F473249

General Info

Members Datasets Scaffolds Average Seq Length
659 372 610 430

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10009980|Ga0224712_100099802
Length 451
Sequence MTAQPEFAEGAGGRSPANHGADGPTEPDLYARARAVAPGGVNSPVRAFGAVGGTPVFMASGSGPYLTDVDGKRYVDLVCSWGPMILGHAHPAVISALHRSVDLGTSFGTVTPGEVELAEQIVARTPIDKLRLVNSGTEATMSALRLARAYTGRRLTVKFAGCYHGHVDSLLASAGSGVATFGLPDSPGVTGAVTADTVVLPYNDQAAVRQAFAEHGPDIACVITEACPANMGVVPPSSGFNELLAALCGEHGSLLIMDEVLTGFRVTRSGWYGREQVPGDLMTFGKVMGGGLPAAAFGGRAEIMDLMAPLGPVYQAGTLSGNPLATAAGLATLAECTPEVYERVDAAAAAIADEASKALTGAGVPFRLSQAGNLFSVFLGVTEPVRDFAQARTQSGAAYAAFFHSMLDAGVYLPPSPYEAWFVSAAHDDAAISLIAQALPDAAEAAAAALG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
6 2643221692 Nocardia sp. Root136 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
13 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
14 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
15 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
16 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
17 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
18 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
19 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
20 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
21 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
22 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
23 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
24 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
25 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
26 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
27 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
28 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
29 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
30 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
31 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
32 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
33 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
34 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
35 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
36 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
37 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
38 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
39 2922554459 Rhodococcus sp. 66b Isolate Unclassified
40 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
41 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
42 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
43 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
44 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
45 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
46 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
47 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
251 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
252 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
261 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
369 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
370 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
371 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
372 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0.46
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 4.25
Rhizosphere 86.34
Stem 0
Stem Tuber 0.15
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10009136 3300002077 Bacteria 2036
2 JGI24744J21845_10009863 3300002077 Bacteria 1960
3 JGI25406J46586_10017546 3300003203 Bacteria 2958
4 Ga0070658_10004695 3300005327 Bacteria 11108
5 Ga0070658_10016833 3300005327 Bacteria 5851
6 Ga0070676_10039604 3300005328 Bacteria 2726
7 Ga0070676_10093615 3300005328 Bacteria 1845
8 Ga0070690_100010311 3300005330 Bacteria 5434
9 Ga0068869_100010623 3300005334 Bacteria 6010
10 Ga0068869_100015064 3300005334 Bacteria 5177
11 Ga0068869_100027180 3300005334 Bacteria 3987
12 Ga0068869_100113549 3300005334 Bacteria 2064
13 Ga0068869_100181182 3300005334 Bacteria 1651
14 Ga0070666_10025799 3300005335 Bacteria 3833
15 Ga0070680_100090769 3300005336 Bacteria 2529
16 Ga0070682_100034956 3300005337 Bacteria 3064
17 Ga0068868_100006215 3300005338 Bacteria 8448
18 Ga0068868_100028502 3300005338 Bacteria 4269
19 Ga0068868_100051984 3300005338 Bacteria 3225
20 Ga0068868_100084430 3300005338 Bacteria 2550
21 Ga0070660_100146654 3300005339 Bacteria 1896
22 Ga0070689_100125006 3300005340 Bacteria 2057
23 Ga0070691_10004199 3300005341 Bacteria 6548
24 Ga0070691_10086277 3300005341 Bacteria 1543
25 Ga0070661_100036432 3300005344 Bacteria 3576
26 Ga0070668_100001503 3300005347 Bacteria 16850
27 Ga0070668_100008184 3300005347 Bacteria 7766
28 Ga0070668_100014822 3300005347 Bacteria 5826
29 Ga0070668_100023950 3300005347 Bacteria 4623
30 Ga0070669_100003990 3300005353 Bacteria 10670
31 Ga0070669_100044389 3300005353 Bacteria 3239
32 Ga0070671_100000653 3300005355 Bacteria 24925
33 Ga0070671_100014146 3300005355 Bacteria 6444
34 Ga0070674_100008667 3300005356 Bacteria 6063
35 Ga0070673_100032954 3300005364 Bacteria 3906
36 Ga0070673_100086039 3300005364 Bacteria 2561
37 Ga0070688_100014774 3300005365 Bacteria 4429
38 Ga0070688_100020938 3300005365 Bacteria 3812
39 Ga0070659_100015049 3300005366 Bacteria 5787
40 Ga0070659_100023115 3300005366 Bacteria 4753
41 Ga0070659_100129592 3300005366 Bacteria 2048
42 Ga0070667_100003097 3300005367 Bacteria 14305
43 Ga0070667_100003861 3300005367 Bacteria 12729
44 Ga0070709_10044865 3300005434 Bacteria 2740
45 Ga0070709_10060166 3300005434 Bacteria 2413
46 Ga0070714_100062406 3300005435 Bacteria 3203
47 Ga0070713_100043437 3300005436 Bacteria 3675
48 Ga0070713_100235480 3300005436 Bacteria 1666
49 Ga0070710_10000174 3300005437 Bacteria 29488
50 Ga0070710_10006635 3300005437 Bacteria 5566
51 Ga0070701_10002167 3300005438 Bacteria 7480
52 Ga0070711_100007734 3300005439 Bacteria 6548
53 Ga0070711_100150308 3300005439 Bacteria 1755
54 Ga0070705_100044584 3300005440 Bacteria 2548
55 Ga0070700_100000064 3300005441 Bacteria 78318
56 Ga0070700_100010160 3300005441 Bacteria 5187
57 Ga0070700_100037284 3300005441 Bacteria 2956
58 Ga0070708_100119891 3300005445 Bacteria 2426
59 Ga0070663_100000466 3300005455 Bacteria 21362
60 Ga0070663_100003410 3300005455 Bacteria 9177
61 Ga0070663_100009904 3300005455 Bacteria 5921
62 Ga0070663_100021979 3300005455 Bacteria 4255
63 Ga0070663_100081598 3300005455 Bacteria 2377
64 Ga0070678_100001568 3300005456 Bacteria 12245
65 Ga0070678_100121361 3300005456 Bacteria 2061
66 Ga0070662_100024724 3300005457 Bacteria 4142
67 Ga0070681_10000077 3300005458 Bacteria 72675
68 Ga0070681_10012712 3300005458 Bacteria 8355
69 Ga0068867_100008283 3300005459 Bacteria 7340
70 Ga0070685_10063826 3300005466 Bacteria 2164
71 Ga0070706_100010721 3300005467 Bacteria 8506
72 Ga0070706_100054604 3300005467 Bacteria 3687
73 Ga0070707_100000213 3300005468 Bacteria 58009
74 Ga0070707_100028377 3300005468 Bacteria 5326
75 Ga0070698_100000527 3300005471 Bacteria 40863
76 Ga0070698_100267108 3300005471 Bacteria 1643
77 Ga0070679_100000016 3300005530 Bacteria 139454
78 Ga0070679_100078617 3300005530 Bacteria 3287
79 Ga0070679_100137619 3300005530 Bacteria 2423
80 Ga0070684_100086143 3300005535 Bacteria 2787
81 Ga0068853_100005937 3300005539 Bacteria 9645
82 Ga0068853_100235151 3300005539 Bacteria 1677
83 Ga0070696_100017874 3300005546 Bacteria 4787
84 Ga0070693_100059561 3300005547 Bacteria 2214
85 Ga0070665_100000401 3300005548 Bacteria 63343
86 Ga0070665_100005239 3300005548 Bacteria 13412
87 Ga0070704_100005753 3300005549 Bacteria 7250
88 Ga0070704_100087318 3300005549 Bacteria 2314
89 Ga0070704_100179609 3300005549 Bacteria 1691
90 Ga0068855_100003813 3300005563 Bacteria 18430
91 Ga0068855_100004544 3300005563 Bacteria 16945
92 Ga0068855_100030141 3300005563 Bacteria 6489
93 Ga0068857_100019120 3300005577 Bacteria 6013
94 Ga0068854_100061046 3300005578 Bacteria 2729
95 Ga0068854_100094689 3300005578 Bacteria 2228
96 Ga0068856_100077264 3300005614 Bacteria 3299
97 Ga0068856_100183267 3300005614 Bacteria 2107
98 Ga0068856_100219116 3300005614 Bacteria 1918
99 Ga0070702_100128942 3300005615 Bacteria 1594
100 Ga0068852_100005953 3300005616 Bacteria 8777
101 Ga0068852_100025899 3300005616 Bacteria 4760
102 Ga0068852_100099945 3300005616 Bacteria 2616
103 Ga0068859_100014343 3300005617 Bacteria 7948
104 Ga0068864_100039541 3300005618 Bacteria 4031
105 Ga0068864_100048460 3300005618 Bacteria 3652
106 Ga0068866_10004247 3300005718 Bacteria 5882
107 Ga0068861_100010212 3300005719 Bacteria 6516
108 Ga0068861_100120019 3300005719 Bacteria 2119
109 Ga0068863_100005170 3300005841 Bacteria 12869
110 Ga0068863_100034594 3300005841 Bacteria 4812
111 Ga0068863_100168409 3300005841 Bacteria 2101
112 Ga0068858_100011913 3300005842 Bacteria 8196
113 Ga0068858_100083714 3300005842 Bacteria 2966
114 Ga0068860_100000114 3300005843 Bacteria 128789
115 Ga0081455_10000071 3300005937 Bacteria 110373
116 Ga0081455_10001759 3300005937 Bacteria 26177
117 Ga0081538_10000392 3300005981 Bacteria 49806
118 Ga0081540_1001045 3300005983 Bacteria 24737
119 Ga0081539_10003154 3300005985 Bacteria 20916
120 Ga0070717_10015998 3300006028 Bacteria 5808
121 Ga0070717_10037923 3300006028 Bacteria 3915
122 Ga0070717_10098859 3300006028 Bacteria 2474
123 Ga0075364_10013585 3300006051 Bacteria 5011
