F473249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 372 | 610 | 430 |
Family's Representative Sequence
| Representative Sequence | 3300022467|Ga0224712_10009980|Ga0224712_100099802 |
| Length | 451 |
| Sequence | MTAQPEFAEGAGGRSPANHGADGPTEPDLYARARAVAPGGVNSPVRAFGAVGGTPVFMASGSGPYLTDVDGKRYVDLVCSWGPMILGHAHPAVISALHRSVDLGTSFGTVTPGEVELAEQIVARTPIDKLRLVNSGTEATMSALRLARAYTGRRLTVKFAGCYHGHVDSLLASAGSGVATFGLPDSPGVTGAVTADTVVLPYNDQAAVRQAFAEHGPDIACVITEACPANMGVVPPSSGFNELLAALCGEHGSLLIMDEVLTGFRVTRSGWYGREQVPGDLMTFGKVMGGGLPAAAFGGRAEIMDLMAPLGPVYQAGTLSGNPLATAAGLATLAECTPEVYERVDAAAAAIADEASKALTGAGVPFRLSQAGNLFSVFLGVTEPVRDFAQARTQSGAAYAAFFHSMLDAGVYLPPSPYEAWFVSAAHDDAAISLIAQALPDAAEAAAAALG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 4 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 5 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 6 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 7 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 8 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 9 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 13 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 14 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 15 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 16 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 17 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 18 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 19 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 20 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 21 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 22 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 23 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 24 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 25 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 26 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 27 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 28 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 29 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 30 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 31 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 32 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 33 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 34 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 35 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 36 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 37 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 38 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 39 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 40 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 41 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 42 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 43 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 44 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 45 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 46 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 47 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 247 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 248 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 249 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 250 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 251 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 252 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 261 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 262 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 369 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 370 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 371 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 372 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.11 |
