bacteria 1619
165 Ga0105239_10109592 3300010375 Bacteria 3060
166 Ga0105239_10191080 3300010375 Bacteria 2292
167 Ga0105239_10469717 3300010375 Bacteria 1428
168 Ga0105239_10567990 3300010375 Bacteria 1292
169 Ga0105246_10036499 3300011119 Bacteria 3293
170 Ga0105246_10080710 3300011119 Bacteria 2316
171 Ga0157370_10063729 3300013104 Bacteria 3491
172 Ga0157369_10008131 3300013105 Bacteria 12028
173 Ga0157369_10087909 3300013105 Bacteria 3318
174 Ga0157369_10119135 3300013105 Bacteria 2802
175 Ga0157374_10026738 3300013296 Bacteria 5195
176 Ga0157374_10150507 3300013296 Bacteria 2262
177 Ga0157374_10414717 3300013296 Bacteria 1345
178 Ga0157378_10020518 3300013297 Bacteria 5810
179 Ga0157378_10101741 3300013297 Bacteria 2624
180 Ga0163162_10152203 3300013306 Bacteria 2431
181 Ga0157372_10297278 3300013307 Bacteria 1878
182 Ga0157375_10022857 3300013308 Bacteria 5761
183 Ga0157375_10203893 3300013308 Bacteria 2134
184 Ga0157375_11484748 3300013308 Bacteria 800
185 Ga0163163_10248176 3300014325 Bacteria 1830
186 Ga0157380_10213004 3300014326 Bacteria 1723
187 Ga0157380_10235704 3300014326 Bacteria 1647
188 Ga0157377_10117636 3300014745 Bacteria 1606
189 Ga0157376_10328698 3300014969 Bacteria 1456
190 Ga0157376_10367260 3300014969 Bacteria 1382
191 Ga0163161_10088819 3300017792 Bacteria 2285
192 Ga0163161_10178152 3300017792 Bacteria 1628
193 Ga0213875_10009445 3300021388 Bacteria 4941
194 Ga0209148_1000289 3300025254 Bacteria 75390
195 Ga0209233_1008680 3300025261 Bacteria 3127
196 Ga0209233_1020997 3300025261 Bacteria 1701
197 Ga0209455_1009095 3300025272 Bacteria 2637
198 Ga0209758_1000777 3300025297 Bacteria 45841
199 Ga0209758_1001284 3300025297 Bacteria 30947
200 Ga0209758_1033098 3300025297 Bacteria 2084
201 Ga0207426_1029436 3300025302 Bacteria 1810
202 Ga0207682_10198249 3300025893 Bacteria 922
203 Ga0207692_10000165 3300025898 Bacteria 21066
204 Ga0207692_10082655 3300025898 Bacteria 1721
205 Ga0207710_10139973 3300025900 Bacteria 1168
206 Ga0207688_10190520 3300025901 Bacteria 1226
207 Ga0207647_10027276 3300025904 Bacteria 3724
208 Ga0207699_10000199 3300025906 Bacteria 35901
209 Ga0207699_10007069 3300025906 Bacteria 5470
210 Ga0207699_10032089 3300025906 Bacteria 2956
211 Ga0207645_10084122 3300025907 Bacteria 2041
212 Ga0207645_10099595 3300025907 Bacteria 1874
213 Ga0207643_10025781 3300025908 Bacteria 3252
214 Ga0207643_10062378 3300025908 Bacteria 2130
215 Ga0207643_10173701 3300025908 Bacteria 1301
216 Ga0207705_10249950 3300025909 Bacteria 1352
217 Ga0207705_10408986 3300025909 Bacteria 1050
218 Ga0207654_10011446 3300025911 Bacteria 4527
219 Ga0207654_10119221 3300025911 Bacteria 1654
220 Ga0207707_10040473 3300025912 Bacteria 4070
221 Ga0207707_10061122 3300025912 Bacteria 3278
222 Ga0207707_10111938 3300025912 Bacteria 2386
223 Ga0207707_10182498 3300025912 Bacteria 1832
224 Ga0207695_10000015 3300025913 Bacteria 803205
225 Ga0207695_10079546 3300025913 Bacteria 3322
226 Ga0207695_10112898 3300025913 Bacteria 2694
227 Ga0207695_10166995 3300025913 Bacteria 2128
228 Ga0207695_10442821 3300025913 Bacteria 1182
229 Ga0207671_10011040 3300025914 Bacteria 7394
230 Ga0207671_10023218 3300025914 Bacteria 4679
231 Ga0207671_10080071 3300025914 Bacteria 2448
232 Ga0207671_10411347 3300025914 Bacteria 1076
233 Ga0207693_10023034 3300025915 Bacteria 4946
234 Ga0207693_10026405 3300025915 Bacteria 4596
235 Ga0207693_10077340 3300025915 Bacteria 2606
236 Ga0207660_10089490 3300025917 Bacteria 2279
237 Ga0207660_10134474 3300025917 Bacteria 1885
238 Ga0207660_10138825 3300025917 Bacteria 1857
239 Ga0207660_10545925 3300025917 Bacteria 942
240 Ga0207657_10005075 3300025919 Bacteria 13810
241 Ga0207657_10181958 3300025919 Bacteria 1699
242 Ga0207657_10257339 3300025919 Bacteria 1390
243 Ga0207649_10209464 3300025920 Bacteria 1382
244 Ga0207652_10067077 3300025921 Bacteria 3111
245 Ga0207652_10075155 3300025921 Bacteria 2944
246 Ga0207694_10030810 3300025924 Bacteria 4095
247 Ga0207687_10018284 3300025927 Bacteria 4625
248 Ga0207687_10055464 3300025927 Bacteria 2777
249 Ga0207700_10010963 3300025928 Bacteria 5755
250 Ga0207700_10036499 3300025928 Bacteria 3551
251 Ga0207700_10038449 3300025928 Bacteria 3473
252 Ga0207700_10041015 3300025928 Bacteria 3383
253 Ga0207700_10093962 3300025928 Bacteria 2375
254 Ga0207664_10052592 3300025929 Bacteria 3222
255 Ga0207664_10266983 3300025929 Bacteria 1498
256 Ga0207644_10208564 3300025931 Bacteria 1544
257 Ga0207690_10145316 3300025932 Bacteria 1753
258 Ga0207706_10030331 3300025933 Bacteria 4824
259 Ga0207706_10120583 3300025933 Bacteria 2306
260 Ga0207686_10136116 3300025934 Bacteria 1691
261 Ga0207686_10190085 3300025934 Bacteria 1463
262 Ga0207709_10012749 3300025935 Bacteria 4634
263 Ga0207709_10336264 3300025935 Bacteria 1135
264 Ga0207669_10072705 3300025937 Bacteria 2166
265 Ga0207669_10706383 3300025937 Bacteria 829