124 Ga0075432_10008885 3300006058 Bacteria 3426
125 Ga0070712_100003874 3300006175 Bacteria 9214
126 Ga0070712_100018973 3300006175 Bacteria 4476
127 Ga0075369_10001162 3300006186 Bacteria 8897
128 Ga0097621_100018361 3300006237 Bacteria 5339
129 Ga0097621_100243256 3300006237 Bacteria 1573
130 Ga0075370_10045494 3300006353 Bacteria 2482
131 Ga0075428_100025634 3300006844 Bacteria 6529
132 Ga0075430_100003241 3300006846 Bacteria 13630
133 Ga0075430_100006724 3300006846 Bacteria 9700
134 Ga0075431_100002314 3300006847 Bacteria 18303
135 Ga0075433_10001489 3300006852 Bacteria 17304
136 Ga0075434_100005169 3300006871 Bacteria 11850
137 Ga0075429_100003556 3300006880 Bacteria 13277
138 Ga0068865_100004566 3300006881 Bacteria 8356
139 Ga0075436_100097534 3300006914 Bacteria 2045
140 Ga0097620_100014343 3300006931 Bacteria 7948
141 Ga0105240_10054115 3300009093 Bacteria 5031
142 Ga0111539_10003093 3300009094 Bacteria 22058
143 Ga0111539_10005914 3300009094 Bacteria 15801
144 Ga0105245_10011470 3300009098 Bacteria 7719
145 Ga0105245_10044404 3300009098 Bacteria 3967
146 Ga0105247_10000587 3300009101 Bacteria 29534
147 Ga0105247_10034450 3300009101 Bacteria 3083
148 Ga0114129_10008813 3300009147 Bacteria 14392
149 Ga0114129_10161528 3300009147 Bacteria 3060
150 Ga0105243_10000176 3300009148 Bacteria 73715
151 Ga0105243_10017022 3300009148 Bacteria 5496
152 Ga0105243_10053042 3300009148 Bacteria 3215
153 Ga0105243_10070243 3300009148 Bacteria 2827
154 Ga0105241_10094905 3300009174 Bacteria 2360
155 Ga0105241_10130677 3300009174 Bacteria 2033
156 Ga0105242_10000541 3300009176 Bacteria 29941
157 Ga0105242_10025964 3300009176 Bacteria 4639
158 Ga0105242_10040131 3300009176 Bacteria 3771
159 Ga0105237_10050276 3300009545 Bacteria 4188
160 Ga0105237_10118830 3300009545 Bacteria 2637
161 Ga0105237_10160494 3300009545 Bacteria 2246
162 Ga0105238_10004587 3300009551 Bacteria 13661
163 Ga0105238_10057780 3300009551 Bacteria 3889
164 Ga0105249_10001455 3300009553 Bacteria 20752
165 Ga0105249_10009099 3300009553 Bacteria 8686
166 Ga0105249_10010376 3300009553 Bacteria 8187
167 Ga0105249_10206108 3300009553 Bacteria 1927
168 Ga0105032_101028 3300009979 Bacteria 2604
169 Ga0105239_10010931 3300010375 Bacteria 10140
170 Ga0105246_10057272 3300011119 Bacteria 2696
171 Ga0157369_10001482 3300013105 Bacteria 28790
172 Ga0157369_10022930 3300013105 Bacteria 6961
173 Ga0157369_10068398 3300013105 Bacteria 3816
174 Ga0157369_10306372 3300013105 Bacteria 1652
175 Ga0157374_10067285 3300013296 Bacteria 3368
176 Ga0157378_10025526 3300013297 Bacteria 5202
177 Ga0157378_10116250 3300013297 Bacteria 2459
178 Ga0163162_10006240 3300013306 Bacteria 11556
179 Ga0157372_10000678 3300013307 Bacteria 37470
180 Ga0157375_10011156 3300013308 Bacteria 7925
181 Ga0157375_10302950 3300013308 Bacteria 1762
182 Ga0163163_10134731 3300014325 Bacteria 2511
183 Ga0157380_10062044 3300014326 Bacteria 2993
184 Ga0157377_10002864 3300014745 Bacteria 7703
185 Ga0157379_10106086 3300014968 Bacteria 2522
186 Ga0157379_10124618 3300014968 Bacteria 2318
187 Ga0163161_10006350 3300017792 Bacteria 8178
188 Ga0163161_10008455 3300017792 Bacteria 7127
189 Ga0163161_10070900 3300017792 Bacteria 2549
190 Ga0163161_10191079 3300017792 Bacteria 1574
191 Ga0206353_10379419 3300020082 Bacteria 2038
192 Ga0206353_11821398 3300020082 Bacteria 3749
193 Ga0213875_10001286 3300021388 Bacteria 16762
194 Ga0213875_10015991 3300021388 Bacteria 3645
195 Ga0224712_10009980 3300022467 Bacteria 2884
196 Ga0207656_10015051 3300025321 Bacteria 2990
197 Ga0207692_10000925 3300025898 Bacteria 10621
198 Ga0207710_10008663 3300025900 Bacteria 4289
199 Ga0207710_10018370 3300025900 Bacteria 2974
200 Ga0207688_10002201 3300025901 Bacteria 10509
201 Ga0207688_10014213 3300025901 Bacteria 4332
202 Ga0207688_10040260 3300025901 Bacteria 2596
203 Ga0207688_10063870 3300025901 Bacteria 2077
204 Ga0207647_10065140 3300025904 Bacteria 2212
205 Ga0207685_10002600 3300025905 Bacteria 4181
206 Ga0207699_10041228 3300025906 Bacteria 2665
207 Ga0207699_10154642 3300025906 Bacteria 1521
208 Ga0207645_10082455 3300025907 Bacteria 2061
209 Ga0207705_10023506 3300025909 Bacteria 4397
210 Ga0207705_10041874 3300025909 Bacteria 3286
211 Ga0207684_10020476 3300025910 Bacteria 5652
212 Ga0207654_10052418 3300025911 Bacteria 2351
213 Ga0207707_10000089 3300025912 Bacteria 90919
214 Ga0207707_10013813 3300025912 Bacteria 7042
215 Ga0207671_10117837 3300025914 Bacteria 2027
216 Ga0207693_10001988 3300025915 Bacteria 17934
217 Ga0207693_10004400 3300025915 Bacteria 11916
218 Ga0207693_10031758 3300025915 Bacteria 4173
219 Ga0207663_10002104 3300025916 Bacteria 9483
220 Ga0207660_10006327 3300025917 Bacteria 7676
221 Ga0207649_10033586 3300025920 Bacteria 3067
222 Ga0207652_10000015 3300025921 Bacteria 193042
223 Ga0207652_10111298 3300025921 Bacteria 2428
224 Ga0207652_10138007 3300025921 Bacteria 2178
225 Ga0207646_10000105 3300025922 Bacteria 114126
226 Ga0207646_10005244 3300025922 Bacteria 13676
227 Ga0207646_10007603 3300025922 Bacteria 10978
228 Ga0207646_10255243 3300025922 Bacteria 1585
229 Ga0207681_10010077 3300025923 Bacteria 5786
230 Ga0207681_10156698 3300025923 Bacteria 1712
231 Ga0207694_10069041 3300025924 Bacteria 2761
232 Ga0207650_10072040 3300025925 Bacteria 2601
233 Ga0207687_10003407 3300025927 Bacteria 10725
234 Ga0207687_10023953 3300025927 Bacteria 4073
235 Ga0207687_10050024 3300025927 Bacteria 2908
236 Ga0207700_10142070 3300025928 Bacteria 1974
237 Ga0207664_10054432 3300025929 Bacteria 3170
238 Ga0207644_10001889 3300025931 Bacteria 13623
239 Ga0207644_10167071 3300025931 Bacteria 1715
240 Ga0207690_10027252 3300025932 Bacteria 3610
241 Ga0207706_10005837 3300025933 Bacteria 11451
242 Ga0207706_10014937 3300025933 Bacteria 7032
243 Ga0207706_10022323 3300025933 Bacteria 5679
244 Ga0207706_10033507 3300025933 Bacteria 4572
245 Ga0207686_10038559 3300025934 Bacteria 2892
246 Ga0207709_10000739 3300025935 Bacteria 25922
247 Ga0207709_10064063 3300025935 Bacteria 2306
248 Ga0207669_10003202 3300025937 Bacteria 7070
249 Ga0207669_10042854 3300025937 Bacteria 2646
250 Ga0207669_10055780 3300025937 Bacteria 2395
251 Ga0207669_10062475 3300025937 Bacteria 2294
252 Ga0207704_10002568 3300025938 Bacteria 8192
253 Ga0207665_10000912 3300025939 Bacteria 19948
254 Ga0207691_10206751 3300025940 Bacteria 1707
255 Ga0207689_10006351 3300025942 Bacteria 10467
256 Ga0207689_10011876 3300025942 Bacteria 7465
257 Ga0207689_10023158 3300025942 Bacteria 5215
258 Ga0207689_10024668 3300025942 Bacteria 5041
259 Ga0207689_10032836 3300025942 Bacteria 4314
260 Ga0207679_10002163 3300025945 Bacteria 12156
261 Ga0207667_10023404 3300025949 Bacteria 6802
262 Ga0207667_10194828 3300025949 Bacteria 2079
263 Ga0207667_10213704 3300025949 Bacteria 1977
264 Ga0207712_10002242 3300025961 Bacteria 12573
265 Ga0207712_10010257 3300025961 Bacteria 5944
266 Ga0207712_10113207 3300025961 Bacteria 2039
267 Ga0207668_10004560 3300025972 Bacteria 8148
268 Ga0207668_10048577 3300025972 Bacteria 2913
269 Ga0207668_10078949 3300025972 Bacteria 2379
270 Ga0207640_10008628 3300025981 Bacteria 5665
271 Ga0207640_10075498 3300025981 Bacteria 2285
272 Ga0207658_10013062 3300025986 Bacteria 5671
273 Ga0207658_10018143 3300025986 Bacteria 4854
274 Ga0207677_10004360 3300026023 Bacteria 7581
275 Ga0207677_10052034 3300026023 Bacteria 2780
276 Ga0207677_10063117 3300026023 Bacteria 2573
277 Ga0207703_10016320 3300026035 Bacteria 5789
278 Ga0207639_10009529 3300026041 Bacteria 6701
279 Ga0207678_10001240 3300026067 Bacteria 23521
280 Ga0207678_10004102 3300026067 Bacteria 13100
281 Ga0207678_10013386 3300026067 Bacteria 7200
282 Ga0207678_10016705 3300026067 Bacteria 6446
283 Ga0207678_10022386 3300026067 Bacteria 5535
284 Ga0207708_10000076 3300026075 Bacteria 78340
285 Ga0207708_10004349 3300026075 Bacteria 10436
286 Ga0207708_10018507 3300026075 Bacteria 5247
287 Ga0207708_10025739 3300026075 Bacteria 4453
288 Ga0207708_10055787 3300026075 Bacteria 3013
289 Ga0207641_10009537 3300026088 Bacteria 7997
290 Ga0207641_10036495 3300026088 Bacteria 4103
291 Ga0207641_10168454 3300026088 Bacteria 1997
292 Ga0207648_10005879 3300026089 Bacteria 12276
293 Ga0207648_10008936 3300026089 Bacteria 9640
294 Ga0207648_10050640 3300026089 Bacteria 3631
295 Ga0207674_10017440 3300026116 Bacteria 7836
296 Ga0207674_10054790 3300026116 Bacteria 4059
297 Ga0207674_10071173 3300026116 Bacteria 3495
298 Ga0207675_100001816 3300026118 Bacteria 21390
299 Ga0207675_100002509 3300026118 Bacteria 18162
300 Ga0207675_100010155 3300026118 Bacteria 8824
301 Ga0207675_100028433 3300026118 Bacteria 5205
302 Ga0207675_100150513 3300026118 Bacteria 2215
303 Ga0207683_10001438 3300026121 Bacteria 21523
304 Ga0207683_10004394 3300026121 Bacteria 12183
305 Ga0207683_10090615 3300026121 Bacteria 2723
306 Ga0207683_10107455 3300026121 Bacteria 2496
307 Ga0207683_10133921 3300026121 Bacteria 2230
308 Ga0207698_10022456 3300026142 Bacteria 4385
309 Ga0207698_10039771 3300026142 Bacteria 3487
310 Ga0207698_10067249 3300026142 Bacteria 2825
311 Ga0207428_10001475 3300027907 Bacteria 24624
312 Ga0268266_10001585 3300028379 Bacteria 26567
313 Ga0268266_10014769 3300028379 Bacteria 6708
314 Ga0268266_10245668 3300028379 Bacteria 1653
315 Ga0268265_10060409 3300028380 Bacteria 2904