| Metatranscriptomes | 0.46 |
| Isolates | 7.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 4.25 |
| Rhizosphere | 86.34 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 8.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10009136 | 3300002077 | Bacteria | 2036 |
| 2 | JGI24744J21845_10009863 | 3300002077 | Bacteria | 1960 |
| 3 | JGI25406J46586_10017546 | 3300003203 | Bacteria | 2958 |
| 4 | Ga0070658_10004695 | 3300005327 | Bacteria | 11108 |
| 5 | Ga0070658_10016833 | 3300005327 | Bacteria | 5851 |
| 6 | Ga0070676_10039604 | 3300005328 | Bacteria | 2726 |
| 7 | Ga0070676_10093615 | 3300005328 | Bacteria | 1845 |
| 8 | Ga0070690_100010311 | 3300005330 | Bacteria | 5434 |
| 9 | Ga0068869_100010623 | 3300005334 | Bacteria | 6010 |
| 10 | Ga0068869_100015064 | 3300005334 | Bacteria | 5177 |
| 11 | Ga0068869_100027180 | 3300005334 | Bacteria | 3987 |
| 12 | Ga0068869_100113549 | 3300005334 | Bacteria | 2064 |
| 13 | Ga0068869_100181182 | 3300005334 | Bacteria | 1651 |
| 14 | Ga0070666_10025799 | 3300005335 | Bacteria | 3833 |
| 15 | Ga0070680_100090769 | 3300005336 | Bacteria | 2529 |
| 16 | Ga0070682_100034956 | 3300005337 | Bacteria | 3064 |
| 17 | Ga0068868_100006215 | 3300005338 | Bacteria | 8448 |
| 18 | Ga0068868_100028502 | 3300005338 | Bacteria | 4269 |
| 19 | Ga0068868_100051984 | 3300005338 | Bacteria | 3225 |
| 20 | Ga0068868_100084430 | 3300005338 | Bacteria | 2550 |
| 21 | Ga0070660_100146654 | 3300005339 | Bacteria | 1896 |
| 22 | Ga0070689_100125006 | 3300005340 | Bacteria | 2057 |
| 23 | Ga0070691_10004199 | 3300005341 | Bacteria | 6548 |
| 24 | Ga0070691_10086277 | 3300005341 | Bacteria | 1543 |
| 25 | Ga0070661_100036432 | 3300005344 | Bacteria | 3576 |
| 26 | Ga0070668_100001503 | 3300005347 | Bacteria | 16850 |
| 27 | Ga0070668_100008184 | 3300005347 | Bacteria | 7766 |
| 28 | Ga0070668_100014822 | 3300005347 | Bacteria | 5826 |
| 29 | Ga0070668_100023950 | 3300005347 | Bacteria | 4623 |
| 30 | Ga0070669_100003990 | 3300005353 | Bacteria | 10670 |
| 31 | Ga0070669_100044389 | 3300005353 | Bacteria | 3239 |
| 32 | Ga0070671_100000653 | 3300005355 | Bacteria | 24925 |
| 33 | Ga0070671_100014146 | 3300005355 | Bacteria | 6444 |
| 34 | Ga0070674_100008667 | 3300005356 | Bacteria | 6063 |
| 35 | Ga0070673_100032954 | 3300005364 | Bacteria | 3906 |
| 36 | Ga0070673_100086039 | 3300005364 | Bacteria | 2561 |
| 37 | Ga0070688_100014774 | 3300005365 | Bacteria | 4429 |
| 38 | Ga0070688_100020938 | 3300005365 | Bacteria | 3812 |
| 39 | Ga0070659_100015049 | 3300005366 | Bacteria | 5787 |
| 40 | Ga0070659_100023115 | 3300005366 | Bacteria | 4753 |
| 41 | Ga0070659_100129592 | 3300005366 | Bacteria | 2048 |
| 42 | Ga0070667_100003097 | 3300005367 | Bacteria | 14305 |
| 43 | Ga0070667_100003861 | 3300005367 | Bacteria | 12729 |
| 44 | Ga0070709_10044865 | 3300005434 | Bacteria | 2740 |
| 45 | Ga0070709_10060166 | 3300005434 | Bacteria | 2413 |
| 46 | Ga0070714_100062406 | 3300005435 | Bacteria | 3203 |
| 47 | Ga0070713_100043437 | 3300005436 | Bacteria | 3675 |
| 48 | Ga0070713_100235480 | 3300005436 | Bacteria | 1666 |
| 49 | Ga0070710_10000174 | 3300005437 | Bacteria | 29488 |