266 Ga0207665_10007939 3300025939 Bacteria 7007
267 Ga0207691_10038113 3300025940 Bacteria 4448
268 Ga0207691_10115252 3300025940 Bacteria 2386
269 Ga0207711_10137002 3300025941 Bacteria 2199
270 Ga0207689_10041578 3300025942 Bacteria 3804
271 Ga0207661_10219280 3300025944 Bacteria 1680
272 Ga0207679_10124933 3300025945 Bacteria 2055
273 Ga0207679_10370953 3300025945 Bacteria 1253
274 Ga0207667_10037913 3300025949 Bacteria 5151
275 Ga0207667_10266873 3300025949 Bacteria 1750
276 Ga0207667_10534574 3300025949 Bacteria 1187
277 Ga0207667_10578006 3300025949 Bacteria 1134
278 Ga0207667_10775817 3300025949 Bacteria 957
279 Ga0207651_10074954 3300025960 Bacteria 2412
280 Ga0207651_10310180 3300025960 Bacteria 1315
281 Ga0207712_10157140 3300025961 Bacteria 1763
282 Ga0207712_10371233 3300025961 Bacteria 1195
283 Ga0207668_10033501 3300025972 Bacteria 3403
284 Ga0207668_10035433 3300025972 Bacteria 3322
285 Ga0207668_10478388 3300025972 Bacteria 1068
286 Ga0207640_10074441 3300025981 Bacteria 2298
287 Ga0207640_10347757 3300025981 Bacteria 1190
288 Ga0207658_10121431 3300025986 Bacteria 2084
289 Ga0207658_10314760 3300025986 Bacteria 1353
290 Ga0207677_10025484 3300026023 Bacteria 3691
291 Ga0207703_10018182 3300026035 Bacteria 5489
292 Ga0207639_10024942 3300026041 Bacteria 4332
293 Ga0207639_10043107 3300026041 Bacteria 3386
294 Ga0207639_10201973 3300026041 Bacteria 1705
295 Ga0207639_10420837 3300026041 Bacteria 1208
296 Ga0207678_10022972 3300026067 Bacteria 5458
297 Ga0207678_10110358 3300026067 Bacteria 2347
298 Ga0207678_10194695 3300026067 Bacteria 1733
299 Ga0207678_10327772 3300026067 Bacteria 1318
300 Ga0207708_10078600 3300026075 Bacteria 2533
301 Ga0207702_10149700 3300026078 Bacteria 2122
302 Ga0207702_10340161 3300026078 Bacteria 1433
303 Ga0207702_10630765 3300026078 Bacteria 1053
304 Ga0207641_10134604 3300026088 Bacteria 2223
305 Ga0207648_10025520 3300026089 Bacteria 5263
306 Ga0207676_10633070 3300026095 Bacteria 1030
307 Ga0207675_100055943 3300026118 Bacteria 3681
308 Ga0207675_100125285 3300026118 Bacteria 2433
309 Ga0207683_10036388 3300026121 Bacteria 4286
310 Ga0207683_10044441 3300026121 Bacteria 3883
311 Ga0207683_10098127 3300026121 Bacteria 2614
312 Ga0207683_10138074 3300026121 Bacteria 2195
313 Ga0207698_10029463 3300026142 Bacteria 3932
314 Ga0207698_10046140 3300026142 Bacteria 3288
315 Ga0207698_10701489 3300026142 Bacteria 1007
316 Ga0268266_10003304 3300028379 Bacteria 16206
317 Ga0268266_10023407 3300028379 Bacteria 5260
318 Ga0268266_10241629 3300028379 Bacteria 1667
319 Ga0268265_10230924 3300028380 Bacteria 1626
320 Ga0268264_10000233 3300028381 Bacteria 106118
321 Ga0268264_10050362 3300028381 Bacteria 3468
322 Ga0307517_10000063 3300028786 Bacteria 144304
323 Ga0307515_10055850 3300028794 Bacteria 5756
324 Ga0307515_10147060 3300028794 Bacteria 2489
325 Ga0307515_10334448 3300028794 Bacteria 1171
326 Ga0307513_10174602 3300031456 Bacteria 2021
327 Ga0307513_10331794 3300031456 Bacteria 1275
328 Ga0307509_10053942 3300031507 Bacteria 4282
329 Ga0307509_10180481 3300031507 Bacteria 1976
330 Ga0307408_100383513 3300031548 Bacteria 1202
331 Ga0307508_10000010 3300031616 Bacteria 255747
332 Ga0307508_10006128 3300031616 Bacteria 11349
333 Ga0307508_10231959 3300031616 Bacteria 1444
334 Ga0307508_10417800 3300031616 Bacteria 933
335 Ga0307413_10033446 3300031824 Bacteria 2928
336 Ga0307410_10199197 3300031852 Bacteria 1528
337 Ga0307406_10256381 3300031901 Bacteria 1321
338 Ga0307416_100112376 3300032002 Bacteria 2404
339 Ga0307416_100329478 3300032002 Bacteria 1534
340 Ga0307416_100398288 3300032002 Bacteria 1413
341 Ga0307416_101200870 3300032002 Bacteria 864
342 Ga0307411_10365118 3300032005 Bacteria 1182
343 Ga0307415_100030758 3300032126 Bacteria 3450
344 Ga0307415_100068490 3300032126 Bacteria 2484
345 Ga0307507_10065171 3300033179 Bacteria 3353
346 Ga0307510_10004116 3300033180 Bacteria 17072
347 Ga0307510_10214756 3300033180 Bacteria 1442
348 Ga0373953_0111647 3300035117 Bacteria 1156
349 Ga0373954_0077398 3300035118 Bacteria 1586
350 Ga0373957_0047779 3300035120 Bacteria 1629
351 Ga0373960_0095798 3300035121 Bacteria 955
352 Ga0373943_0004237 3300035170 Bacteria 6503
353 Ga0373955_0228132 3300035172 Bacteria 1113
354 Ga0373924_0011093 3300035410 Bacteria 3338
355 Ga0373927_0012630 3300035695 Bacteria 5618
356 Ga0373927_0146685 3300035695 Bacteria 1545
357 Ga0373947_0018151 3300035725 Bacteria 4048
358 Ga0373925_0023130 3300037068 Bacteria 4535
359 Ga0373925_0083022 3300037068 Bacteria 2439
360 Ga0373925_0089447 3300037068 Bacteria 2352
361 Ga0373925_0282557 3300037068 Bacteria 1337
362 Ga0373925_0362194 3300037068 Bacteria 1179
363 Ga0373925_0774027 3300037068 Bacteria 791
364 Ga0395899_0190638 3300037312 Bacteria 1435
365 Ga0395900_0001114 3300037418 Bacteria 34044
366 Ga0395898_0025991 3300037466 Bacteria 5896