316 Ga0268264_10000147 3300028381 Bacteria 164790
317 Ga0268264_10008608 3300028381 Bacteria 8478
318 Ga0268264_10019740 3300028381 Bacteria 5505
319 Ga0314311_1001867 3300030733 Bacteria 11811
320 Ga0265320_10025164 3300031240 Bacteria 3134
321 Ga0265325_10024399 3300031241 Bacteria 3291
322 Ga0265340_10006275 3300031247 Bacteria 6551
323 Ga0307408_100161744 3300031548 Bacteria 1779
324 Ga0307508_10003996 3300031616 Bacteria 14613
325 Ga0265314_10007762 3300031711 Bacteria 9277
326 Ga0307405_10002200 3300031731 Bacteria 8520
327 Ga0307405_10064876 3300031731 Bacteria 2322
328 Ga0307413_10011436 3300031824 Bacteria 4365
329 Ga0307413_10040751 3300031824 Bacteria 2713
330 Ga0307413_10122783 3300031824 Bacteria 1762
331 Ga0307518_10000304 3300031838 Bacteria 37119
332 Ga0307518_10005413 3300031838 Bacteria 9127
333 Ga0307410_10003205 3300031852 Bacteria 8155
334 Ga0307410_10004504 3300031852 Bacteria 7215
335 Ga0307410_10051997 3300031852 Bacteria 2764
336 Ga0307410_10057563 3300031852 Bacteria 2647
337 Ga0307406_10007359 3300031901 Bacteria 6101
338 Ga0307407_10006451 3300031903 Bacteria 5214
339 Ga0307412_10116208 3300031911 Bacteria 1919
340 Ga0307409_100000197 3300031995 Bacteria 23795
341 Ga0307409_100000337 3300031995 Bacteria 19410
342 Ga0307409_100115222 3300031995 Bacteria 2262
343 Ga0307416_100003728 3300032002 Bacteria 9040
344 Ga0307416_100209866 3300032002 Bacteria 1856
345 Ga0307414_10020370 3300032004 Bacteria 4133
346 Ga0307411_10006006 3300032005 Bacteria 6034
347 Ga0307411_10012993 3300032005 Bacteria 4573
348 Ga0307415_100003572 3300032126 Bacteria 7939
349 Ga0307415_100003928 3300032126 Bacteria 7641
350 Ga0307415_100005308 3300032126 Bacteria 6823
351 Ga0307415_100081508 3300032126 Bacteria 2311
352 Ga0307507_10038408 3300033179 Bacteria 4853
353 Ga0307510_10112253 3300033180 Bacteria 2463
354 Ga0373923_0029939 3300035111 Bacteria 2186
355 Ga0373932_0015187 3300035112 Bacteria 1948
356 Ga0373936_0049371 3300035113 Bacteria 1699
357 Ga0373953_0038220 3300035117 Bacteria 1898
358 Ga0373954_0027618 3300035118 Bacteria 2606
359 Ga0373956_0004349 3300035119 Bacteria 5679
360 Ga0373955_0035391 3300035172 Bacteria 2644
361 Ga0395899_0083821 3300037312 Bacteria 2318
362 Ga0395900_0019899 3300037418 Bacteria 6842
363 Ga0395900_0046784 3300037418 Bacteria 4455
364 Ga0395900_0265159 3300037418 Bacteria 1714
365 Ga0395898_0044449 3300037466 Bacteria 4372
366 Ga0395898_0189323 3300037466 Bacteria 1966
367 Ga0395905_0198768 3300037471 Bacteria 1880
368 Ga0436364_0090786 3300037853 Bacteria 2368
369 Ga0436364_0251182 3300037853 Bacteria 7342
370 Ga0436364_0512751 3300037853 Bacteria 53348
371 Ga0436364_0955899 3300037853 Bacteria 14646
372 Ga0395901_0005633 3300038443 Bacteria 12674
373 Ga0395901_0020193 3300038443 Bacteria 6819
374 Ga0395901_0021278 3300038443 Bacteria 6643
375 Ga0436365_1226639 3300039437 Bacteria 1640
376 Ga0439448_0000133 3300042005 Bacteria 14009
377 Ga0439450_000171 3300042008 Bacteria 7424
378 Ga0439463_000090 3300042016 Bacteria 21211
379 Ga0450900_001900 3300042136 Bacteria 2133
380 Ga0439444_0001658 3300042437 Bacteria 2931
381 Ga0439464_0000125 3300042439 Bacteria 12183
382 Ga0450916_001317 3300042530 Bacteria 2451
383 Ga0439440_0000024 3300042993 Bacteria 18444
384 Ga0466969_0004839 3300044656 Bacteria 7167
385 Ga0466969_0006017 3300044656 Bacteria 6458
386 Ga0466972_0003690 3300044658 Bacteria 7619
387 Ga0466972_0004496 3300044658 Bacteria 6978
388 Ga0466972_0008802 3300044658 Bacteria 5063
389 Ga0466972_0009094 3300044658 Bacteria 4990
390 Ga0466972_0036883 3300044658 Bacteria 2390
391 Ga0466965_0000962 3300044683 Bacteria 11123
392 Ga0466965_0001996 3300044683 Bacteria 8535
393 Ga0466965_0003981 3300044683 Bacteria 6546
394 Ga0466965_0004181 3300044683 Bacteria 6416
395 Ga0466966_0001859 3300044684 Bacteria 13697
396 Ga0466966_0004214 3300044684 Bacteria 9490
397 Ga0466966_0013306 3300044684 Bacteria 5447
398 Ga0466966_0022867 3300044684 Bacteria 4096
399 Ga0466966_0089499 3300044684 Bacteria 1912
400 Ga0466961_0001396 3300044693 Bacteria 14959
401 Ga0466961_0002770 3300044693 Bacteria 10909
402 Ga0466961_0016856 3300044693 Bacteria 4695
403 Ga0466961_0068835 3300044693 Bacteria 2247
404 Ga0466961_0095725 3300044693 Bacteria 1872
405 Ga0466963_0001299 3300044694 Bacteria 13271
406 Ga0466963_0001487 3300044694 Bacteria 12654
407 Ga0466963_0008033 3300044694 Bacteria 6317
408 Ga0466963_0040543 3300044694 Bacteria 3052
409 Ga0466963_0132852 3300044694 Bacteria 1720
410 Ga0466963_0133200 3300044694 Bacteria 1718
411 Ga0466964_0012279 3300044706 Bacteria 3242
412 Ga0466964_0096034 3300044706 Bacteria 1298
413 Ga0466971_0001862 3300044719 Bacteria 8980
414 Ga0466971_0027693 3300044719 Bacteria 2539
415 Ga0466971_0056094 3300044719 Bacteria 1777
416 Ga0466971_0060540 3300044719 Bacteria 1711
417 Ga0466968_0000508 3300044735 Bacteria 13208
418 Ga0466968_0041430 3300044735 Bacteria 1944
419 Ga0466970_0006801 3300044765 Bacteria 5725
420 Ga0466970_0014201 3300044765 Bacteria 4085
421 Ga0466970_0019429 3300044765 Bacteria 3523
422 Ga0466957_0007701 3300044842 Bacteria 6090
423 Ga0466957_0029764 3300044842 Bacteria 3258
424 Ga0466960_0000412 3300044901 Bacteria 14752
425 Ga0466959_0001272 3300045049 Bacteria 15252
426 Ga0466959_0006432 3300045049 Bacteria 8134
427 Ga0466959_0007060 3300045049 Bacteria 7850
428 Ga0466959_0163076 3300045049 Bacteria 1566
429 Ga0466958_0000116 3300045836 Bacteria 25851
430 Ga0466958_0046431 3300045836 Bacteria 2621
431 Ga0466958_0060052 3300045836 Bacteria 2314
432 Ga0466967_0000924 3300045976 Bacteria 15792
433 Ga0466967_0002676 3300045976 Bacteria 11247
434 Ga0466967_0002704 3300045976 Bacteria 11204
435 Ga0466967_0007673 3300045976 Bacteria 7812
436 Ga0466967_0121203 3300045976 Bacteria 2416
437 Ga0495592_0055242 3300046454 Bacteria 2938
438 Ga0495629_0003195 3300046459 Bacteria 12402
439 Ga0495641_0011885 3300046461 Bacteria 4916
440 Ga0495651_0009515 3300046462 Bacteria 7463
441 Ga0495582_0002562 3300046473 Bacteria 10116
442 Ga0495639_0017334 3300046475 Bacteria 3128
443 Ga0495662_0020498 3300046476 Bacteria 3198
444 Ga0495608_0009657 3300046511 Bacteria 6732
445 Ga0495630_0090057 3300046517 Bacteria 2317
446 Ga0495630_0175985 3300046517 Bacteria 1631
447 Ga0495665_0012173 3300046531 Bacteria 4655
448 Ga0495640_0048191 3300046533 Bacteria 2945
449 Ga0495598_0006230 3300046537 Bacteria 2686
450 Ga0495621_0021044 3300046539 Bacteria 2147
451 Ga0495645_0009696 3300046543 Bacteria 6734
452 Ga0495667_0057518 3300046559 Bacteria 2555
453 Ga0495635_0014323 3300046663 Bacteria 5547
454 Ga0495657_0020345 3300046675 Bacteria 4771
455 Ga0495599_0061354 3300046678 Bacteria 2350
456 Ga0495658_0009331 3300046683 Bacteria 4887
457 Ga0495613_0109622 3300046689 Bacteria 1990
458 Ga0495624_0036086 3300046690 Bacteria 3189
459 Ga0495624_0141757 3300046690 Bacteria 1472
460 Ga0495581_0007738 3300047315 Bacteria 6218
461 Ga0495604_0055898 3300047317 Bacteria 3040
462 Ga0495680_0071345 3300047322 Bacteria 2644
463 Ga0495684_0030287 3300047471 Bacteria 4155
464 Ga0495686_0002331 3300047472 Bacteria 18152
465 Ga0495602_0045280 3300048088 Bacteria 3982
466 Ga0495614_0023959 3300048089 Bacteria 2634
467 Ga0496100_0010318 3300048903 Bacteria 5285
468 Ga0496100_0028650 3300048903 Bacteria 3436
469 Ga0496100_0029701 3300048903 Bacteria 3384
470 Ga0496101_0005719 3300048904 Bacteria 7941
471 Ga0496102_0000292 3300048905 Bacteria 64203
472 Ga0496102_0000409 3300048905 Bacteria 49825
473 Ga0496102_0114293 3300048905 Bacteria 2518
474 Ga0496103_0008519 3300048906 Bacteria 6092
475 Ga0496103_0015040 3300048906 Bacteria 4600
476 Ga0496103_0016423 3300048906 Bacteria 4417
477 Ga0496104_0003042 3300048907 Bacteria 14443
478 Ga0496104_0118439 3300048907 Bacteria 2542
479 Ga0496104_0174030 3300048907 Bacteria 2063
480 Ga0496105_0006019 3300048908 Bacteria 9270
481 Ga0496106_0113115 3300048909 Bacteria 2115
482 Ga0496107_0004037 3300048910 Bacteria 9885
483 Ga0496108_0001993 3300048911 Bacteria 16350
484 Ga0496108_0141950 3300048911 Bacteria 2069
485 Ga0496108_0248515 3300048911 Bacteria 1547
486 Ga0496109_0001047 3300048912 Bacteria 22883
487 Ga0496110_0274425 3300048913 Bacteria 1535
488 Ga0496112_0010431 3300048915 Bacteria 8426
489 Ga0496112_0114299 3300048915 Bacteria 2670
490 Ga0496112_0144919 3300048915 Bacteria 2343
491 Ga0496113_0126539 3300048916 Bacteria 2002
492 Ga0496114_0002107 3300048917 Bacteria 15111
493 Ga0496114_0080999 3300048917 Bacteria 2742
494 Ga0496115_0015008 3300048918 Bacteria 5871
495 Ga0496116_0003840 3300048919 Bacteria 14667
496 Ga0496117_0000572 3300048920 Bacteria 60381
497 Ga0496118_0004828 3300048921 Bacteria 15719
498 Ga0496118_0117707 3300048921 Bacteria 1742
499 Ga0496119_0000200 3300048922 Bacteria 84506
500 Ga0496119_0023406 3300048922 Bacteria 4380
501 Ga0496120_0005099 3300048923 Bacteria 10624
502 Ga0496120_0008461 3300048923 Bacteria 7468
503 Ga0496124_0036597 3300048927 Bacteria 4279
504 Ga0496125_0043573 3300048928 Bacteria 3805
505 Ga0496126_0000003 3300048929 Bacteria 961576
506 Ga0496126_0000344 3300048929 Bacteria 97456
507 Ga0496126_0005807 3300048929 Bacteria 13950
508 Ga0496126_0142815 3300048929 Bacteria 2059
509 Ga0501031_0000786 3300049568 Bacteria 19065
510 Ga0501031_0001466 3300049568 Bacteria 14643