| 50 | Ga0070710_10006635 | 3300005437 | Bacteria | 5566 |
| 51 | Ga0070701_10002167 | 3300005438 | Bacteria | 7480 |
| 52 | Ga0070711_100007734 | 3300005439 | Bacteria | 6548 |
| 53 | Ga0070711_100150308 | 3300005439 | Bacteria | 1755 |
| 54 | Ga0070705_100044584 | 3300005440 | Bacteria | 2548 |
| 55 | Ga0070700_100000064 | 3300005441 | Bacteria | 78318 |
| 56 | Ga0070700_100010160 | 3300005441 | Bacteria | 5187 |
| 57 | Ga0070700_100037284 | 3300005441 | Bacteria | 2956 |
| 58 | Ga0070708_100119891 | 3300005445 | Bacteria | 2426 |
| 59 | Ga0070663_100000466 | 3300005455 | Bacteria | 21362 |
| 60 | Ga0070663_100003410 | 3300005455 | Bacteria | 9177 |
| 61 | Ga0070663_100009904 | 3300005455 | Bacteria | 5921 |
| 62 | Ga0070663_100021979 | 3300005455 | Bacteria | 4255 |
| 63 | Ga0070663_100081598 | 3300005455 | Bacteria | 2377 |
| 64 | Ga0070678_100001568 | 3300005456 | Bacteria | 12245 |
| 65 | Ga0070678_100121361 | 3300005456 | Bacteria | 2061 |
| 66 | Ga0070662_100024724 | 3300005457 | Bacteria | 4142 |
| 67 | Ga0070681_10000077 | 3300005458 | Bacteria | 72675 |
| 68 | Ga0070681_10012712 | 3300005458 | Bacteria | 8355 |
| 69 | Ga0068867_100008283 | 3300005459 | Bacteria | 7340 |
| 70 | Ga0070685_10063826 | 3300005466 | Bacteria | 2164 |
| 71 | Ga0070706_100010721 | 3300005467 | Bacteria | 8506 |
| 72 | Ga0070706_100054604 | 3300005467 | Bacteria | 3687 |
| 73 | Ga0070707_100000213 | 3300005468 | Bacteria | 58009 |
| 74 | Ga0070707_100028377 | 3300005468 | Bacteria | 5326 |
| 75 | Ga0070698_100000527 | 3300005471 | Bacteria | 40863 |
| 76 | Ga0070698_100267108 | 3300005471 | Bacteria | 1643 |
| 77 | Ga0070679_100000016 | 3300005530 | Bacteria | 139454 |
| 78 | Ga0070679_100078617 | 3300005530 | Bacteria | 3287 |
| 79 | Ga0070679_100137619 | 3300005530 | Bacteria | 2423 |
| 80 | Ga0070684_100086143 | 3300005535 | Bacteria | 2787 |
| 81 | Ga0068853_100005937 | 3300005539 | Bacteria | 9645 |
| 82 | Ga0068853_100235151 | 3300005539 | Bacteria | 1677 |
| 83 | Ga0070696_100017874 | 3300005546 | Bacteria | 4787 |
| 84 | Ga0070693_100059561 | 3300005547 | Bacteria | 2214 |
| 85 | Ga0070665_100000401 | 3300005548 | Bacteria | 63343 |
| 86 | Ga0070665_100005239 | 3300005548 | Bacteria | 13412 |
| 87 | Ga0070704_100005753 | 3300005549 | Bacteria | 7250 |
| 88 | Ga0070704_100087318 | 3300005549 | Bacteria | 2314 |
| 89 | Ga0070704_100179609 | 3300005549 | Bacteria | 1691 |
| 90 | Ga0068855_100003813 | 3300005563 | Bacteria | 18430 |
| 91 | Ga0068855_100004544 | 3300005563 | Bacteria | 16945 |
| 92 | Ga0068855_100030141 | 3300005563 | Bacteria | 6489 |
| 93 | Ga0068857_100019120 | 3300005577 | Bacteria | 6013 |
| 94 | Ga0068854_100061046 | 3300005578 | Bacteria | 2729 |
| 95 | Ga0068854_100094689 | 3300005578 | Bacteria | 2228 |
| 96 | Ga0068856_100077264 | 3300005614 | Bacteria | 3299 |
| 97 | Ga0068856_100183267 | 3300005614 | Bacteria | 2107 |
| 98 | Ga0068856_100219116 | 3300005614 | Bacteria | 1918 |
| 99 | Ga0070702_100128942 | 3300005615 | Bacteria | 1594 |
| 100 | Ga0068852_100005953 | 3300005616 | Bacteria | 8777 |
| 101 | Ga0068852_100025899 | 3300005616 | Bacteria | 4760 |
| 102 | Ga0068852_100099945 | 3300005616 | Bacteria | 2616 |
| 103 | Ga0068859_100014343 | 3300005617 | Bacteria | 7948 |
| 104 | Ga0068864_100039541 | 3300005618 | Bacteria | 4031 |
| 105 | Ga0068864_100048460 | 3300005618 | Bacteria | 3652 |
| 106 | Ga0068866_10004247 | 3300005718 | Bacteria | 5882 |