367 Ga0395905_0053830 3300037471 Bacteria 3766
368 Ga0436364_0040477 3300037853 Bacteria 8459
369 Ga0436364_0206741 3300037853 Bacteria 3240
370 Ga0436364_1035392 3300037853 Bacteria 2478
371 Ga0395901_0010900 3300038443 Bacteria 9214
372 Ga0395901_0264898 3300038443 Bacteria 1788
373 Ga0395901_0849791 3300038443 Bacteria 898
374 Ga0436365_0426367 3300039437 Bacteria 885
375 Ga0436365_0468195 3300039437 Bacteria 13406
376 Ga0436365_0572994 3300039437 Bacteria 1361
377 Ga0436365_1160814 3300039437 Bacteria 3151
378 Ga0436363_0409584 3300039450 Bacteria 949
379 Ga0451853_0453971 3300041512 Bacteria 1240
380 Ga0466963_0107173 3300044694 Bacteria 1916
381 Ga0466963_0151728 3300044694 Bacteria 1609
382 Ga0466971_0077874 3300044719 Bacteria 1510
383 Ga0466960_0155480 3300044901 Bacteria 1225
384 Ga0466959_0032198 3300045049 Bacteria 3881
385 Ga0495603_0020993 3300046455 Bacteria 3955
386 Ga0495603_0037719 3300046455 Bacteria 2899
387 Ga0495603_0304792 3300046455 Bacteria 915
388 Ga0495629_0217842 3300046459 Bacteria 1317
389 Ga0495629_0405882 3300046459 Bacteria 926
390 Ga0495651_0073158 3300046462 Bacteria 2602
391 Ga0495653_0102356 3300046463 Bacteria 2073
392 Ga0495653_0292508 3300046463 Bacteria 1065
393 Ga0495580_0082638 3300046472 Bacteria 2238
394 Ga0495582_0049891 3300046473 Bacteria 2305
395 Ga0495605_0035316 3300046474 Bacteria 2527
396 Ga0495639_0021448 3300046475 Bacteria 2828
397 Ga0495662_0109664 3300046476 Bacteria 1352
398 Ga0495664_0031011 3300046477 Bacteria 3133
399 Ga0495664_0038425 3300046477 Bacteria 2825
400 Ga0495585_0117973 3300046492 Bacteria 1406
401 Ga0495594_0027988 3300046499 Bacteria 3040
402 Ga0495606_0006147 3300046507 Bacteria 11189
403 Ga0495606_0079931 3300046507 Bacteria 2035
404 Ga0495608_0078684 3300046511 Bacteria 2144
405 Ga0495616_0104978 3300046513 Bacteria 1320
406 Ga0495618_0174255 3300046514 Bacteria 1368
407 Ga0495618_0243548 3300046514 Bacteria 1130
408 Ga0495628_0172251 3300046516 Bacteria 1641
409 Ga0495628_0459095 3300046516 Bacteria 924
410 Ga0495630_0299640 3300046517 Bacteria 1228
411 Ga0495631_0061970 3300046518 Bacteria 1621
412 Ga0495644_0039016 3300046523 Bacteria 1791
413 Ga0495648_0072853 3300046524 Bacteria 1986
414 Ga0495648_0239198 3300046524 Bacteria 883
415 Ga0495642_0077132 3300046528 Bacteria 1399
416 Ga0495652_0249929 3300046529 Bacteria 1315
417 Ga0495665_0062129 3300046531 Bacteria 1972
418 Ga0495640_0076367 3300046533 Bacteria 2235
419 Ga0495640_0128869 3300046533 Bacteria 1639
420 Ga0495586_0369527 3300046535 Bacteria 824
421 Ga0495587_0051090 3300046536 Bacteria 2445
422 Ga0495587_0206765 3300046536 Bacteria 1109
423 Ga0495609_0043529 3300046538 Bacteria 2016
424 Ga0495645_0053215 3300046543 Bacteria 2943
425 Ga0495622_0030911 3300046557 Bacteria 2503
426 Ga0495622_0039401 3300046557 Bacteria 2201
427 Ga0495622_0084380 3300046557 Bacteria 1461
428 Ga0495633_0040665 3300046558 Bacteria 2214
429 Ga0495633_0239485 3300046558 Bacteria 829
430 Ga0495667_0080513 3300046559 Bacteria 2117
431 Ga0495656_0018687 3300046615 Bacteria 2667
432 Ga0495656_0097988 3300046615 Bacteria 1351
433 Ga0495668_0085045 3300046616 Bacteria 1735
434 Ga0495668_0197554 3300046616 Bacteria 1101
435 Ga0495668_0212991 3300046616 Bacteria 1058
436 Ga0495668_0223269 3300046616 Bacteria 1031
437 Ga0495634_0047590 3300046642 Bacteria 2889
438 Ga0495611_0159558 3300046648 Bacteria 1053
439 Ga0495625_0199438 3300046660 Bacteria 1321
440 Ga0495625_0277230 3300046660 Bacteria 1080
441 Ga0495625_0289746 3300046660 Bacteria 1051
442 Ga0495635_0149062 3300046663 Bacteria 1592
443 Ga0495659_0110624 3300046664 Bacteria 1072
444 Ga0495588_0016081 3300046674 Bacteria 3611
445 Ga0495657_0008189 3300046675 Bacteria 8010
446 Ga0495599_0008361 3300046678 Bacteria 6291
447 Ga0495599_0063709 3300046678 Bacteria 2304
448 Ga0495599_0274899 3300046678 Bacteria 1021
449 Ga0495623_0095572 3300046679 Bacteria 1817
450 Ga0495646_0023587 3300046680 Bacteria 3873
451 Ga0495658_0114246 3300046683 Bacteria 1627
452 Ga0495658_0115979 3300046683 Bacteria 1615
453 Ga0495669_0004111 3300046684 Bacteria 5988
454 Ga0495669_0133278 3300046684 Bacteria 1170
455 Ga0495669_0300573 3300046684 Bacteria 773
456 Ga0495613_0244122 3300046689 Bacteria 1255
457 Ga0495624_0020095 3300046690 Bacteria 4449
458 Ga0495624_0039050 3300046690 Bacteria 3045
459 Ga0495649_0149285 3300046694 Bacteria 1228
460 Ga0495600_0030992 3300046809 Bacteria 3463
461 Ga0495581_0154937 3300047315 Bacteria 1339
462 Ga0495604_0065122 3300047317 Bacteria 2775
463 Ga0495604_0209393 3300047317 Bacteria 1348
464 Ga0495674_0210929 3300047319 Bacteria 1608
465 Ga0495672_0053900 3300047320 Bacteria 2354
466 Ga0495676_0288056 3300047321 Bacteria 1110
467 Ga0495680_0020556 3300047322 Bacteria 5549
468 Ga0495683_0074543 3300047323 Bacteria 1663
469 Ga0495675_0065077 3300047444 Bacteria 2306
470 Ga0495677_0084680 3300047445 Bacteria 1191