511 Ga0501031_0001689 3300049568 Bacteria 13873
512 Ga0501031_0107159 3300049568 Bacteria 1824
513 Ga0501032_0000529 3300049569 Bacteria 31035
514 Ga0501032_0079701 3300049569 Bacteria 2180
515 Ga0501033_0007352 3300049570 Bacteria 8577
516 Ga0501033_0017409 3300049570 Bacteria 5429
517 Ga0501033_0150472 3300049570 Bacteria 1679
518 Ga0501034_0005705 3300049571 Bacteria 13530
519 Ga0501034_0022894 3300049571 Bacteria 6365
520 Ga0501034_0029795 3300049571 Bacteria 5548
521 Ga0501036_0000208 3300049572 Bacteria 39217
522 Ga0501036_0002407 3300049572 Bacteria 14642
523 Ga0501036_0024907 3300049572 Bacteria 5047
524 Ga0501037_0001621 3300049573 Bacteria 16347
525 Ga0501037_0014597 3300049573 Bacteria 5779
526 Ga0501037_0114019 3300049573 Bacteria 1946
527 Ga0501038_0003875 3300049574 Bacteria 13905
528 Ga0501038_0008098 3300049574 Bacteria 9672
529 Ga0501039_0000629 3300049575 Bacteria 25532
530 Ga0501039_0008229 3300049575 Bacteria 7949
531 Ga0501039_0012507 3300049575 Bacteria 6482
532 Ga0501040_0000013 3300049576 Bacteria 76297
533 Ga0501040_0003285 3300049576 Bacteria 10452
534 Ga0501040_0044155 3300049576 Bacteria 3038
535 Ga0501041_0000134 3300049577 Bacteria 31802
536 Ga0501041_0001378 3300049577 Bacteria 13433
537 Ga0501042_0000426 3300049578 Bacteria 21400
538 Ga0501042_0001684 3300049578 Bacteria 13181
539 Ga0501043_0014156 3300049579 Bacteria 6241
540 Ga0501043_0020981 3300049579 Bacteria 5122
541 Ga0501046_0001172 3300049580 Bacteria 25515
542 Ga0501046_0001681 3300049580 Bacteria 21164
543 Ga0501046_0004074 3300049580 Bacteria 13323
544 Ga0501047_0002802 3300049581 Bacteria 16555
545 Ga0501047_0046413 3300049581 Bacteria 4198
546 Ga0501048_0000215 3300049582 Bacteria 37866
547 Ga0501048_0002334 3300049582 Bacteria 14481
548 Ga0501048_0008359 3300049582 Bacteria 7824
549 Ga0501067_0040637 3300049583 Bacteria 2582
550 Ga0501068_0017459 3300049584 Bacteria 4151
551 Ga0501069_0010476 3300049585 Bacteria 4908
552 Ga0501069_0040757 3300049585 Bacteria 2566
553 Ga0501070_0006467 3300049586 Bacteria 9973
554 Ga0501070_0025483 3300049586 Bacteria 4960
555 Ga0501071_0014902 3300049587 Bacteria 5326
556 Ga0501072_0000218 3300049588 Bacteria 41909
557 Ga0501072_0041820 3300049588 Bacteria 3599
558 Ga0501073_0026995 3300049589 Bacteria 4109
559 Ga0501074_0023632 3300049590 Bacteria 4467
560 Ga0501074_0067877 3300049590 Bacteria 2563
561 Ga0501075_0000029 3300049591 Bacteria 58190
562 Ga0501075_0008416 3300049591 Bacteria 7196
563 Ga0501076_0000173 3300049592 Bacteria 37869
564 Ga0501076_0001857 3300049592 Bacteria 14373
565 Ga0501076_0049135 3300049592 Bacteria 3335
566 Ga0501077_0000077 3300049593 Bacteria 49358
567 Ga0501077_0058031 3300049593 Bacteria 2457
568 Ga0501079_0000721 3300049741 Bacteria 22321
569 Ga0501079_0001150 3300049741 Bacteria 18499
570 Ga0501079_0061214 3300049741 Bacteria 2903
571 Ga0501080_0000266 3300049742 Bacteria 39496
572 Ga0501080_0011290 3300049742 Bacteria 8175
573 Ga0501080_0011433 3300049742 Bacteria 8129
574 Ga0501081_0002166 3300049743 Bacteria 12325
575 Ga0501081_0007931 3300049743 Bacteria 6887
576 Ga0501083_0024502 3300049744 Bacteria 4180
577 Ga0501035_0000602 3300049822 Bacteria 39639
578 Ga0501035_0003399 3300049822 Bacteria 15224
579 Ga0501035_0010290 3300049822 Bacteria 8676
580 Ga0501035_0027898 3300049822 Bacteria 5158
581 Ga0501044_0002108 3300049823 Bacteria 22875
582 Ga0501044_0007990 3300049823 Bacteria 11625
583 Ga0501044_0012463 3300049823 Bacteria 9207
584 Ga0501044_0171028 3300049823 Bacteria 2144
585 Ga0501044_0302782 3300049823 Bacteria 1527
586 Ga0501045_0002189 3300049824 Bacteria 13251
587 Ga0501045_0025660 3300049824 Bacteria 4237
588 Ga0501045_0047607 3300049824 Bacteria 3123
589 nmdc:mga00v17_7817_c1 3300050491 Bacteria 5732
590 nmdc:mga05p37_35803_c1 3300050507 Bacteria 6089
591 nmdc:mga05p37_672_c1 3300050507 Bacteria 37785
592 nmdc:mga09592_2964_c1 3300050508 Bacteria 13758
593 nmdc:mga0qj67_294_c1 3300050509 Bacteria 34748
594 nmdc:mga0qj67_59950_c1 3300050509 Bacteria 3019
595 nmdc:mga06r32_285_c2 3300050510 Bacteria 37898
596 nmdc:mga08y16_116013_c1 3300050511 Bacteria 2788
597 nmdc:mga0n895_43331_c1 3300050512 Bacteria 4385
598 nmdc:mga0a205_10272_c1 3300050515 Bacteria 8600
599 nmdc:mga0a205_55902_c1 3300050515 Bacteria 3811
600 nmdc:mga0sz30_3432_c1 3300050516 Bacteria 5710
601 Ga0495612_0043296 3300053078 Bacteria 1839
602 Ga0495595_0076644 3300053084 Bacteria 1587
603 Ga0495619_0024500 3300053085 Bacteria 3871
604 Ga0500652_000323 3300053131 Bacteria 17135
605 Ga0501084_0001702 3300054114 Bacteria 17475
606 Ga0501082_0000853 3300060353 Bacteria 26885
607 Ga0501082_0294315 3300060353 Bacteria 1413
608 Ga0466962_0000566 3300061719 Bacteria 16241
609 Ga0466962_0011231 3300061719 Bacteria 4312
610 Ga0530510_0000142 3300061734 Bacteria 42031

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053078 Ga0495612_0043296 Ga0495612_0043296_39_1145 365
2 3300044706 Ga0466964_0096034 Ga0466964_0096034_61_1281 384
3 3300005455 Ga0070663_100081598 Ga0070663_1000815983 386
4 3300037853 Ga0436364_0090786 Ga0436364_0090786_1083_2279 388
5 3300005347 Ga0070668_100014822 Ga0070668_1000148224 389
6 3300005367 Ga0070667_100003861 Ga0070667_10000386110 389
7 3300025986 Ga0207658_10018143 Ga0207658_100181433 389
8 3300005548 Ga0070665_100000401 Ga0070665_10000040144 391
9 3300005843 Ga0068860_100000114 Ga0068860_10000011444 391
10 3300028379 Ga0268266_10001585 Ga0268266_100015858 391
11 3300028381 Ga0268264_10000147 Ga0268264_1000014744 391
12 iso_pu_bacteria 2775506925 2776371604 392
13 3300035117 Ga0373953_0038220 Ga0373953_0038220_441_1631 393
14 3300044658 Ga0466972_0036883 Ga0466972_0036883_1143_2327 394
15 3300044693 Ga0466961_0068835 Ga0466961_0068835_507_1697 394
16 3300045049 Ga0466959_0163076 Ga0466959_0163076_344_1528 394
17 3300005334 Ga0068869_100181182 Ga0068869_1001811821 396
18 3300005338 Ga0068868_100084430 Ga0068868_1000844303 396
19 3300005347 Ga0070668_100008184 Ga0070668_1000081844 396
20 3300005353 Ga0070669_100044389 Ga0070669_1000443893 396
21 3300005355 Ga0070671_100014146 Ga0070671_1000141461 396
22 3300005364 Ga0070673_100086039 Ga0070673_1000860393 396
23 3300005434 Ga0070709_10060166 Ga0070709_100601662 396
24 3300005439 Ga0070711_100150308 Ga0070711_1001503082 396
25 3300005466 Ga0070685_10063826 Ga0070685_100638261 396
26 3300005546 Ga0070696_100017874 Ga0070696_1000178741 396
27 3300005549 Ga0070704_100179609 Ga0070704_1001796091 396
28 3300005614 Ga0068856_100219116 Ga0068856_1002191162 396
29 3300005616 Ga0068852_100005953 Ga0068852_1000059533 396
30 3300005842 Ga0068858_100011913 Ga0068858_1000119134 396
31 3300006237 Ga0097621_100243256 Ga0097621_1002432561 396
32 3300006914 Ga0075436_100097534 Ga0075436_1000975341 396
33 3300025923 Ga0207681_10156698 Ga0207681_101566982 396
34 3300026118 Ga0207675_100010155 Ga0207675_1000101556 396
35 3300031824 Ga0307413_10011436 Ga0307413_100114365 396
36 3300039437 Ga0436365_1226639 Ga0436365_1226639_421_1611 396
37 3300046690 Ga0495624_0141757 Ga0495624_0141757_137_1327 396
38 3300048929 Ga0496126_0000003 Ga0496126_0000003_505928_507121 396
39 3300045976 Ga0466967_0007673 Ga0466967_0007673_1492_2727 401
40 iso_pu_bacteria 2795385472 2795791772 405
41 3300037312 Ga0395899_0083821 Ga0395899_0083821_30_1286 407
42 3300005467 Ga0070706_100010721 Ga0070706_1000107214 408
43 3300005468 Ga0070707_100000213 Ga0070707_10000021344 408
44 3300005471 Ga0070698_100000527 Ga0070698_10000052733 408
45 3300025910 Ga0207684_10020476 Ga0207684_100204764 408
46 3300025922 Ga0207646_10000105 Ga0207646_1000010566 408
47 3300035111 Ga0373923_0029939 Ga0373923_0029939_416_1651 408
48 3300035113 Ga0373936_0049371 Ga0373936_0049371_198_1433 408
49 3300035118 Ga0373954_0027618 Ga0373954_0027618_374_1609 408
50 3300035172 Ga0373955_0035391 Ga0373955_0035391_199_1434 408
51 3300046454 Ga0495592_0055242 Ga0495592_0055242_786_2021 408
52 3300046459 Ga0495629_0003195 Ga0495629_0003195_71_1306 408
53 3300046461 Ga0495641_0011885 Ga0495641_0011885_997_2232 408
54 3300046462 Ga0495651_0009515 Ga0495651_0009515_3860_5095 408
55 3300046473 Ga0495582_0002562 Ga0495582_0002562_2152_3387 408
56 3300046475 Ga0495639_0017334 Ga0495639_0017334_626_1861 408
57 3300046476 Ga0495662_0020498 Ga0495662_0020498_917_2152 408
58 3300046511 Ga0495608_0009657 Ga0495608_0009657_3129_4364 408
59 3300046517 Ga0495630_0090057 Ga0495630_0090057_246_1481 408
60 3300046533 Ga0495640_0048191 Ga0495640_0048191_921_2156 408
61 3300046543 Ga0495645_0009696 Ga0495645_0009696_1371_2606 408
62 3300046559 Ga0495667_0057518 Ga0495667_0057518_785_2020 408
63 3300046663 Ga0495635_0014323 Ga0495635_0014323_870_2105 408
64 3300046675 Ga0495657_0020345 Ga0495657_0020345_3129_4364 408
65 3300046683 Ga0495658_0009331 Ga0495658_0009331_2420_3655 408
66 3300046689 Ga0495613_0109622 Ga0495613_0109622_348_1583 408
67 3300046690 Ga0495624_0036086 Ga0495624_0036086_836_2071 408
68 3300047315 Ga0495581_0007738 Ga0495581_0007738_373_1608 408
69 3300047317 Ga0495604_0055898 Ga0495604_0055898_1778_3013 408
70 3300047322 Ga0495680_0071345 Ga0495680_0071345_199_1434 408
71 3300047471 Ga0495684_0030287 Ga0495684_0030287_1339_2574 408
72 3300048088 Ga0495602_0045280 Ga0495602_0045280_199_1434 408
73 3300048089 Ga0495614_0023959 Ga0495614_0023959_521_1756 408