| 107 | Ga0068861_100010212 | 3300005719 | Bacteria | 6516 |
| 108 | Ga0068861_100120019 | 3300005719 | Bacteria | 2119 |
| 109 | Ga0068863_100005170 | 3300005841 | Bacteria | 12869 |
| 110 | Ga0068863_100034594 | 3300005841 | Bacteria | 4812 |
| 111 | Ga0068863_100168409 | 3300005841 | Bacteria | 2101 |
| 112 | Ga0068858_100011913 | 3300005842 | Bacteria | 8196 |
| 113 | Ga0068858_100083714 | 3300005842 | Bacteria | 2966 |
| 114 | Ga0068860_100000114 | 3300005843 | Bacteria | 128789 |
| 115 | Ga0081455_10000071 | 3300005937 | Bacteria | 110373 |
| 116 | Ga0081455_10001759 | 3300005937 | Bacteria | 26177 |
| 117 | Ga0081538_10000392 | 3300005981 | Bacteria | 49806 |
| 118 | Ga0081540_1001045 | 3300005983 | Bacteria | 24737 |
| 119 | Ga0081539_10003154 | 3300005985 | Bacteria | 20916 |
| 120 | Ga0070717_10015998 | 3300006028 | Bacteria | 5808 |
| 121 | Ga0070717_10037923 | 3300006028 | Bacteria | 3915 |
| 122 | Ga0070717_10098859 | 3300006028 | Bacteria | 2474 |
| 123 | Ga0075364_10013585 | 3300006051 | Bacteria | 5011 |
| 124 | Ga0075432_10008885 | 3300006058 | Bacteria | 3426 |
| 125 | Ga0070712_100003874 | 3300006175 | Bacteria | 9214 |
| 126 | Ga0070712_100018973 | 3300006175 | Bacteria | 4476 |
| 127 | Ga0075369_10001162 | 3300006186 | Bacteria | 8897 |
| 128 | Ga0097621_100018361 | 3300006237 | Bacteria | 5339 |
| 129 | Ga0097621_100243256 | 3300006237 | Bacteria | 1573 |
| 130 | Ga0075370_10045494 | 3300006353 | Bacteria | 2482 |
| 131 | Ga0075428_100025634 | 3300006844 | Bacteria | 6529 |
| 132 | Ga0075430_100003241 | 3300006846 | Bacteria | 13630 |
| 133 | Ga0075430_100006724 | 3300006846 | Bacteria | 9700 |
| 134 | Ga0075431_100002314 | 3300006847 | Bacteria | 18303 |
| 135 | Ga0075433_10001489 | 3300006852 | Bacteria | 17304 |
| 136 | Ga0075434_100005169 | 3300006871 | Bacteria | 11850 |
| 137 | Ga0075429_100003556 | 3300006880 | Bacteria | 13277 |
| 138 | Ga0068865_100004566 | 3300006881 | Bacteria | 8356 |
| 139 | Ga0075436_100097534 | 3300006914 | Bacteria | 2045 |
| 140 | Ga0097620_100014343 | 3300006931 | Bacteria | 7948 |
| 141 | Ga0105240_10054115 | 3300009093 | Bacteria | 5031 |
| 142 | Ga0111539_10003093 | 3300009094 | Bacteria | 22058 |
| 143 | Ga0111539_10005914 | 3300009094 | Bacteria | 15801 |
| 144 | Ga0105245_10011470 | 3300009098 | Bacteria | 7719 |
| 145 | Ga0105245_10044404 | 3300009098 | Bacteria | 3967 |
| 146 | Ga0105247_10000587 | 3300009101 | Bacteria | 29534 |
| 147 | Ga0105247_10034450 | 3300009101 | Bacteria | 3083 |
| 148 | Ga0114129_10008813 | 3300009147 | Bacteria | 14392 |
| 149 | Ga0114129_10161528 | 3300009147 | Bacteria | 3060 |
| 150 | Ga0105243_10000176 | 3300009148 | Bacteria | 73715 |
| 151 | Ga0105243_10017022 | 3300009148 | Bacteria | 5496 |
| 152 | Ga0105243_10053042 | 3300009148 | Bacteria | 3215 |
| 153 | Ga0105243_10070243 | 3300009148 | Bacteria | 2827 |
| 154 | Ga0105241_10094905 | 3300009174 | Bacteria | 2360 |
| 155 | Ga0105241_10130677 | 3300009174 | Bacteria | 2033 |
| 156 | Ga0105242_10000541 | 3300009176 | Bacteria | 29941 |
| 157 | Ga0105242_10025964 | 3300009176 | Bacteria | 4639 |
| 158 | Ga0105242_10040131 | 3300009176 | Bacteria | 3771 |
| 159 | Ga0105237_10050276 | 3300009545 | Bacteria | 4188 |
| 160 | Ga0105237_10118830 | 3300009545 | Bacteria | 2637 |
| 161 | Ga0105237_10160494 | 3300009545 | Bacteria | 2246 |
| 162 | Ga0105238_10004587 | 3300009551 | Bacteria | 13661 |
| 163 | Ga0105238_10057780 | 3300009551 | Bacteria | 3889 |