471 Ga0495684_0101814 3300047471 Bacteria 2171
472 Ga0495686_0054922 3300047472 Bacteria 2493
473 Ga0495686_0084252 3300047472 Bacteria 1938
474 Ga0495686_0206803 3300047472 Bacteria 1123
475 Ga0495593_0120784 3300047673 Bacteria 1333
476 Ga0495602_0036756 3300048088 Bacteria 4553
477 Ga0496100_0717480 3300048903 Bacteria 781
478 Ga0496101_0330732 3300048904 Bacteria 1196
479 Ga0496101_0637795 3300048904 Bacteria 842
480 Ga0496102_0013151 3300048905 Bacteria 7160
481 Ga0496102_0187514 3300048905 Bacteria 1949
482 Ga0496103_0046583 3300048906 Bacteria 2678
483 Ga0496104_0027176 3300048907 Bacteria 5294
484 Ga0496104_0039416 3300048907 Bacteria 4424
485 Ga0496104_0113081 3300048907 Bacteria 2604
486 Ga0496105_0012801 3300048908 Bacteria 6648
487 Ga0496105_0626854 3300048908 Bacteria 832
488 Ga0496106_0129944 3300048909 Bacteria 1975
489 Ga0496109_0207314 3300048912 Bacteria 1843
490 Ga0496109_0302169 3300048912 Bacteria 1509
491 Ga0496111_0505437 3300048914 Bacteria 889
492 Ga0496112_0000009 3300048915 Bacteria 299708
493 Ga0496112_0202013 3300048915 Bacteria 1947
494 Ga0496112_0584652 3300048915 Bacteria 1049
495 Ga0496113_0029108 3300048916 Bacteria 3984
496 Ga0496114_0107633 3300048917 Bacteria 2386
497 Ga0496114_0181557 3300048917 Bacteria 1838
498 Ga0496115_0507974 3300048918 Bacteria 968
499 Ga0496117_0029200 3300048920 Bacteria 4255
500 Ga0496118_0058758 3300048921 Bacteria 2870
501 Ga0496119_0004533 3300048922 Bacteria 13787
502 Ga0496119_0106482 3300048922 Bacteria 1565
503 Ga0496120_0059361 3300048923 Bacteria 2144
504 Ga0496121_0003715 3300048924 Bacteria 21404
505 Ga0496121_0049355 3300048924 Bacteria 3569
506 Ga0496121_0169743 3300048924 Bacteria 1586
507 Ga0496121_0264538 3300048924 Bacteria 1185
508 Ga0496124_0217912 3300048927 Bacteria 1438
509 Ga0496125_0100754 3300048928 Bacteria 2128
510 Ga0496125_0146899 3300048928 Bacteria 1628
511 Ga0496126_0014485 3300048929 Bacteria 7969
512 Ga0496126_0015165 3300048929 Bacteria 7761
513 Ga0496126_0047565 3300048929 Bacteria 3926
514 Ga0496126_0151729 3300048929 Bacteria 1985
515 Ga0496126_0351760 3300048929 Bacteria 1205
516 Ga0495682_0018787 3300049460 Bacteria 2603
517 Ga0501032_0052542 3300049569 Bacteria 2746
518 Ga0501033_0196784 3300049570 Bacteria 1441
519 Ga0501036_0222730 3300049572 Bacteria 1584
520 Ga0501037_0076099 3300049573 Bacteria 2437
521 Ga0501038_0319702 3300049574 Bacteria 1214
522 Ga0501043_0047729 3300049579 Bacteria 3366
523 Ga0501046_0083005 3300049580 Bacteria 2474
524 Ga0501047_0016152 3300049581 Bacteria 7122
525 Ga0501068_0065328 3300049584 Bacteria 2215
526 Ga0501069_0084379 3300049585 Bacteria 1792
527 Ga0501070_0083824 3300049586 Bacteria 2639
528 Ga0501071_0291367 3300049587 Bacteria 1236
529 Ga0501074_0110043 3300049590 Bacteria 1971
530 Ga0501076_0208707 3300049592 Bacteria 1596
531 Ga0501080_0012457 3300049742 Bacteria 7796
532 Ga0501080_0024858 3300049742 Bacteria 5555
533 Ga0501080_0389238 3300049742 Bacteria 1255
534 Ga0501035_0343788 3300049822 Bacteria 1249
535 nmdc:mga03683_11007_c1 3300050489 Bacteria 3259
536 nmdc:mga03683_40684_c1 3300050489 Bacteria 1907
537 nmdc:mga03n38_52971_c1 3300050490 Bacteria 1818
538 nmdc:mga03n38_95891_c1 3300050490 Bacteria 1422
539 nmdc:mga00v17_175906_c1 3300050491 Bacteria 1380
540 nmdc:mga00v17_222858_c1 3300050491 Bacteria 1221
541 nmdc:mga00v17_27207_c1 3300050491 Bacteria 3337
542 nmdc:mga00v17_81022_c1 3300050491 Bacteria 2027
543 nmdc:mga0yw44_115125_c1 3300050492 Bacteria 1727
544 nmdc:mga0yw44_48505_c1 3300050492 Bacteria 2561
545 nmdc:mga0yw44_6965_c1 3300050492 Bacteria 5520
546 nmdc:mga0yw44_82697_c1 3300050492 Bacteria 2015
547 nmdc:mga0k408_74589_c1 3300050493 Bacteria 1982
548 nmdc:mga06z11_204399_c1 3300050494 Bacteria 1148
549 nmdc:mga06z11_81135_c1 3300050494 Bacteria 1741
550 nmdc:mga04h51_23613_c1 3300050495 Bacteria 1874
551 nmdc:mga07m45_159560_c1 3300050496 Bacteria 1309
552 nmdc:mga07m45_311544_c1 3300050496 Bacteria 915
553 nmdc:mga07m45_58157_c1 3300050496 Bacteria 2187
554 nmdc:mga0qj67_386138_c1 3300050509 Bacteria 1130
555 nmdc:mga08y16_204237_c1 3300050511 Bacteria 2047
556 nmdc:mga08y16_305412_c1 3300050511 Bacteria 1639
557 nmdc:mga0n895_241145_c1 3300050512 Bacteria 1834
558 nmdc:mga0n895_445654_c1 3300050512 Bacteria 1307
559 nmdc:mga0n895_745806_c1 3300050512 Bacteria 972
560 nmdc:mga0a205_129931_c1 3300050515 Bacteria 2419
561 nmdc:mga0sz30_18563_c1 3300050516 Bacteria 2785
562 Ga0495601_0039388 3300053077 Bacteria 2960
563 Ga0495601_0135822 3300053077 Bacteria 1603
564 Ga0495612_0112909 3300053078 Bacteria 1164
565 Ga0500610_0105953 3300053079 Bacteria 1450
566 Ga0500635_0007803 3300053080 Bacteria 2912
567 Ga0500643_096997 3300053087 Bacteria 801
568 Ga0500647_0251788 3300053091 Bacteria 776
569 Ga0500651_0002838 3300053093 Bacteria 9308
570 Ga0500566_0022201 3300053094 Bacteria 3729