74 3300053084 Ga0495595_0076644 Ga0495595_0076644_109_1344 408
75 3300035119 Ga0373956_0004349 Ga0373956_0004349_3743_5083 409
76 3300005334 Ga0068869_100015064 Ga0068869_1000150644 410
77 3300005336 Ga0070680_100090769 Ga0070680_1000907691 410
78 3300005338 Ga0068868_100028502 Ga0068868_1000285022 410
79 3300005339 Ga0070660_100146654 Ga0070660_1001466541 410
80 3300005366 Ga0070659_100023115 Ga0070659_1000231153 410
81 3300005441 Ga0070700_100010160 Ga0070700_1000101606 410
82 3300005455 Ga0070663_100003410 Ga0070663_1000034105 410
83 3300005457 Ga0070662_100024724 Ga0070662_1000247243 410
84 3300005577 Ga0068857_100019120 Ga0068857_1000191206 410
85 3300005578 Ga0068854_100094689 Ga0068854_1000946892 410
86 3300005616 Ga0068852_100099945 Ga0068852_1000999452 410
87 3300009094 Ga0111539_10005914 Ga0111539_1000591413 410
88 3300009148 Ga0105243_10070243 Ga0105243_100702431 410
89 3300014325 Ga0163163_10134731 Ga0163163_101347312 410
90 3300014745 Ga0157377_10002864 Ga0157377_100028644 410
91 3300025933 Ga0207706_10014937 Ga0207706_100149377 410
92 3300025940 Ga0207691_10206751 Ga0207691_102067512 410
93 3300025942 Ga0207689_10023158 Ga0207689_100231584 410
94 3300025945 Ga0207679_10002163 Ga0207679_1000216312 410
95 3300025981 Ga0207640_10075498 Ga0207640_100754982 410
96 3300026023 Ga0207677_10052034 Ga0207677_100520344 410
97 3300026067 Ga0207678_10004102 Ga0207678_100041026 410
98 3300026075 Ga0207708_10018507 Ga0207708_100185072 410
99 3300026116 Ga0207674_10017440 Ga0207674_100174406 410
100 3300026121 Ga0207683_10090615 Ga0207683_100906152 410
101 3300026142 Ga0207698_10039771 Ga0207698_100397712 410
102 3300050511 nmdc:mga08y16_116013_c1 nmdc:mga08y16_116013_c1_690_2000 410
103 3300044694 Ga0466963_0133200 Ga0466963_0133200_333_1580 411
104 3300044735 Ga0466968_0041430 Ga0466968_0041430_541_1788 411
105 3300049575 Ga0501039_0012507 Ga0501039_0012507_246_1550 411
106 3300049576 Ga0501040_0003285 Ga0501040_0003285_2776_4080 411
107 3300049577 Ga0501041_0000134 Ga0501041_0000134_437_1741 411
108 3300049580 Ga0501046_0001172 Ga0501046_0001172_23933_25237 411
109 3300049584 Ga0501068_0017459 Ga0501068_0017459_242_1546 411
110 3300049824 Ga0501045_0002189 Ga0501045_0002189_155_1459 411
111 3300046539 Ga0495621_0021044 Ga0495621_0021044_871_2118 412
112 3300049568 Ga0501031_0107159 Ga0501031_0107159_282_1586 413
113 iso_pu_bacteria 2808606522 2809586052 413
114 3300009148 Ga0105243_10000176 Ga0105243_1000017627 415
115 3300025935 Ga0207709_10000739 Ga0207709_1000073917 415
116 3300042136 Ga0450900_001900 Ga0450900_001900_16_1329 415
117 3300032002 Ga0307416_100209866 Ga0307416_1002098662 416
118 3300032126 Ga0307415_100005308 Ga0307415_1000053082 416
119 3300048929 Ga0496126_0005807 Ga0496126_0005807_6642_7940 416
120 3300009545 Ga0105237_10160494 Ga0105237_101604942 417
121 3300025914 Ga0207671_10117837 Ga0207671_101178373 417
122 3300044684 Ga0466966_0013306 Ga0466966_0013306_1328_2641 417
123 3300045049 Ga0466959_0006432 Ga0466959_0006432_4670_5983 417
124 3300005327 Ga0070658_10016833 Ga0070658_100168332 418
125 3300005344 Ga0070661_100036432 Ga0070661_1000364325 418
126 3300005530 Ga0070679_100078617 Ga0070679_1000786174 418
127 3300037466 Ga0395898_0189323 Ga0395898_0189323_456_1799 418
128 3300037471 Ga0395905_0198768 Ga0395905_0198768_358_1701 418
129 3300038443 Ga0395901_0005633 Ga0395901_0005633_478_1821 418
130 3300049572 Ga0501036_0024907 Ga0501036_0024907_3408_4709 418
131 3300049573 Ga0501037_0114019 Ga0501037_0114019_472_1773 418
132 3300049591 Ga0501075_0008416 Ga0501075_0008416_362_1663 418
133 3300049592 Ga0501076_0001857 Ga0501076_0001857_201_1502 418
134 3300049743 Ga0501081_0002166 Ga0501081_0002166_7058_8362 418
135 3300025920 Ga0207649_10033586 Ga0207649_100335863 419
136 3300038443 Ga0395901_0020193 Ga0395901_0020193_3967_5298 419
137 3300049569 Ga0501032_0079701 Ga0501032_0079701_725_2044 419
138 3300049570 Ga0501033_0017409 Ga0501033_0017409_2423_3742 419
139 3300049571 Ga0501034_0022894 Ga0501034_0022894_4966_6285 419
140 3300049581 Ga0501047_0046413 Ga0501047_0046413_760_2079 419
141 3300049822 Ga0501035_0000602 Ga0501035_0000602_30959_32278 419
142 3300049823 Ga0501044_0012463 Ga0501044_0012463_7397_8716 419
143 3300005441 Ga0070700_100000064 Ga0070700_10000006471 420
144 3300026075 Ga0207708_10000076 Ga0207708_100000762 420
145 3300037418 Ga0395900_0019899 Ga0395900_0019899_4267_5598 420
146 3300037418 Ga0395900_0046784 Ga0395900_0046784_437_1768 420
147 3300037466 Ga0395898_0044449 Ga0395898_0044449_336_1667 420
148 3300038443 Ga0395901_0021278 Ga0395901_0021278_3896_5227 420
149 3300046678 Ga0495599_0061354 Ga0495599_0061354_735_2006 420
150 iso_pu_bacteria 2837183177 2837185787 420
151 3300005435 Ga0070714_100062406 Ga0070714_1000624063 421
152 3300005437 Ga0070710_10000174 Ga0070710_1000017423 421
153 3300006844 Ga0075428_100025634 Ga0075428_1000256344 421
154 3300006846 Ga0075430_100003241 Ga0075430_10000324110 421
155 3300006847 Ga0075431_100002314 Ga0075431_10000231415 421
156 3300006880 Ga0075429_100003556 Ga0075429_10000355610 421
157 3300009147 Ga0114129_10008813 Ga0114129_1000881310 421
158 3300025898 Ga0207692_10000925 Ga0207692_100009259 421
159 3300044694 Ga0466963_0008033 Ga0466963_0008033_1158_2498 421
160 3300050507 nmdc:mga05p37_672_c1 nmdc:mga05p37_672_c1_5563_6861 421
161 3300050508 nmdc:mga09592_2964_c1 nmdc:mga09592_2964_c1_3219_4517 421
162 3300050509 nmdc:mga0qj67_294_c1 nmdc:mga0qj67_294_c1_3219_4517 421
163 3300050510 nmdc:mga06r32_285_c2 nmdc:mga06r32_285_c2_33322_34620 421
164 3300005436 Ga0070713_100043437 Ga0070713_1000434374 422
165 3300005981 Ga0081538_10000392 Ga0081538_1000039217 422
166 3300009551 Ga0105238_10057780 Ga0105238_100577804 422
167 3300025924 Ga0207694_10069041 Ga0207694_100690413 422
168 3300044656 Ga0466969_0004839 Ga0466969_0004839_1995_3317 422
169 3300044684 Ga0466966_0004214 Ga0466966_0004214_4797_6119 422
170 3300044693 Ga0466961_0002770 Ga0466961_0002770_8020_9342 422
171 3300044719 Ga0466971_0027693 Ga0466971_0027693_495_1817 422
172 3300045049 Ga0466959_0007060 Ga0466959_0007060_3617_4939 422
173 3300048923 Ga0496120_0008461 Ga0496120_0008461_1142_2440 422
174 3300049741 Ga0501079_0061214 Ga0501079_0061214_1271_2563 422
175 3300061719 Ga0466962_0011231 Ga0466962_0011231_2109_3431 422
176 3300005841 Ga0068863_100168409 Ga0068863_1001684093 423
177 3300044684 Ga0466966_0022867 Ga0466966_0022867_2711_4039 423
178 3300048903 Ga0496100_0028650 Ga0496100_0028650_62_1360 423
179 3300048905 Ga0496102_0000292 Ga0496102_0000292_142_1440 423
180 3300048906 Ga0496103_0016423 Ga0496103_0016423_120_1418 423
181 3300048907 Ga0496104_0118439 Ga0496104_0118439_121_1419 423
182 3300048907 Ga0496104_0174030 Ga0496104_0174030_75_1358 423
183 3300048911 Ga0496108_0248515 Ga0496108_0248515_236_1534 423
184 3300048915 Ga0496112_0144919 Ga0496112_0144919_19_1302 423
185 3300048916 Ga0496113_0126539 Ga0496113_0126539_430_1713 423
186 3300048919 Ga0496116_0003840 Ga0496116_0003840_11393_12691 423
187 3300048920 Ga0496117_0000572 Ga0496117_0000572_47678_48976 423
188 3300048921 Ga0496118_0004828 Ga0496118_0004828_3010_4308 423
189 3300048922 Ga0496119_0023406 Ga0496119_0023406_103_1401 423
190 3300048927 Ga0496124_0036597 Ga0496124_0036597_2940_4238 423
191 3300048928 Ga0496125_0043573 Ga0496125_0043573_1448_2746 423
192 3300048929 Ga0496126_0000344 Ga0496126_0000344_62610_63908 423
193 3300005445 Ga0070708_100119891 Ga0070708_1001198912 424
194 3300005467 Ga0070706_100054604 Ga0070706_1000546044 424
195 3300005468 Ga0070707_100028377 Ga0070707_1000283775 424
196 3300005471 Ga0070698_100267108 Ga0070698_1002671082 424
197 3300006028 Ga0070717_10015998 Ga0070717_100159983 424
198 3300009147 Ga0114129_10161528 Ga0114129_101615283 424
199 3300022467 Ga0224712_10009980 Ga0224712_100099802 424
200 3300025906 Ga0207699_10154642 Ga0207699_101546422 424
201 3300025922 Ga0207646_10005244 Ga0207646_100052442 424
202 3300025922 Ga0207646_10007603 Ga0207646_100076038 424
203 3300025922 Ga0207646_10255243 Ga0207646_102552431 424
204 3300046517 Ga0495630_0175985 Ga0495630_0175985_168_1475 424
205 3300005458 Ga0070681_10000077 Ga0070681_100000778 425
206 3300005530 Ga0070679_100000016 Ga0070679_100000016135 425
207 3300013105 Ga0157369_10001482 Ga0157369_1000148219 425
208 3300013105 Ga0157369_10022930 Ga0157369_100229306 425
209 3300020082 Ga0206353_11821398 Ga0206353_118213984 425
210 3300021388 Ga0213875_10015991 Ga0213875_100159912 425
211 3300025912 Ga0207707_10000089 Ga0207707_100000898 425
212 3300025917 Ga0207660_10006327 Ga0207660_100063274 425
213 3300025921 Ga0207652_10000015 Ga0207652_1000001596 425
214 3300037853 Ga0436364_0251182 Ga0436364_0251182_5804_7141 425
215 3300044694 Ga0466963_0132852 Ga0466963_0132852_324_1649 425
216 3300049823 Ga0501044_0007990 Ga0501044_0007990_4385_5665 425
217 iso_pu_bacteria 2918501144 2918506935 425
218 3300003203 JGI25406J46586_10017546 JGI25406J46586_100175462 426
219 3300005455 Ga0070663_100009904 Ga0070663_1000099043 426
220 3300005985 Ga0081539_10003154 Ga0081539_100031547 426
221 3300021388 Ga0213875_10001286 Ga0213875_100012869 426
222 3300025921 Ga0207652_10138007 Ga0207652_101380072 426
223 3300028379 Ga0268266_10245668 Ga0268266_102456682 426
224 3300031548 Ga0307408_100161744 Ga0307408_1001617441 426