| 164 | Ga0105249_10001455 | 3300009553 | Bacteria | 20752 |
| 165 | Ga0105249_10009099 | 3300009553 | Bacteria | 8686 |
| 166 | Ga0105249_10010376 | 3300009553 | Bacteria | 8187 |
| 167 | Ga0105249_10206108 | 3300009553 | Bacteria | 1927 |
| 168 | Ga0105032_101028 | 3300009979 | Bacteria | 2604 |
| 169 | Ga0105239_10010931 | 3300010375 | Bacteria | 10140 |
| 170 | Ga0105246_10057272 | 3300011119 | Bacteria | 2696 |
| 171 | Ga0157369_10001482 | 3300013105 | Bacteria | 28790 |
| 172 | Ga0157369_10022930 | 3300013105 | Bacteria | 6961 |
| 173 | Ga0157369_10068398 | 3300013105 | Bacteria | 3816 |
| 174 | Ga0157369_10306372 | 3300013105 | Bacteria | 1652 |
| 175 | Ga0157374_10067285 | 3300013296 | Bacteria | 3368 |
| 176 | Ga0157378_10025526 | 3300013297 | Bacteria | 5202 |
| 177 | Ga0157378_10116250 | 3300013297 | Bacteria | 2459 |
| 178 | Ga0163162_10006240 | 3300013306 | Bacteria | 11556 |
| 179 | Ga0157372_10000678 | 3300013307 | Bacteria | 37470 |
| 180 | Ga0157375_10011156 | 3300013308 | Bacteria | 7925 |
| 181 | Ga0157375_10302950 | 3300013308 | Bacteria | 1762 |
| 182 | Ga0163163_10134731 | 3300014325 | Bacteria | 2511 |
| 183 | Ga0157380_10062044 | 3300014326 | Bacteria | 2993 |
| 184 | Ga0157377_10002864 | 3300014745 | Bacteria | 7703 |
| 185 | Ga0157379_10106086 | 3300014968 | Bacteria | 2522 |
| 186 | Ga0157379_10124618 | 3300014968 | Bacteria | 2318 |
| 187 | Ga0163161_10006350 | 3300017792 | Bacteria | 8178 |
| 188 | Ga0163161_10008455 | 3300017792 | Bacteria | 7127 |
| 189 | Ga0163161_10070900 | 3300017792 | Bacteria | 2549 |
| 190 | Ga0163161_10191079 | 3300017792 | Bacteria | 1574 |
| 191 | Ga0206353_10379419 | 3300020082 | Bacteria | 2038 |
| 192 | Ga0206353_11821398 | 3300020082 | Bacteria | 3749 |
| 193 | Ga0213875_10001286 | 3300021388 | Bacteria | 16762 |
| 194 | Ga0213875_10015991 | 3300021388 | Bacteria | 3645 |
| 195 | Ga0224712_10009980 | 3300022467 | Bacteria | 2884 |
| 196 | Ga0207656_10015051 | 3300025321 | Bacteria | 2990 |
| 197 | Ga0207692_10000925 | 3300025898 | Bacteria | 10621 |
| 198 | Ga0207710_10008663 | 3300025900 | Bacteria | 4289 |
| 199 | Ga0207710_10018370 | 3300025900 | Bacteria | 2974 |
| 200 | Ga0207688_10002201 | 3300025901 | Bacteria | 10509 |
| 201 | Ga0207688_10014213 | 3300025901 | Bacteria | 4332 |
| 202 | Ga0207688_10040260 | 3300025901 | Bacteria | 2596 |
| 203 | Ga0207688_10063870 | 3300025901 | Bacteria | 2077 |
| 204 | Ga0207647_10065140 | 3300025904 | Bacteria | 2212 |
| 205 | Ga0207685_10002600 | 3300025905 | Bacteria | 4181 |
| 206 | Ga0207699_10041228 | 3300025906 | Bacteria | 2665 |
| 207 | Ga0207699_10154642 | 3300025906 | Bacteria | 1521 |
| 208 | Ga0207645_10082455 | 3300025907 | Bacteria | 2061 |
| 209 | Ga0207705_10023506 | 3300025909 | Bacteria | 4397 |
| 210 | Ga0207705_10041874 | 3300025909 | Bacteria | 3286 |
| 211 | Ga0207684_10020476 | 3300025910 | Bacteria | 5652 |
| 212 | Ga0207654_10052418 | 3300025911 | Bacteria | 2351 |
| 213 | Ga0207707_10000089 | 3300025912 | Bacteria | 90919 |
| 214 | Ga0207707_10013813 | 3300025912 | Bacteria | 7042 |
| 215 | Ga0207671_10117837 | 3300025914 | Bacteria | 2027 |
| 216 | Ga0207693_10001988 | 3300025915 | Bacteria | 17934 |
| 217 | Ga0207693_10004400 | 3300025915 | Bacteria | 11916 |
| 218 | Ga0207693_10031758 | 3300025915 | Bacteria | 4173 |
| 219 | Ga0207663_10002104 | 3300025916 | Bacteria | 9483 |
| 220 | Ga0207660_10006327 | 3300025917 | Bacteria | 7676 |