571 Ga0500555_031064 3300053103 Bacteria 1514
572 Ga0500562_011319 3300053108 Bacteria 2264
573 Ga0500569_126802 3300053109 Bacteria 852
574 Ga0500592_015065 3300053116 Bacteria 1240
575 Ga0500595_002029 3300053119 Bacteria 10346
576 Ga0500595_003254 3300053119 Bacteria 7668
577 Ga0500595_005484 3300053119 Bacteria 5535
578 Ga0500595_010151 3300053119 Bacteria 3756
579 Ga0500595_047000 3300053119 Bacteria 1354
580 Ga0500595_093592 3300053119 Bacteria 867
581 Ga0500607_044099 3300053121 Bacteria 2400
582 Ga0500642_0047746 3300053130 Bacteria 1877
583 Ga0500559_0033836 3300053136 Bacteria 2201
584 Ga0500568_0077509 3300053139 Bacteria 1265
585 Ga0500579_123958 3300053143 Bacteria 1239
586 Ga0500586_002441 3300053145 Bacteria 4199
587 Ga0500589_047982 3300053147 Bacteria 1986
588 Ga0500603_003810 3300053150 Bacteria 3230
589 Ga0500603_075146 3300053150 Bacteria 969
590 Ga0500604_0018495 3300053151 Bacteria 1942
591 Ga0500633_0091779 3300053160 Bacteria 1110
592 Ga0500634_0121345 3300053161 Bacteria 1271
593 Ga0500638_029082 3300053162 Bacteria 2657
594 Ga0500636_0161042 3300053177 Bacteria 1223
595 Ga0500637_0000158 3300053178 Bacteria 24925
596 Ga0500637_0102458 3300053178 Bacteria 1660
597 Ga0500645_013128 3300053730 Bacteria 2664
598 Ga0500609_001975 3300053731 Bacteria 2958
599 Ga0500661_000622 3300055283 Bacteria 6610
600 Ga0501082_0213210 3300060353 Bacteria 1680
601 Ga0530510_0215728 3300061734 Bacteria 1426
602 Ga0530510_0242898 3300061734 Bacteria 1341
603 2513638942 2513237094 Bacteria 8789602
604 2513675862 2513237098 Bacteria 9902361
605 2513692551 2513237101 Bacteria 7952346
606 2513692555 2513237101 Bacteria 7952346
607 2513718667 2513237104 Bacteria 10034502
608 2513889153 2513237141 Bacteria 8496279
609 2524468910 2524023210 Bacteria 9029266
610 2723845058 2721755755 Bacteria 8322773
611 2723845062 2721755755 Bacteria 8322773
612 2793082071
613 2824713257 2824704595 Bacteria 9667483
614 2824758262 2824753945 Bacteria 9787441
615 2824768243 2824763712 Bacteria 9792355
616 2844319118 2844315083 Bacteria 8138177
617 2874605220 2874604998 Bacteria 7834745
618 2874605224 2874604998 Bacteria 7834745
619 2876766812 2876761206 Bacteria 10111113
620 2876814291 2876808645 Bacteria 8824342
621 2879111216 2879110137 Bacteria 8907982
622 2885386578 2885383462 Bacteria 9473874
623 2889039814 2889033259 Bacteria 9099371
624 2903728955 2903727486 Bacteria 8281579
625 2903773989 2903768456 Bacteria 9749579
626 2904695850 2904690495 Bacteria 9412302
627 2904714685 2904711408 Bacteria 9771557
628 2906607127 2906602504 Bacteria 8295279
629 2906633306 2906626472 Bacteria 8826946
630 2908761151 2908756301 Bacteria 8864324
631 2922365378 2922361189 Bacteria 7436256
632 2932799908 2932794094 Bacteria 7915132
633 2932802747 2932801729 Bacteria 7987968
634 2935889841 2935883170 Bacteria 7964738
635 2935965809 2935959822 Bacteria 7869783
636 2941532851 2941531003 Bacteria 7653939
637 3005722352 3005718088 Bacteria 8283608
638 8006926847 8006926726 Bacteria 6749210
639 8006926852 8006926726 Bacteria 6749210
640 8006965769 8006964411 Bacteria 8966052
641 8006987020 8006984368 Bacteria 9651211
642 8006996008 8006994254 Bacteria 8309700
643 8006996012 8006994254 Bacteria 8309700
644 8016591714 8016583857 Bacteria 10421953
645 8056673841 8056673599 Bacteria 7871253
646 8056686684 8056681323 Bacteria 8472857
647 8056968067 8056967851 Bacteria 9038162
648 Ga0307410_10088744
649 JGI25406J46586_10000281
650 rootL2_10035197
651 JGI25160J50197_1031852
652 JGI25404J52841_10022917
653 Ga0055543_1028812
654 Ga0065165_1000780
655 Ga0070676_10188988
656 Ga0070683_100136351
657 Ga0070680_100012011
658 Ga0070680_100035867
659 Ga0070689_100648972
660 Ga0070691_10211773
661 Ga0070687_100128144
662 Ga0070687_100189393
663 Ga0070668_100004427
664 Ga0070668_100069820
665 Ga0070667_100068727
666 Ga0070667_100364275
667 Ga0070709_10003412
668 Ga0070709_10048106
669 Ga0070709_10088552
670 Ga0070714_100008226
671 Ga0070713_100012323
672 Ga0070713_100044873
673 Ga0070713_100119074
674 Ga0070713_100487424
675 Ga0070710_10000481
676 Ga0070711_100015478
677 Ga0070711_100023942
678 Ga0070700_100059919
679 Ga0070663_100024749
680 Ga0070663_100294194
681 Ga0070678_100051598
682 Ga0070662_100023503
683 Ga0070681_10014221
684 Ga0070681_10168200
685 Ga0070681_10622741
686 Ga0070681_10800771
687 Ga0068867_100022027
688 Ga0070685_10282670
689 Ga0070706_100319849
690 Ga0070698_100024412
691 Ga0070679_100014275
692 Ga0070679_100051845
693 Ga0070679_100058689
694 Ga0070679_100257029
695 Ga0070684_100016386
696 Ga0070684_100325182
697 Ga0068853_100074705
698 Ga0068853_100240232
699 Ga0068853_100361737
700 Ga0070672_100022894
701 Ga0070672_100174923
702 Ga0070696_100355284
703 Ga0070693_100184712
704 Ga0070665_100055387
705 Ga0070665_100069970
706 Ga0070665_100216232
707 Ga0070665_100374632
708 Ga0068855_100009212
709 Ga0068855_100140785