225 3300031731 Ga0307405_10002200 Ga0307405_100022008 426
226 3300031824 Ga0307413_10040751 Ga0307413_100407513 426
227 3300031852 Ga0307410_10003205 Ga0307410_100032056 426
228 3300031901 Ga0307406_10007359 Ga0307406_100073594 426
229 3300031903 Ga0307407_10006451 Ga0307407_100064513 426
230 3300031995 Ga0307409_100000197 Ga0307409_10000019715 426
231 3300032002 Ga0307416_100003728 Ga0307416_1000037287 426
232 3300032005 Ga0307411_10006006 Ga0307411_100060065 426
233 3300032126 Ga0307415_100003572 Ga0307415_1000035725 426
234 3300037853 Ga0436364_0512751 Ga0436364_0512751_23699_25036 426
235 3300044693 Ga0466961_0001396 Ga0466961_0001396_12719_14014 426
236 3300044694 Ga0466963_0040543 Ga0466963_0040543_294_1592 426
237 3300045836 Ga0466958_0046431 Ga0466958_0046431_790_2085 426
238 3300048929 Ga0496126_0142815 Ga0496126_0142815_676_1971 426
239 3300049570 Ga0501033_0150472 Ga0501033_0150472_17_1333 426
240 iso_pu_bacteria 2523231044 2523386566 426
241 iso_pu_bacteria 2899370129 2899373743 426
242 iso_pu_bacteria 8003314358 8003316372 426
243 3300005328 Ga0070676_10039604 Ga0070676_100396042 427
244 3300005337 Ga0070682_100034956 Ga0070682_1000349563 427
245 3300005340 Ga0070689_100125006 Ga0070689_1001250062 427
246 3300005458 Ga0070681_10012712 Ga0070681_100127128 427
247 3300005530 Ga0070679_100137619 Ga0070679_1001376192 427
248 3300005614 Ga0068856_100183267 Ga0068856_1001832671 427
249 3300005615 Ga0070702_100128942 Ga0070702_1001289422 427
250 3300005618 Ga0068864_100039541 Ga0068864_1000395414 427
251 3300009174 Ga0105241_10094905 Ga0105241_100949052 427
252 3300020082 Ga0206353_10379419 Ga0206353_103794192 427
253 3300025901 Ga0207688_10063870 Ga0207688_100638702 427
254 3300025912 Ga0207707_10013813 Ga0207707_100138135 427
255 3300025921 Ga0207652_10111298 Ga0207652_101112983 427
256 3300025933 Ga0207706_10033507 Ga0207706_100335072 427
257 3300025949 Ga0207667_10213704 Ga0207667_102137041 427
258 3300026088 Ga0207641_10168454 Ga0207641_101684542 427
259 3300030733 Ga0314311_1001867 Ga0314311_10018674 427
260 3300032005 Ga0307411_10012993 Ga0307411_100129932 427
261 3300044658 Ga0466972_0008802 Ga0466972_0008802_2894_4189 427
262 3300044683 Ga0466965_0000962 Ga0466965_0000962_5321_6616 427
263 3300044683 Ga0466965_0003981 Ga0466965_0003981_4611_5906 427
264 3300044683 Ga0466965_0004181 Ga0466965_0004181_4027_5322 427
265 3300044684 Ga0466966_0089499 Ga0466966_0089499_568_1866 427
266 3300044693 Ga0466961_0016856 Ga0466961_0016856_927_2228 427
267 3300044901 Ga0466960_0000412 Ga0466960_0000412_5135_6430 427
268 iso_pu_bacteria 2915768154 2915773536 427
269 iso_pu_bacteria 2917736166 2917741298 427
270 3300005327 Ga0070658_10004695 Ga0070658_100046952 428
271 3300005563 Ga0068855_100004544 Ga0068855_1000045448 428
272 3300005614 Ga0068856_100077264 Ga0068856_1000772642 428
273 3300005719 Ga0068861_100120019 Ga0068861_1001200192 428
274 3300006058 Ga0075432_10008885 Ga0075432_100088853 428
275 3300006846 Ga0075430_100006724 Ga0075430_1000067249 428
276 3300009094 Ga0111539_10003093 Ga0111539_100030932 428
277 3300009553 Ga0105249_10009099 Ga0105249_100090999 428
278 3300013307 Ga0157372_10000678 Ga0157372_1000067821 428
279 3300025909 Ga0207705_10023506 Ga0207705_100235061 428
280 3300025909 Ga0207705_10041874 Ga0207705_100418743 428
281 3300025925 Ga0207650_10072040 Ga0207650_100720402 428
282 3300025949 Ga0207667_10023404 Ga0207667_100234046 428
283 3300026118 Ga0207675_100002509 Ga0207675_1000025097 428
284 3300027907 Ga0207428_10001475 Ga0207428_100014752 428
285 3300031731 Ga0307405_10064876 Ga0307405_100648762 428
286 3300031852 Ga0307410_10004504 Ga0307410_100045044 428
287 3300031852 Ga0307410_10057563 Ga0307410_100575632 428
288 3300031911 Ga0307412_10116208 Ga0307412_101162082 428
289 3300031995 Ga0307409_100000337 Ga0307409_1000003379 428
290 3300032004 Ga0307414_10020370 Ga0307414_100203701 428
291 3300032126 Ga0307415_100003928 Ga0307415_1000039284 428
292 3300032126 Ga0307415_100081508 Ga0307415_1000815082 428
293 3300042005 Ga0439448_0000133 Ga0439448_0000133_3053_4363 428
294 3300042008 Ga0439450_000171 Ga0439450_000171_424_1734 428
295 3300042016 Ga0439463_000090 Ga0439463_000090_8703_10013 428
296 3300042437 Ga0439444_0001658 Ga0439444_0001658_1512_2822 428
297 3300042439 Ga0439464_0000125 Ga0439464_0000125_4397_5707 428
298 3300042530 Ga0450916_001317 Ga0450916_001317_728_2038 428
299 3300042993 Ga0439440_0000024 Ga0439440_0000024_8840_10150 428
300 3300044658 Ga0466972_0004496 Ga0466972_0004496_2362_3663 428
301 3300046537 Ga0495598_0006230 Ga0495598_0006230_904_2214 428
302 3300049568 Ga0501031_0000786 Ga0501031_0000786_6020_7330 428
303 3300049568 Ga0501031_0001466 Ga0501031_0001466_3670_5013 428
304 3300049568 Ga0501031_0001689 Ga0501031_0001689_4927_6234 428
305 3300049569 Ga0501032_0000529 Ga0501032_0000529_9450_10793 428
306 3300049570 Ga0501033_0007352 Ga0501033_0007352_5829_7172 428
307 3300049571 Ga0501034_0005705 Ga0501034_0005705_8518_9861 428
308 3300049571 Ga0501034_0029795 Ga0501034_0029795_3453_4760 428
309 3300049572 Ga0501036_0000208 Ga0501036_0000208_35890_37200 428
310 3300049572 Ga0501036_0002407 Ga0501036_0002407_11581_12924 428
311 3300049573 Ga0501037_0001621 Ga0501037_0001621_1059_2402 428
312 3300049573 Ga0501037_0014597 Ga0501037_0014597_3162_4472 428
313 3300049574 Ga0501038_0003875 Ga0501038_0003875_11504_12847 428
314 3300049574 Ga0501038_0008098 Ga0501038_0008098_5738_7048 428
315 3300049575 Ga0501039_0000629 Ga0501039_0000629_13133_14443 428
316 3300049575 Ga0501039_0008229 Ga0501039_0008229_5548_6891 428
317 3300049576 Ga0501040_0000013 Ga0501040_0000013_62391_63701 428
318 3300049576 Ga0501040_0044155 Ga0501040_0044155_1568_2911 428
319 3300049577 Ga0501041_0001378 Ga0501041_0001378_8726_10036 428
320 3300049578 Ga0501042_0000426 Ga0501042_0000426_5819_7129 428
321 3300049578 Ga0501042_0001684 Ga0501042_0001684_2818_4161 428
322 3300049579 Ga0501043_0014156 Ga0501043_0014156_174_1481 428
323 3300049579 Ga0501043_0020981 Ga0501043_0020981_3670_5013 428
324 3300049580 Ga0501046_0001681 Ga0501046_0001681_12406_13716 428
325 3300049580 Ga0501046_0004074 Ga0501046_0004074_2486_3829 428
326 3300049581 Ga0501047_0002802 Ga0501047_0002802_3670_5013 428
327 3300049582 Ga0501048_0000215 Ga0501048_0000215_8743_10053 428
328 3300049582 Ga0501048_0002334 Ga0501048_0002334_10321_11664 428
329 3300049582 Ga0501048_0008359 Ga0501048_0008359_2182_3489 428
330 3300049583 Ga0501067_0040637 Ga0501067_0040637_1059_2402 428
331 3300049585 Ga0501069_0040757 Ga0501069_0040757_1059_2402 428
332 3300049586 Ga0501070_0006467 Ga0501070_0006467_6578_7921 428
333 3300049587 Ga0501071_0014902 Ga0501071_0014902_107_1450 428
334 3300049588 Ga0501072_0000218 Ga0501072_0000218_35075_36385 428
335 3300049588 Ga0501072_0041820 Ga0501072_0041820_140_1483 428
336 3300049589 Ga0501073_0026995 Ga0501073_0026995_1708_3051 428
337 3300049590 Ga0501074_0023632 Ga0501074_0023632_1456_2766 428
338 3300049590 Ga0501074_0067877 Ga0501074_0067877_90_1433 428
339 3300049591 Ga0501075_0000029 Ga0501075_0000029_54863_56173 428
340 3300049592 Ga0501076_0000173 Ga0501076_0000173_35102_36412 428
341 3300049592 Ga0501076_0049135 Ga0501076_0049135_1900_3243 428
342 3300049593 Ga0501077_0000077 Ga0501077_0000077_33587_34897 428
343 3300049593 Ga0501077_0058031 Ga0501077_0058031_53_1396 428
344 3300049741 Ga0501079_0000721 Ga0501079_0000721_15201_16511 428
345 3300049741 Ga0501079_0001150 Ga0501079_0001150_7385_8728 428
346 3300049742 Ga0501080_0011290 Ga0501080_0011290_1157_2500 428
347 3300049742 Ga0501080_0011433 Ga0501080_0011433_6045_7355 428
348 3300049743 Ga0501081_0007931 Ga0501081_0007931_1882_3192 428
349 3300049744 Ga0501083_0024502 Ga0501083_0024502_2780_4123 428
350 3300049822 Ga0501035_0003399 Ga0501035_0003399_7332_8642 428
351 3300049822 Ga0501035_0010290 Ga0501035_0010290_1516_2823 428
352 3300049822 Ga0501035_0027898 Ga0501035_0027898_3667_5010 428
353 3300049823 Ga0501044_0002108 Ga0501044_0002108_3898_5241 428
354 3300049823 Ga0501044_0171028 Ga0501044_0171028_434_1741 428
355 3300049823 Ga0501044_0302782 Ga0501044_0302782_28_1329 428
356 3300049824 Ga0501045_0025660 Ga0501045_0025660_1836_3179 428
357 3300049824 Ga0501045_0047607 Ga0501045_0047607_491_1801 428
358 3300050507 nmdc:mga05p37_35803_c1 nmdc:mga05p37_35803_c1_4610_5920 428
359 3300050509 nmdc:mga0qj67_59950_c1 nmdc:mga0qj67_59950_c1_425_1735 428
360 3300050512 nmdc:mga0n895_43331_c1 nmdc:mga0n895_43331_c1_2224_3534 428
361 3300050515 nmdc:mga0a205_55902_c1 nmdc:mga0a205_55902_c1_400_1710 428
362 3300054114 Ga0501084_0001702 Ga0501084_0001702_13727_15037 428
363 3300060353 Ga0501082_0000853 Ga0501082_0000853_11219_12529 428
364 3300060353 Ga0501082_0294315 Ga0501082_0294315_23_1366 428
365 3300061734 Ga0530510_0000142 Ga0530510_0000142_25672_26982 428
366 iso_pu_bacteria 2551306166 2552111067 428
367 iso_pu_bacteria 2643221692 2644514143 428
368 iso_pu_bacteria 2744054611 2744957395 428
369 iso_pu_bacteria 2751185725 2753035971 428
370 iso_pu_bacteria 2751185792 2753326004 428
371 iso_pu_bacteria 2795385470 2795781309 428
372 iso_pu_bacteria 2842888712 2842890633 428
373 iso_pu_bacteria 2866612099 2866617267 428
374 iso_pu_bacteria 2899359706 2899361154 428
375 3300005334 Ga0068869_100027180 Ga0068869_1000271803 429