| 221 | Ga0207649_10033586 | 3300025920 | Bacteria | 3067 |
| 222 | Ga0207652_10000015 | 3300025921 | Bacteria | 193042 |
| 223 | Ga0207652_10111298 | 3300025921 | Bacteria | 2428 |
| 224 | Ga0207652_10138007 | 3300025921 | Bacteria | 2178 |
| 225 | Ga0207646_10000105 | 3300025922 | Bacteria | 114126 |
| 226 | Ga0207646_10005244 | 3300025922 | Bacteria | 13676 |
| 227 | Ga0207646_10007603 | 3300025922 | Bacteria | 10978 |
| 228 | Ga0207646_10255243 | 3300025922 | Bacteria | 1585 |
| 229 | Ga0207681_10010077 | 3300025923 | Bacteria | 5786 |
| 230 | Ga0207681_10156698 | 3300025923 | Bacteria | 1712 |
| 231 | Ga0207694_10069041 | 3300025924 | Bacteria | 2761 |
| 232 | Ga0207650_10072040 | 3300025925 | Bacteria | 2601 |
| 233 | Ga0207687_10003407 | 3300025927 | Bacteria | 10725 |
| 234 | Ga0207687_10023953 | 3300025927 | Bacteria | 4073 |
| 235 | Ga0207687_10050024 | 3300025927 | Bacteria | 2908 |
| 236 | Ga0207700_10142070 | 3300025928 | Bacteria | 1974 |
| 237 | Ga0207664_10054432 | 3300025929 | Bacteria | 3170 |
| 238 | Ga0207644_10001889 | 3300025931 | Bacteria | 13623 |
| 239 | Ga0207644_10167071 | 3300025931 | Bacteria | 1715 |
| 240 | Ga0207690_10027252 | 3300025932 | Bacteria | 3610 |
| 241 | Ga0207706_10005837 | 3300025933 | Bacteria | 11451 |
| 242 | Ga0207706_10014937 | 3300025933 | Bacteria | 7032 |
| 243 | Ga0207706_10022323 | 3300025933 | Bacteria | 5679 |
| 244 | Ga0207706_10033507 | 3300025933 | Bacteria | 4572 |
| 245 | Ga0207686_10038559 | 3300025934 | Bacteria | 2892 |
| 246 | Ga0207709_10000739 | 3300025935 | Bacteria | 25922 |
| 247 | Ga0207709_10064063 | 3300025935 | Bacteria | 2306 |
| 248 | Ga0207669_10003202 | 3300025937 | Bacteria | 7070 |
| 249 | Ga0207669_10042854 | 3300025937 | Bacteria | 2646 |
| 250 | Ga0207669_10055780 | 3300025937 | Bacteria | 2395 |
| 251 | Ga0207669_10062475 | 3300025937 | Bacteria | 2294 |
| 252 | Ga0207704_10002568 | 3300025938 | Bacteria | 8192 |
| 253 | Ga0207665_10000912 | 3300025939 | Bacteria | 19948 |
| 254 | Ga0207691_10206751 | 3300025940 | Bacteria | 1707 |
| 255 | Ga0207689_10006351 | 3300025942 | Bacteria | 10467 |
| 256 | Ga0207689_10011876 | 3300025942 | Bacteria | 7465 |
| 257 | Ga0207689_10023158 | 3300025942 | Bacteria | 5215 |
| 258 | Ga0207689_10024668 | 3300025942 | Bacteria | 5041 |
| 259 | Ga0207689_10032836 | 3300025942 | Bacteria | 4314 |
| 260 | Ga0207679_10002163 | 3300025945 | Bacteria | 12156 |
| 261 | Ga0207667_10023404 | 3300025949 | Bacteria | 6802 |
| 262 | Ga0207667_10194828 | 3300025949 | Bacteria | 2079 |
| 263 | Ga0207667_10213704 | 3300025949 | Bacteria | 1977 |
| 264 | Ga0207712_10002242 | 3300025961 | Bacteria | 12573 |
| 265 | Ga0207712_10010257 | 3300025961 | Bacteria | 5944 |
| 266 | Ga0207712_10113207 | 3300025961 | Bacteria | 2039 |
| 267 | Ga0207668_10004560 | 3300025972 | Bacteria | 8148 |
| 268 | Ga0207668_10048577 | 3300025972 | Bacteria | 2913 |
| 269 | Ga0207668_10078949 | 3300025972 | Bacteria | 2379 |
| 270 | Ga0207640_10008628 | 3300025981 | Bacteria | 5665 |
| 271 | Ga0207640_10075498 | 3300025981 | Bacteria | 2285 |
| 272 | Ga0207658_10013062 | 3300025986 | Bacteria | 5671 |
| 273 | Ga0207658_10018143 | 3300025986 | Bacteria | 4854 |
| 274 | Ga0207677_10004360 | 3300026023 | Bacteria | 7581 |
| 275 | Ga0207677_10052034 | 3300026023 | Bacteria | 2780 |
| 276 | Ga0207677_10063117 | 3300026023 | Bacteria | 2573 |
| 277 | Ga0207703_10016320 | 3300026035 | Bacteria | 5789 |
| 278 | Ga0207639_10009529 | 3300026041 | Bacteria | 6701 |