710 Ga0068855_100142424
711 Ga0068855_100499656
712 Ga0068855_100505495
713 Ga0068854_100299338
714 Ga0068854_100322565
715 Ga0068854_100322723
716 Ga0068854_100721956
717 Ga0068856_100064451
718 Ga0068856_100160646
719 Ga0068856_100185506
720 Ga0068856_100235458
721 Ga0070702_100010378
722 Ga0068852_100011773
723 Ga0068852_100129219
724 Ga0068852_100521336
725 Ga0068859_100100349
726 Ga0068859_100373581
727 Ga0068864_100009206
728 Ga0068866_10020587
729 Ga0068866_10265073
730 Ga0068861_100019200
731 Ga0068861_100472666
732 Ga0068851_10107770
733 Ga0068858_100211471
734 Ga0068860_100000210
735 Ga0068860_100050997
736 Ga0068860_100281358
737 Ga0068860_100472009
738 Ga0068862_100056434
739 Ga0068862_100065432
740 Ga0081455_10001807
741 Ga0081455_10006641
742 Ga0081455_10019881
743 Ga0081455_10022228
744 Ga0081455_10042247
745 Ga0081540_1002695
746 Ga0081540_1005053
747 Ga0081540_1005406
748 Ga0081540_1006654
749 Ga0081540_1007202
750 Ga0081540_1040804
751 Ga0081540_1046557
752 Ga0081540_1047694
753 Ga0081540_1088580
754 Ga0081539_10001902
755 Ga0081539_10017089
756 Ga0070717_10003071
757 Ga0075365_10058844
758 Ga0075365_10175380
759 Ga0075364_10048221
760 Ga0075364_10058757
761 Ga0070716_100062135
762 Ga0070712_100066018
763 Ga0070712_100095956
764 Ga0075362_10038875
765 Ga0075367_10040989
766 Ga0075369_10021793
767 Ga0075369_10113460
768 Ga0075366_10062243
769 Ga0075366_10143193
770 Ga0075366_10159348
771 Ga0097621_100290069
772 Ga0097621_100333022
773 Ga0075370_10037080
774 Ga0068871_100206750
775 Ga0097620_100100347
776 Ga0097620_100373547
777 Ga0075435_100049691
778 Ga0099795_10114182
779 Ga0105240_10004178
780 Ga0105240_10009326
781 Ga0105240_10047043
782 Ga0105240_10073286
783 Ga0105240_10220784
784 Ga0111539_10119427
785 Ga0105245_10016807
786 Ga0105245_10025000
787 Ga0105245_10592191
788 Ga0105245_11152303
789 Ga0105247_10074788
790 Ga0105247_10111268
791 Ga0105247_10236057
792 Ga0105247_10268899
793 Ga0114129_10282753
794 Ga0105243_10026499
795 Ga0105241_10003119
796 Ga0105241_10008364
797 Ga0105241_10128069
798 Ga0105242_10097650
799 Ga0105242_10116558
800 Ga0105242_10282620
801 Ga0105237_10026824
802 Ga0105237_10040705
803 Ga0105237_10126924
804 Ga0105237_10143735
805 Ga0105237_10168724
806 Ga0105237_10306609
807 Ga0105238_10147488
808 Ga0105249_10146558
809 Ga0105249_10183790
810 Ga0105249_10449560
811 Ga0099796_10037600
812 Ga0105239_10109592
813 Ga0105239_10191080
814 Ga0105239_10469717
815 Ga0105239_10567990
816 Ga0105246_10036499
817 Ga0105246_10080710
818 Ga0157370_10063729
819 Ga0157369_10008131
820 Ga0157369_10087909
821 Ga0157369_10119135
822 Ga0157374_10026738
823 Ga0157374_10150507
824 Ga0157374_10414717
825 Ga0157378_10020518
826 Ga0157378_10101741
827 Ga0163162_10152203
828 Ga0157372_10297278
829 Ga0157375_10022857
830 Ga0157375_10203893
831 Ga0157375_11484748
832 Ga0163163_10248176
833 Ga0157380_10213004
834 Ga0157380_10235704
835 Ga0157377_10117636
836 Ga0157376_10328698
837 Ga0157376_10367260
838 Ga0163161_10088819
839 Ga0163161_10178152
840 Ga0213875_10009445
841 Ga0209148_1000289
842 Ga0209233_1008680
843 Ga0209233_1020997
844 Ga0209455_1009095
845 Ga0209758_1000777
846 Ga0209758_1001284
847 Ga0209758_1033098
848 Ga0207426_1029436
849 Ga0207682_10198249
850 Ga0207692_10000165
851 Ga0207692_10082655
852 Ga0207710_10139973
853 Ga0207688_10190520
854 Ga0207647_10027276
855 Ga0207699_10000199
856 Ga0207699_10007069
857 Ga0207699_10032089
858 Ga0207645_10084122
859 Ga0207645_10099595
860 Ga0207643_10025781
861 Ga0207643_10062378
862 Ga0207643_10173701
863 Ga0207705_10249950
864 Ga0207705_10408986
865 Ga0207654_10011446
866 Ga0207654_10119221
867 Ga0207707_10040473
868 Ga0207707_10061122
869 Ga0207707_10111938
870 Ga0207707_10182498
871 Ga0207695_10000015
872 Ga0207695_10079546
873 Ga0207695_10112898
874 Ga0207695_10166995
875 Ga0207695_10442821
876 Ga0207671_10011040
877 Ga0207671_10023218
878 Ga0207671_10080071
879 Ga0207671_10411347
880 Ga0207693_10023034
881 Ga0207693_10026405
882 Ga0207693_10077340
883 Ga0207660_10089490
884 Ga0207660_10134474
885 Ga0207660_10138825
886 Ga0207660_10545925
887 Ga0207657_10005075
888 Ga0207657_10181958
889 Ga0207657_10257339
890 Ga0207649_10209464
891 Ga0207652_10067077
892 Ga0207652_10075155
893 Ga0207694_10030810
894 Ga0207687_10018284
895 Ga0207687_10055464
896 Ga0207700_10010963
897 Ga0207700_10036499
898 Ga0207700_10038449
899 Ga0207700_10041015
900 Ga0207700_10093962
901 Ga0207664_10052592
902 Ga0207664_10266983
903 Ga0207644_10208564
904 Ga0207690_10145316
905 Ga0207706_10030331
906 Ga0207706_10120583
907 Ga0207686_10136116
908 Ga0207686_10190085
909 Ga0207709_10012749
910 Ga0207709_10336264
911 Ga0207669_10072705
912 Ga0207669_10706383
913 Ga0207665_10007939
914 Ga0207691_10038113
915 Ga0207691_10115252
916 Ga0207711_10137002
917 Ga0207689_10041578
918 Ga0207661_10219280
919 Ga0207679_10124933
920 Ga0207679_10370953