376 3300005335 Ga0070666_10025799 Ga0070666_100257993 429
377 3300005347 Ga0070668_100001503 Ga0070668_10000150315 429
378 3300005436 Ga0070713_100235480 Ga0070713_1002354802 429
379 3300005455 Ga0070663_100000466 Ga0070663_10000046613 429
380 3300005535 Ga0070684_100086143 Ga0070684_1000861433 429
381 3300005563 Ga0068855_100003813 Ga0068855_1000038137 429
382 3300005618 Ga0068864_100048460 Ga0068864_1000484604 429
383 3300005841 Ga0068863_100005170 Ga0068863_1000051703 429
384 3300005842 Ga0068858_100083714 Ga0068858_1000837142 429
385 3300005937 Ga0081455_10000071 Ga0081455_1000007195 429
386 3300005937 Ga0081455_10001759 Ga0081455_1000175917 429
387 3300005983 Ga0081540_1001045 Ga0081540_100104511 429
388 3300006028 Ga0070717_10098859 Ga0070717_100988592 429
389 3300006852 Ga0075433_10001489 Ga0075433_1000148914 429
390 3300006871 Ga0075434_100005169 Ga0075434_10000516910 429
391 3300009093 Ga0105240_10054115 Ga0105240_100541153 429
392 3300009098 Ga0105245_10044404 Ga0105245_100444043 429
393 3300009101 Ga0105247_10034450 Ga0105247_100344503 429
394 3300009176 Ga0105242_10025964 Ga0105242_100259643 429
395 3300009545 Ga0105237_10118830 Ga0105237_101188303 429
396 3300009551 Ga0105238_10004587 Ga0105238_100045873 429
397 3300009553 Ga0105249_10010376 Ga0105249_100103767 429
398 3300013105 Ga0157369_10068398 Ga0157369_100683984 429
399 3300013297 Ga0157378_10116250 Ga0157378_101162502 429
400 3300013306 Ga0163162_10006240 Ga0163162_100062402 429
401 3300014968 Ga0157379_10124618 Ga0157379_101246182 429
402 3300017792 Ga0163161_10008455 Ga0163161_100084555 429
403 3300017792 Ga0163161_10070900 Ga0163161_100709002 429
404 3300025321 Ga0207656_10015051 Ga0207656_100150513 429
405 3300025900 Ga0207710_10008663 Ga0207710_100086635 429
406 3300025907 Ga0207645_10082455 Ga0207645_100824552 429
407 3300025911 Ga0207654_10052418 Ga0207654_100524182 429
408 3300025915 Ga0207693_10031758 Ga0207693_100317583 429
409 3300025927 Ga0207687_10023953 Ga0207687_100239534 429
410 3300025928 Ga0207700_10142070 Ga0207700_101420702 429
411 3300025937 Ga0207669_10042854 Ga0207669_100428542 429
412 3300025937 Ga0207669_10062475 Ga0207669_100624752 429
413 3300025939 Ga0207665_10000912 Ga0207665_100009123 429
414 3300025942 Ga0207689_10011876 Ga0207689_100118766 429
415 3300025942 Ga0207689_10032836 Ga0207689_100328364 429
416 3300025949 Ga0207667_10194828 Ga0207667_101948281 429
417 3300025961 Ga0207712_10002242 Ga0207712_1000224210 429
418 3300025961 Ga0207712_10113207 Ga0207712_101132072 429
419 3300026023 Ga0207677_10063117 Ga0207677_100631173 429
420 3300026067 Ga0207678_10016705 Ga0207678_100167056 429
421 3300026067 Ga0207678_10022386 Ga0207678_100223863 429
422 3300026075 Ga0207708_10004349 Ga0207708_100043499 429
423 3300026088 Ga0207641_10009537 Ga0207641_100095375 429
424 3300026089 Ga0207648_10050640 Ga0207648_100506404 429
425 3300026121 Ga0207683_10004394 Ga0207683_1000439410 429
426 3300026142 Ga0207698_10022456 Ga0207698_100224562 429
427 3300031240 Ga0265320_10025164 Ga0265320_100251643 429
428 3300031241 Ga0265325_10024399 Ga0265325_100243994 429
429 3300031247 Ga0265340_10006275 Ga0265340_100062755 429
430 3300031711 Ga0265314_10007762 Ga0265314_100077626 429
431 3300031824 Ga0307413_10122783 Ga0307413_101227832 429
432 3300031852 Ga0307410_10051997 Ga0307410_100519972 429
433 3300031995 Ga0307409_100115222 Ga0307409_1001152222 429
434 3300035112 Ga0373932_0015187 Ga0373932_0015187_238_1542 429
435 3300037418 Ga0395900_0265159 Ga0395900_0265159_100_1413 429
436 3300037853 Ga0436364_0955899 Ga0436364_0955899_7458_8783 429
437 3300044656 Ga0466969_0006017 Ga0466969_0006017_3752_5071 429
438 3300044658 Ga0466972_0003690 Ga0466972_0003690_4232_5533 429
439 3300044658 Ga0466972_0009094 Ga0466972_0009094_51_1358 429
440 3300044684 Ga0466966_0001859 Ga0466966_0001859_886_2190 429
441 3300044693 Ga0466961_0095725 Ga0466961_0095725_89_1426 429
442 3300044694 Ga0466963_0001299 Ga0466963_0001299_5286_6590 429
443 3300044694 Ga0466963_0001487 Ga0466963_0001487_3013_4320 429
444 3300044719 Ga0466971_0001862 Ga0466971_0001862_5178_6482 429
445 3300044719 Ga0466971_0056094 Ga0466971_0056094_115_1476 429
446 3300044719 Ga0466971_0060540 Ga0466971_0060540_359_1666 429
447 3300044765 Ga0466970_0019429 Ga0466970_0019429_110_1429 429
448 3300044842 Ga0466957_0007701 Ga0466957_0007701_770_2074 429
449 3300045049 Ga0466959_0001272 Ga0466959_0001272_528_1832 429
450 3300045836 Ga0466958_0000116 Ga0466958_0000116_14711_16015 429
451 3300045836 Ga0466958_0060052 Ga0466958_0060052_630_1946 429
452 3300045976 Ga0466967_0000924 Ga0466967_0000924_11683_12990 429
453 3300045976 Ga0466967_0121203 Ga0466967_0121203_134_1438 429
454 3300048903 Ga0496100_0029701 Ga0496100_0029701_1900_3204 429
455 3300048907 Ga0496104_0003042 Ga0496104_0003042_12736_14040 429
456 3300048908 Ga0496105_0006019 Ga0496105_0006019_3334_4638 429
457 3300049585 Ga0501069_0010476 Ga0501069_0010476_736_2040 429
458 3300049586 Ga0501070_0025483 Ga0501070_0025483_952_2256 429
459 3300049742 Ga0501080_0000266 Ga0501080_0000266_27255_28559 429
460 3300050515 nmdc:mga0a205_10272_c1 nmdc:mga0a205_10272_c1_5567_6871 429
461 3300061719 Ga0466962_0000566 Ga0466962_0000566_5313_6617 429
462 3300005355 Ga0070671_100000653 Ga0070671_1000006536 430
463 3300005548 Ga0070665_100005239 Ga0070665_1000052397 430
464 3300005841 Ga0068863_100034594 Ga0068863_1000345943 430
465 3300025931 Ga0207644_10001889 Ga0207644_100018896 430
466 3300025972 Ga0207668_10078949 Ga0207668_100789492 430
467 3300026088 Ga0207641_10036495 Ga0207641_100364955 430
468 3300028381 Ga0268264_10019740 Ga0268264_100197401 430
469 3300031616 Ga0307508_10003996 Ga0307508_1000399610 430
470 3300033180 Ga0307510_10112253 Ga0307510_101122533 430
471 3300048922 Ga0496119_0000200 Ga0496119_0000200_73780_75129 430
472 3300048923 Ga0496120_0005099 Ga0496120_0005099_3751_5100 430
473 3300053085 Ga0495619_0024500 Ga0495619_0024500_1654_2958 430
474 iso_pu_bacteria 2738543011 2739235941 430
475 iso_pu_bacteria 2889300758 2889305539 430
476 iso_pu_bacteria 2915358134 2915361536 430
477 iso_pu_bacteria 2939743619 2939743675 430
478 iso_pu_bacteria 8047710418 8047718431 430
479 3300006028 Ga0070717_10037923 Ga0070717_100379232 431
480 3300006353 Ga0075370_10045494 Ga0075370_100454942 431
481 3300025929 Ga0207664_10054432 Ga0207664_100544322 431
482 3300044765 Ga0466970_0014201 Ga0466970_0014201_157_1467 431
483 3300044842 Ga0466957_0029764 Ga0466957_0029764_143_1492 431
484 3300046531 Ga0495665_0012173 Ga0495665_0012173_2121_3446 431
485 3300048906 Ga0496103_0008519 Ga0496103_0008519_3676_5034 431
486 3300048911 Ga0496108_0141950 Ga0496108_0141950_515_1834 431
487 3300048921 Ga0496118_0117707 Ga0496118_0117707_22_1380 431
488 iso_pu_bacteria 2565956761 2566996745 431
489 iso_pu_bacteria 2738541308 2738887658 431
490 iso_pu_bacteria 2904535858 2904541488 431
491 iso_pu_bacteria 2922554459 2922560136 431
492 iso_pu_bacteria 2956939328 2956940875 431
493 iso_pu_bacteria 3001119090 3001120564 431
494 3300026067 Ga0207678_10001240 Ga0207678_1000124015 432
495 3300026116 Ga0207674_10071173 Ga0207674_100711733 432
496 3300031838 Ga0307518_10005413 Ga0307518_100054139 432
497 3300045976 Ga0466967_0002676 Ga0466967_0002676_9332_10693 432
498 3300048905 Ga0496102_0000409 Ga0496102_0000409_7328_8647 432
499 3300048906 Ga0496103_0015040 Ga0496103_0015040_3260_4579 432
500 iso_pu_bacteria 2738543005 2739202625 432
501 iso_pu_bacteria 2870782633 2870788412 432
502 iso_pu_bacteria 2904765812 2904767577 432
503 iso_pu_bacteria 2904770941 2904774925 432
504 iso_pu_bacteria 2908811453 2908813219 432
505 iso_pu_bacteria 2919420072 2919424560 432
506 iso_pu_bacteria 2919432681 2919437059 432
507 iso_pu_bacteria 2928142448 2928143155 432
508 iso_pu_bacteria 2974315732 2974316031 432
509 iso_pu_bacteria 2984523437 2984524194 432
510 iso_pu_bacteria 8056207758 8056210976 432
511 3300031838 Ga0307518_10000304 Ga0307518_1000030411 433
512 3300033179 Ga0307507_10038408 Ga0307507_100384085 433
513 3300047472 Ga0495686_0002331 Ga0495686_0002331_14273_15586 433
514 3300048915 Ga0496112_0114299 Ga0496112_0114299_1056_2357 433
515 3300053131 Ga0500652_000323 Ga0500652_000323_12341_13648 433
516 iso_pu_bacteria 2585427649 2586064717 433
517 iso_pu_bacteria 2738541274 2738702743 433
518 iso_pu_bacteria 2738543028 2739329652 433
519 3300002077 JGI24744J21845_10009136 JGI24744J21845_100091362 434
520 3300002077 JGI24744J21845_10009863 JGI24744J21845_100098632 434
521 3300005328 Ga0070676_10093615 Ga0070676_100936151 434
522 3300005330 Ga0070690_100010311 Ga0070690_1000103112 434
523 3300005334 Ga0068869_100010623 Ga0068869_1000106234 434
524 3300005334 Ga0068869_100113549 Ga0068869_1001135493 434
525 3300005338 Ga0068868_100006215 Ga0068868_1000062156 434
526 3300005338 Ga0068868_100051984 Ga0068868_1000519844 434
527 3300005341 Ga0070691_10004199 Ga0070691_100041994 434
528 3300005341 Ga0070691_10086277 Ga0070691_100862771 434
529 3300005347 Ga0070668_100023950 Ga0070668_1000239502 434
530 3300005353 Ga0070669_100003990 Ga0070669_1000039904 434
531 3300005356 Ga0070674_100008667 Ga0070674_1000086674 434
532 3300005364 Ga0070673_100032954 Ga0070673_1000329543 434
533 3300005365 Ga0070688_100014774 Ga0070688_1000147742 434