| 279 | Ga0207678_10001240 | 3300026067 | Bacteria | 23521 |
| 280 | Ga0207678_10004102 | 3300026067 | Bacteria | 13100 |
| 281 | Ga0207678_10013386 | 3300026067 | Bacteria | 7200 |
| 282 | Ga0207678_10016705 | 3300026067 | Bacteria | 6446 |
| 283 | Ga0207678_10022386 | 3300026067 | Bacteria | 5535 |
| 284 | Ga0207708_10000076 | 3300026075 | Bacteria | 78340 |
| 285 | Ga0207708_10004349 | 3300026075 | Bacteria | 10436 |
| 286 | Ga0207708_10018507 | 3300026075 | Bacteria | 5247 |
| 287 | Ga0207708_10025739 | 3300026075 | Bacteria | 4453 |
| 288 | Ga0207708_10055787 | 3300026075 | Bacteria | 3013 |
| 289 | Ga0207641_10009537 | 3300026088 | Bacteria | 7997 |
| 290 | Ga0207641_10036495 | 3300026088 | Bacteria | 4103 |
| 291 | Ga0207641_10168454 | 3300026088 | Bacteria | 1997 |
| 292 | Ga0207648_10005879 | 3300026089 | Bacteria | 12276 |
| 293 | Ga0207648_10008936 | 3300026089 | Bacteria | 9640 |
| 294 | Ga0207648_10050640 | 3300026089 | Bacteria | 3631 |
| 295 | Ga0207674_10017440 | 3300026116 | Bacteria | 7836 |
| 296 | Ga0207674_10054790 | 3300026116 | Bacteria | 4059 |
| 297 | Ga0207674_10071173 | 3300026116 | Bacteria | 3495 |
| 298 | Ga0207675_100001816 | 3300026118 | Bacteria | 21390 |
| 299 | Ga0207675_100002509 | 3300026118 | Bacteria | 18162 |
| 300 | Ga0207675_100010155 | 3300026118 | Bacteria | 8824 |
| 301 | Ga0207675_100028433 | 3300026118 | Bacteria | 5205 |
| 302 | Ga0207675_100150513 | 3300026118 | Bacteria | 2215 |
| 303 | Ga0207683_10001438 | 3300026121 | Bacteria | 21523 |
| 304 | Ga0207683_10004394 | 3300026121 | Bacteria | 12183 |
| 305 | Ga0207683_10090615 | 3300026121 | Bacteria | 2723 |
| 306 | Ga0207683_10107455 | 3300026121 | Bacteria | 2496 |
| 307 | Ga0207683_10133921 | 3300026121 | Bacteria | 2230 |
| 308 | Ga0207698_10022456 | 3300026142 | Bacteria | 4385 |
| 309 | Ga0207698_10039771 | 3300026142 | Bacteria | 3487 |
| 310 | Ga0207698_10067249 | 3300026142 | Bacteria | 2825 |
| 311 | Ga0207428_10001475 | 3300027907 | Bacteria | 24624 |
| 312 | Ga0268266_10001585 | 3300028379 | Bacteria | 26567 |
| 313 | Ga0268266_10014769 | 3300028379 | Bacteria | 6708 |
| 314 | Ga0268266_10245668 | 3300028379 | Bacteria | 1653 |
| 315 | Ga0268265_10060409 | 3300028380 | Bacteria | 2904 |
| 316 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 317 | Ga0268264_10008608 | 3300028381 | Bacteria | 8478 |
| 318 | Ga0268264_10019740 | 3300028381 | Bacteria | 5505 |
| 319 | Ga0314311_1001867 | 3300030733 | Bacteria | 11811 |
| 320 | Ga0265320_10025164 | 3300031240 | Bacteria | 3134 |
| 321 | Ga0265325_10024399 | 3300031241 | Bacteria | 3291 |
| 322 | Ga0265340_10006275 | 3300031247 | Bacteria | 6551 |
| 323 | Ga0307408_100161744 | 3300031548 | Bacteria | 1779 |
| 324 | Ga0307508_10003996 | 3300031616 | Bacteria | 14613 |
| 325 | Ga0265314_10007762 | 3300031711 | Bacteria | 9277 |
| 326 | Ga0307405_10002200 | 3300031731 | Bacteria | 8520 |
| 327 | Ga0307405_10064876 | 3300031731 | Bacteria | 2322 |
| 328 | Ga0307413_10011436 | 3300031824 | Bacteria | 4365 |
| 329 | Ga0307413_10040751 | 3300031824 | Bacteria | 2713 |
| 330 | Ga0307413_10122783 | 3300031824 | Bacteria | 1762 |
| 331 | Ga0307518_10000304 | 3300031838 | Bacteria | 37119 |
| 332 | Ga0307518_10005413 | 3300031838 | Bacteria | 9127 |
| 333 | Ga0307410_10003205 | 3300031852 | Bacteria | 8155 |
| 334 | Ga0307410_10004504 | 3300031852 | Bacteria | 7215 |
| 335 | Ga0307410_10051997 | 3300031852 | Bacteria | 2764 |