921 Ga0207667_10037913
922 Ga0207667_10266873
923 Ga0207667_10534574
924 Ga0207667_10578006
925 Ga0207667_10775817
926 Ga0207651_10074954
927 Ga0207651_10310180
928 Ga0207712_10157140
929 Ga0207712_10371233
930 Ga0207668_10033501
931 Ga0207668_10035433
932 Ga0207668_10478388
933 Ga0207640_10074441
934 Ga0207640_10347757
935 Ga0207658_10121431
936 Ga0207658_10314760
937 Ga0207677_10025484
938 Ga0207703_10018182
939 Ga0207639_10024942
940 Ga0207639_10043107
941 Ga0207639_10201973
942 Ga0207639_10420837
943 Ga0207678_10022972
944 Ga0207678_10110358
945 Ga0207678_10194695
946 Ga0207678_10327772
947 Ga0207708_10078600
948 Ga0207702_10149700
949 Ga0207702_10340161
950 Ga0207702_10630765
951 Ga0207641_10134604
952 Ga0207648_10025520
953 Ga0207676_10633070
954 Ga0207675_100055943
955 Ga0207675_100125285
956 Ga0207683_10036388
957 Ga0207683_10044441
958 Ga0207683_10098127
959 Ga0207683_10138074
960 Ga0207698_10029463
961 Ga0207698_10046140
962 Ga0207698_10701489
963 Ga0268266_10003304
964 Ga0268266_10023407
965 Ga0268266_10241629
966 Ga0268265_10230924
967 Ga0268264_10000233
968 Ga0268264_10050362
969 Ga0307517_10000063
970 Ga0307515_10055850
971 Ga0307515_10147060
972 Ga0307515_10334448
973 Ga0307513_10174602
974 Ga0307513_10331794
975 Ga0307509_10053942
976 Ga0307509_10180481
977 Ga0307408_100383513
978 Ga0307508_10000010
979 Ga0307508_10006128
980 Ga0307508_10231959
981 Ga0307508_10417800
982 Ga0307413_10033446
983 Ga0307410_10199197
984 Ga0307406_10256381
985 Ga0307416_100112376
986 Ga0307416_100329478
987 Ga0307416_100398288
988 Ga0307416_101200870
989 Ga0307411_10365118
990 Ga0307415_100030758
991 Ga0307415_100068490
992 Ga0307507_10065171
993 Ga0307510_10004116
994 Ga0307510_10214756
995 Ga0373953_0111647
996 Ga0373954_0077398
997 Ga0373957_0047779
998 Ga0373960_0095798
999 Ga0373943_0004237
1000 Ga0373955_0228132
1001 Ga0373924_0011093
1002 Ga0373927_0012630
1003 Ga0373927_0146685
1004 Ga0373947_0018151
1005 Ga0373925_0023130
1006 Ga0373925_0083022
1007 Ga0373925_0089447
1008 Ga0373925_0282557
1009 Ga0373925_0362194
1010 Ga0373925_0774027
1011 Ga0395899_0190638
1012 Ga0395900_0001114
1013 Ga0395898_0025991
1014 Ga0395905_0053830
1015 Ga0436364_0040477
1016 Ga0436364_0206741
1017 Ga0436364_1035392
1018 Ga0395901_0010900
1019 Ga0395901_0264898
1020 Ga0395901_0849791
1021 Ga0436365_0426367
1022 Ga0436365_0468195
1023 Ga0436365_0572994
1024 Ga0436365_1160814
1025 Ga0436363_0409584
1026 Ga0451853_0453971
1027 Ga0466963_0107173
1028 Ga0466963_0151728
1029 Ga0466971_0077874
1030 Ga0466960_0155480
1031 Ga0466959_0032198
1032 Ga0495603_0020993
1033 Ga0495603_0037719
1034 Ga0495603_0304792
1035 Ga0495629_0217842
1036 Ga0495629_0405882
1037 Ga0495651_0073158
1038 Ga0495653_0102356
1039 Ga0495653_0292508
1040 Ga0495580_0082638
1041 Ga0495582_0049891
1042 Ga0495605_0035316
1043 Ga0495639_0021448
1044 Ga0495662_0109664
1045 Ga0495664_0031011
1046 Ga0495664_0038425
1047 Ga0495585_0117973
1048 Ga0495594_0027988
1049 Ga0495606_0006147
1050 Ga0495606_0079931
1051 Ga0495608_0078684
1052 Ga0495616_0104978
1053 Ga0495618_0174255
1054 Ga0495618_0243548
1055 Ga0495628_0172251
1056 Ga0495628_0459095
1057 Ga0495630_0299640
1058 Ga0495631_0061970
1059 Ga0495644_0039016
1060 Ga0495648_0072853
1061 Ga0495648_0239198
1062 Ga0495642_0077132
1063 Ga0495652_0249929
1064 Ga0495665_0062129
1065 Ga0495640_0076367
1066 Ga0495640_0128869
1067 Ga0495586_0369527
1068 Ga0495587_0051090
1069 Ga0495587_0206765
1070 Ga0495609_0043529
1071 Ga0495645_0053215
1072 Ga0495622_0030911
1073 Ga0495622_0039401
1074 Ga0495622_0084380
1075 Ga0495633_0040665
1076 Ga0495633_0239485
1077 Ga0495667_0080513
1078 Ga0495656_0018687
1079 Ga0495656_0097988
1080 Ga0495668_0085045
1081 Ga0495668_0197554
1082 Ga0495668_0212991
1083 Ga0495668_0223269
1084 Ga0495634_0047590
1085 Ga0495611_0159558
1086 Ga0495625_0199438
1087 Ga0495625_0277230
1088 Ga0495625_0289746
1089 Ga0495635_0149062
1090 Ga0495659_0110624
1091 Ga0495588_0016081
1092 Ga0495657_0008189
1093 Ga0495599_0008361
1094 Ga0495599_0063709
1095 Ga0495599_0274899
1096 Ga0495623_0095572
1097 Ga0495646_0023587
1098 Ga0495658_0114246
1099 Ga0495658_0115979
1100 Ga0495669_0004111
1101 Ga0495669_0133278
1102 Ga0495669_0300573
1103 Ga0495613_0244122
1104 Ga0495624_0020095
1105 Ga0495624_0039050
1106 Ga0495649_0149285
1107 Ga0495600_0030992
1108 Ga0495581_0154937
1109 Ga0495604_0065122
1110 Ga0495604_0209393
1111 Ga0495674_0210929
1112 Ga0495672_0053900
1113 Ga0495676_0288056
1114 Ga0495680_0020556
1115 Ga0495683_0074543
1116 Ga0495675_0065077
1117 Ga0495677_0084680
1118 Ga0495684_0101814
1119 Ga0495686_0054922
1120 Ga0495686_0084252
1121 Ga0495686_0206803
1122 Ga0495593_0120784
1123 Ga0495602_0036756
1124 Ga0496100_0717480
1125 Ga0496101_0330732
1126 Ga0496101_0637795
1127 Ga0496102_0013151
1128 Ga0496102_0187514
1129 Ga0496103_0046583
1130 Ga0496104_0027176
1131 Ga0496104_0039416