534 3300005365 Ga0070688_100020938 Ga0070688_1000209385 434
535 3300005366 Ga0070659_100015049 Ga0070659_1000150494 434
536 3300005366 Ga0070659_100129592 Ga0070659_1001295922 434
537 3300005367 Ga0070667_100003097 Ga0070667_10000309719 434
538 3300005434 Ga0070709_10044865 Ga0070709_100448652 434
539 3300005437 Ga0070710_10006635 Ga0070710_100066352 434
540 3300005438 Ga0070701_10002167 Ga0070701_100021675 434
541 3300005439 Ga0070711_100007734 Ga0070711_1000077344 434
542 3300005440 Ga0070705_100044584 Ga0070705_1000445843 434
543 3300005441 Ga0070700_100037284 Ga0070700_1000372842 434
544 3300005455 Ga0070663_100021979 Ga0070663_1000219794 434
545 3300005456 Ga0070678_100001568 Ga0070678_1000015689 434
546 3300005456 Ga0070678_100121361 Ga0070678_1001213612 434
547 3300005459 Ga0068867_100008283 Ga0068867_1000082834 434
548 3300005539 Ga0068853_100005937 Ga0068853_1000059375 434
549 3300005539 Ga0068853_100235151 Ga0068853_1002351511 434
550 3300005547 Ga0070693_100059561 Ga0070693_1000595612 434
551 3300005549 Ga0070704_100005753 Ga0070704_1000057535 434
552 3300005549 Ga0070704_100087318 Ga0070704_1000873183 434
553 3300005563 Ga0068855_100030141 Ga0068855_1000301417 434
554 3300005578 Ga0068854_100061046 Ga0068854_1000610461 434
555 3300005616 Ga0068852_100025899 Ga0068852_1000258992 434
556 3300005617 Ga0068859_100014343 Ga0068859_1000143435 434
557 3300005718 Ga0068866_10004247 Ga0068866_100042473 434
558 3300005719 Ga0068861_100010212 Ga0068861_1000102126 434
559 3300006051 Ga0075364_10013585 Ga0075364_100135852 434
560 3300006175 Ga0070712_100003874 Ga0070712_1000038746 434
561 3300006175 Ga0070712_100018973 Ga0070712_1000189734 434
562 3300006186 Ga0075369_10001162 Ga0075369_100011622 434
563 3300006237 Ga0097621_100018361 Ga0097621_1000183616 434
564 3300006881 Ga0068865_100004566 Ga0068865_1000045666 434
565 3300006931 Ga0097620_100014343 Ga0097620_1000143435 434
566 3300009098 Ga0105245_10011470 Ga0105245_100114705 434
567 3300009101 Ga0105247_10000587 Ga0105247_1000058733 434
568 3300009148 Ga0105243_10017022 Ga0105243_100170222 434
569 3300009148 Ga0105243_10053042 Ga0105243_100530422 434
570 3300009174 Ga0105241_10130677 Ga0105241_101306771 434
571 3300009176 Ga0105242_10000541 Ga0105242_1000054122 434
572 3300009176 Ga0105242_10040131 Ga0105242_100401314 434
573 3300009545 Ga0105237_10050276 Ga0105237_100502765 434
574 3300009553 Ga0105249_10001455 Ga0105249_100014555 434
575 3300009553 Ga0105249_10206108 Ga0105249_102061082 434
576 3300009979 Ga0105032_101028 Ga0105032_1010282 434
577 3300010375 Ga0105239_10010931 Ga0105239_100109317 434
578 3300011119 Ga0105246_10057272 Ga0105246_100572722 434
579 3300013105 Ga0157369_10306372 Ga0157369_103063721 434
580 3300013296 Ga0157374_10067285 Ga0157374_100672852 434
581 3300013297 Ga0157378_10025526 Ga0157378_100255262 434
582 3300013308 Ga0157375_10011156 Ga0157375_100111565 434
583 3300013308 Ga0157375_10302950 Ga0157375_103029502 434
584 3300014326 Ga0157380_10062044 Ga0157380_100620444 434
585 3300014968 Ga0157379_10106086 Ga0157379_101060862 434
586 3300017792 Ga0163161_10006350 Ga0163161_100063505 434
587 3300017792 Ga0163161_10191079 Ga0163161_101910791 434
588 3300025900 Ga0207710_10018370 Ga0207710_100183703 434
589 3300025901 Ga0207688_10002201 Ga0207688_100022015 434
590 3300025901 Ga0207688_10014213 Ga0207688_100142132 434
591 3300025901 Ga0207688_10040260 Ga0207688_100402602 434
592 3300025904 Ga0207647_10065140 Ga0207647_100651403 434
593 3300025905 Ga0207685_10002600 Ga0207685_100026004 434
594 3300025906 Ga0207699_10041228 Ga0207699_100412283 434
595 3300025915 Ga0207693_10001988 Ga0207693_1000198816 434
596 3300025915 Ga0207693_10004400 Ga0207693_1000440013 434
597 3300025916 Ga0207663_10002104 Ga0207663_100021045 434
598 3300025923 Ga0207681_10010077 Ga0207681_100100775 434
599 3300025927 Ga0207687_10003407 Ga0207687_1000340711 434
600 3300025927 Ga0207687_10050024 Ga0207687_100500243 434
601 3300025931 Ga0207644_10167071 Ga0207644_101670712 434
602 3300025932 Ga0207690_10027252 Ga0207690_100272524 434
603 3300025933 Ga0207706_10005837 Ga0207706_100058378 434
604 3300025933 Ga0207706_10022323 Ga0207706_100223234 434
605 3300025934 Ga0207686_10038559 Ga0207686_100385594 434
606 3300025935 Ga0207709_10064063 Ga0207709_100640632 434
607 3300025937 Ga0207669_10003202 Ga0207669_100032022 434
608 3300025937 Ga0207669_10055780 Ga0207669_100557805 434
609 3300025938 Ga0207704_10002568 Ga0207704_100025685 434
610 3300025942 Ga0207689_10006351 Ga0207689_1000635114 434
611 3300025942 Ga0207689_10024668 Ga0207689_100246682 434
612 3300025961 Ga0207712_10010257 Ga0207712_100102573 434
613 3300025972 Ga0207668_10004560 Ga0207668_100045602 434
614 3300025972 Ga0207668_10048577 Ga0207668_100485772 434
615 3300025981 Ga0207640_10008628 Ga0207640_100086283 434
616 3300025986 Ga0207658_10013062 Ga0207658_100130623 434
617 3300026023 Ga0207677_10004360 Ga0207677_100043605 434
618 3300026035 Ga0207703_10016320 Ga0207703_100163205 434
619 3300026041 Ga0207639_10009529 Ga0207639_100095293 434
620 3300026067 Ga0207678_10013386 Ga0207678_100133864 434
621 3300026075 Ga0207708_10025739 Ga0207708_100257392 434
622 3300026075 Ga0207708_10055787 Ga0207708_100557872 434
623 3300026089 Ga0207648_10005879 Ga0207648_100058792 434
624 3300026089 Ga0207648_10008936 Ga0207648_100089365 434
625 3300026116 Ga0207674_10054790 Ga0207674_100547903 434
626 3300026118 Ga0207675_100001816 Ga0207675_10000181622 434
627 3300026118 Ga0207675_100028433 Ga0207675_1000284334 434
628 3300026118 Ga0207675_100150513 Ga0207675_1001505132 434
629 3300026121 Ga0207683_10001438 Ga0207683_1000143822 434
630 3300026121 Ga0207683_10107455 Ga0207683_101074552 434
631 3300026121 Ga0207683_10133921 Ga0207683_101339212 434
632 3300026142 Ga0207698_10067249 Ga0207698_100672492 434
633 3300028379 Ga0268266_10014769 Ga0268266_100147695 434
634 3300028380 Ga0268265_10060409 Ga0268265_100604094 434
635 3300028381 Ga0268264_10008608 Ga0268264_100086085 434
636 3300044683 Ga0466965_0001996 Ga0466965_0001996_5134_6456 434
637 3300044706 Ga0466964_0012279 Ga0466964_0012279_1620_2948 434
638 3300044735 Ga0466968_0000508 Ga0466968_0000508_5707_7029 434
639 3300044765 Ga0466970_0006801 Ga0466970_0006801_3064_4386 434
640 3300045976 Ga0466967_0002704 Ga0466967_0002704_4371_5690 434
641 3300048903 Ga0496100_0010318 Ga0496100_0010318_440_1744 434
642 3300048904 Ga0496101_0005719 Ga0496101_0005719_6087_7391 434
643 3300048905 Ga0496102_0114293 Ga0496102_0114293_173_1477 434
644 3300048909 Ga0496106_0113115 Ga0496106_0113115_398_1702 434
645 3300048910 Ga0496107_0004037 Ga0496107_0004037_4825_6129 434
646 3300048911 Ga0496108_0001993 Ga0496108_0001993_11402_12706 434
647 3300048912 Ga0496109_0001047 Ga0496109_0001047_12896_14200 434
648 3300048913 Ga0496110_0274425 Ga0496110_0274425_137_1474 434
649 3300048915 Ga0496112_0010431 Ga0496112_0010431_645_1949 434
650 3300048917 Ga0496114_0002107 Ga0496114_0002107_2834_4138 434
651 3300048917 Ga0496114_0080999 Ga0496114_0080999_107_1411 434
652 3300048918 Ga0496115_0015008 Ga0496115_0015008_507_1811 434
653 3300050491 nmdc:mga00v17_7817_c1 nmdc:mga00v17_7817_c1_3384_4700 434
654 3300050516 nmdc:mga0sz30_3432_c1 nmdc:mga0sz30_3432_c1_679_1995 434
655 iso_pu_bacteria 2558860112 2558912561 434
656 iso_pu_bacteria 2816332139 2816505739 434
657 iso_pu_bacteria 2863067949 2863070182 434
658 iso_pu_bacteria 2866552031 2866555713 434
659 iso_pu_bacteria 8054472261 8054474499 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

48

439

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cfb-assembly1.cif.gz_A-2 glutamate-1-semialdehyde 2,1-aminomutase from thermosynechococcus elongatus 0.9677 36 424
2hp1-assembly1.cif.gz_B inter-subunit signaling in gsam 0.9647 6 425
2hoy-assembly1.cif.gz_A inter-subunit signaling in gsam 0.9634 6 424
4gsa-assembly1.cif.gz_A crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase) reduced with cyanoborohydrate 0.9621 6 424
2hp1-assembly1.cif.gz_A inter-subunit signaling in gsam 0.961 4 425
ID Description Score Start End Superfamily
6dvsA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9431 72 317 3.40.640.10
2gsaA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9405 72 317 3.40.640.10
2cfbA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9394 323 424 3.90.1150.10
af_Q2G283_321_426_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9377 323 423 3.90.1150.10
4e77A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9372 72 317 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2X3HJA9-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (Glutamate-1-semialdehyde aminotransferase) 0.9716 7 143 GO:0008483
GO:0030170
GO:0042286
AF-A0A378UW51-F1-model_v4 Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8) 0.971 226 431 GO:0008483
GO:0030170
GO:0042286
AF-A0A7K2NRA2-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9703 182 431 GO:0008483
GO:0030170
AF-W7SXH3-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase 0.9678 168 431 GO:0008483
GO:0030170
AF-A0A813BXZ7-F1-model_v4 glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) 0.9659 10 425 GO:0005247
GO:0006782
GO:0008483
GO:0016020
GO:0030170
GO:0042286

Feature Viewer

pLDDT pTM Quality
87.94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map