1132 Ga0496104_0113081
1133 Ga0496105_0012801
1134 Ga0496105_0626854
1135 Ga0496106_0129944
1136 Ga0496109_0207314
1137 Ga0496109_0302169
1138 Ga0496111_0505437
1139 Ga0496112_0000009
1140 Ga0496112_0202013
1141 Ga0496112_0584652
1142 Ga0496113_0029108
1143 Ga0496114_0107633
1144 Ga0496114_0181557
1145 Ga0496115_0507974
1146 Ga0496117_0029200
1147 Ga0496118_0058758
1148 Ga0496119_0004533
1149 Ga0496119_0106482
1150 Ga0496120_0059361
1151 Ga0496121_0003715
1152 Ga0496121_0049355
1153 Ga0496121_0169743
1154 Ga0496121_0264538
1155 Ga0496124_0217912
1156 Ga0496125_0100754
1157 Ga0496125_0146899
1158 Ga0496126_0014485
1159 Ga0496126_0015165
1160 Ga0496126_0047565
1161 Ga0496126_0151729
1162 Ga0496126_0351760
1163 Ga0495682_0018787
1164 Ga0501032_0052542
1165 Ga0501033_0196784
1166 Ga0501036_0222730
1167 Ga0501037_0076099
1168 Ga0501038_0319702
1169 Ga0501043_0047729
1170 Ga0501046_0083005
1171 Ga0501047_0016152
1172 Ga0501068_0065328
1173 Ga0501069_0084379
1174 Ga0501070_0083824
1175 Ga0501071_0291367
1176 Ga0501074_0110043
1177 Ga0501076_0208707
1178 Ga0501080_0012457
1179 Ga0501080_0024858
1180 Ga0501080_0389238
1181 Ga0501035_0343788
1182 nmdc:mga03683_11007_c1
1183 nmdc:mga03683_40684_c1
1184 nmdc:mga03n38_52971_c1
1185 nmdc:mga03n38_95891_c1
1186 nmdc:mga00v17_175906_c1
1187 nmdc:mga00v17_222858_c1
1188 nmdc:mga00v17_27207_c1
1189 nmdc:mga00v17_81022_c1
1190 nmdc:mga0yw44_115125_c1
1191 nmdc:mga0yw44_48505_c1
1192 nmdc:mga0yw44_6965_c1
1193 nmdc:mga0yw44_82697_c1
1194 nmdc:mga0k408_74589_c1
1195 nmdc:mga06z11_204399_c1
1196 nmdc:mga06z11_81135_c1
1197 nmdc:mga04h51_23613_c1
1198 nmdc:mga07m45_159560_c1
1199 nmdc:mga07m45_311544_c1
1200 nmdc:mga07m45_58157_c1
1201 nmdc:mga0qj67_386138_c1
1202 nmdc:mga08y16_204237_c1
1203 nmdc:mga08y16_305412_c1
1204 nmdc:mga0n895_241145_c1
1205 nmdc:mga0n895_445654_c1
1206 nmdc:mga0n895_745806_c1
1207 nmdc:mga0a205_129931_c1
1208 nmdc:mga0sz30_18563_c1
1209 Ga0495601_0039388
1210 Ga0495601_0135822
1211 Ga0495612_0112909
1212 Ga0500610_0105953
1213 Ga0500635_0007803
1214 Ga0500643_096997
1215 Ga0500647_0251788
1216 Ga0500651_0002838
1217 Ga0500566_0022201
1218 Ga0500555_031064
1219 Ga0500562_011319
1220 Ga0500569_126802
1221 Ga0500592_015065
1222 Ga0500595_002029
1223 Ga0500595_003254
1224 Ga0500595_005484
1225 Ga0500595_010151
1226 Ga0500595_047000
1227 Ga0500595_093592
1228 Ga0500607_044099
1229 Ga0500642_0047746
1230 Ga0500559_0033836
1231 Ga0500568_0077509
1232 Ga0500579_123958
1233 Ga0500586_002441
1234 Ga0500589_047982
1235 Ga0500603_003810
1236 Ga0500603_075146
1237 Ga0500604_0018495
1238 Ga0500633_0091779
1239 Ga0500634_0121345
1240 Ga0500638_029082
1241 Ga0500636_0161042
1242 Ga0500637_0000158
1243 Ga0500637_0102458
1244 Ga0500645_013128
1245 Ga0500609_001975
1246 Ga0500661_000622
1247 Ga0501082_0213210
1248 Ga0530510_0215728
1249 Ga0530510_0242898
1250 2513638942
1251 2513675862
1252 2513692551
1253 2513692555
1254 2513718667
1255 2513889153
1256 2524468910
1257 2723845058
1258 2723845062
1259 2793082071
1260 2824713257
1261 2824758262
1262 2824768243
1263 2844319118
1264 2874605220
1265 2874605224
1266 2876766812
1267 2876814291
1268 2879111216
1269 2885386578
1270 2889039814
1271 2903728955
1272 2903773989
1273 2904695850
1274 2904714685
1275 2906607127
1276 2906633306
1277 2908761151
1278 2922365378
1279 2932799908
1280 2932802747
1281 2935889841
1282 2935965809
1283 2941532851
1284 3005722352
1285 8006926847
1286 8006926852
1287 8006965769
1288 8006987020
1289 8006996008
1290 8006996012
1291 8016591714
1292 8056673841
1293 8056686684
1294 8056968067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ovs-assembly1.cif.gz_A crystal structure of a type three secretion system protein 0.8152 9 116
4kt5-assembly1.cif.gz_B structure of grlr-grla complex 0.7936 9 117
4kt5-assembly1.cif.gz_B structure of grlr-grla complex 0.7504 9 117
2ovs-assembly1.cif.gz_A crystal structure of a type three secretion system protein 0.7402 9 116
8ayb-assembly1.cif.gz_A anammox-specific fabz from scalindua brodae 0.7204 196 237
ID Description Score Start End Superfamily
2ovsA00 Mainly Beta;Beta Barrel;Lipocalin;T3SS negative regulator GrlR 0.7971 9 116 2.40.128.380
2ovsA00 Mainly Beta;Beta Barrel;Lipocalin;T3SS negative regulator GrlR 0.7357 9 116 2.40.128.380
3p09B00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7044 202 235 3.40.710.10
3ni9B00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6821 204 240 3.40.710.10
af_X1WBR6_99_193_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.673 10 54 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A160UUP8-F1-model_v4 deleted 0.9762 34 114
AF-A0A160UUP8-F1-model_v4 deleted 0.9645 34 114
AF-F9Y9R5-F1-model_v4 Type III secretion system (T3SS) negative regulator GrlR 0.9475 7 112
AF-A0A7S9H219-F1-model_v4 T3SS negative regulator,GrlR 0.9467 7 114
AF-A0A533J9M7-F1-model_v4 deleted 0.9465 8 118

Map