| 336 | Ga0307410_10057563 | 3300031852 | Bacteria | 2647 |
| 337 | Ga0307406_10007359 | 3300031901 | Bacteria | 6101 |
| 338 | Ga0307407_10006451 | 3300031903 | Bacteria | 5214 |
| 339 | Ga0307412_10116208 | 3300031911 | Bacteria | 1919 |
| 340 | Ga0307409_100000197 | 3300031995 | Bacteria | 23795 |
| 341 | Ga0307409_100000337 | 3300031995 | Bacteria | 19410 |
| 342 | Ga0307409_100115222 | 3300031995 | Bacteria | 2262 |
| 343 | Ga0307416_100003728 | 3300032002 | Bacteria | 9040 |
| 344 | Ga0307416_100209866 | 3300032002 | Bacteria | 1856 |
| 345 | Ga0307414_10020370 | 3300032004 | Bacteria | 4133 |
| 346 | Ga0307411_10006006 | 3300032005 | Bacteria | 6034 |
| 347 | Ga0307411_10012993 | 3300032005 | Bacteria | 4573 |
| 348 | Ga0307415_100003572 | 3300032126 | Bacteria | 7939 |
| 349 | Ga0307415_100003928 | 3300032126 | Bacteria | 7641 |
| 350 | Ga0307415_100005308 | 3300032126 | Bacteria | 6823 |
| 351 | Ga0307415_100081508 | 3300032126 | Bacteria | 2311 |
| 352 | Ga0307507_10038408 | 3300033179 | Bacteria | 4853 |
| 353 | Ga0307510_10112253 | 3300033180 | Bacteria | 2463 |
| 354 | Ga0373923_0029939 | 3300035111 | Bacteria | 2186 |
| 355 | Ga0373932_0015187 | 3300035112 | Bacteria | 1948 |
| 356 | Ga0373936_0049371 | 3300035113 | Bacteria | 1699 |
| 357 | Ga0373953_0038220 | 3300035117 | Bacteria | 1898 |
| 358 | Ga0373954_0027618 | 3300035118 | Bacteria | 2606 |
| 359 | Ga0373956_0004349 | 3300035119 | Bacteria | 5679 |
| 360 | Ga0373955_0035391 | 3300035172 | Bacteria | 2644 |
| 361 | Ga0395899_0083821 | 3300037312 | Bacteria | 2318 |
| 362 | Ga0395900_0019899 | 3300037418 | Bacteria | 6842 |
| 363 | Ga0395900_0046784 | 3300037418 | Bacteria | 4455 |
| 364 | Ga0395900_0265159 | 3300037418 | Bacteria | 1714 |
| 365 | Ga0395898_0044449 | 3300037466 | Bacteria | 4372 |
| 366 | Ga0395898_0189323 | 3300037466 | Bacteria | 1966 |
| 367 | Ga0395905_0198768 | 3300037471 | Bacteria | 1880 |
| 368 | Ga0436364_0090786 | 3300037853 | Bacteria | 2368 |
| 369 | Ga0436364_0251182 | 3300037853 | Bacteria | 7342 |
| 370 | Ga0436364_0512751 | 3300037853 | Bacteria | 53348 |
| 371 | Ga0436364_0955899 | 3300037853 | Bacteria | 14646 |
| 372 | Ga0395901_0005633 | 3300038443 | Bacteria | 12674 |
| 373 | Ga0395901_0020193 | 3300038443 | Bacteria | 6819 |
| 374 | Ga0395901_0021278 | 3300038443 | Bacteria | 6643 |
| 375 | Ga0436365_1226639 | 3300039437 | Bacteria | 1640 |
| 376 | Ga0439448_0000133 | 3300042005 | Bacteria | 14009 |
| 377 | Ga0439450_000171 | 3300042008 | Bacteria | 7424 |
| 378 | Ga0439463_000090 | 3300042016 | Bacteria | 21211 |
| 379 | Ga0450900_001900 | 3300042136 | Bacteria | 2133 |
| 380 | Ga0439444_0001658 | 3300042437 | Bacteria | 2931 |
| 381 | Ga0439464_0000125 | 3300042439 | Bacteria | 12183 |
| 382 | Ga0450916_001317 | 3300042530 | Bacteria | 2451 |
| 383 | Ga0439440_0000024 | 3300042993 | Bacteria | 18444 |
| 384 | Ga0466969_0004839 | 3300044656 | Bacteria | 7167 |
| 385 | Ga0466969_0006017 | 3300044656 | Bacteria | 6458 |
| 386 | Ga0466972_0003690 | 3300044658 | Bacteria | 7619 |
| 387 | Ga0466972_0004496 | 3300044658 | Bacteria | 6978 |
| 388 | Ga0466972_0008802 | 3300044658 | Bacteria | 5063 |
| 389 | Ga0466972_0009094 | 3300044658 | Bacteria | 4990 |
| 390 | Ga0466972_0036883 | 3300044658 | Bacteria | 2390 |
| 391 | Ga0466965_0000962 | 3300044683 | Bacteria | 11123 |
| 392 | Ga0466965_0001996 | 3300044683 | Bacteria | 8535 |
| 393 | Ga0466965_0003981 | 3300044683 | Bacteria | 6546 |
| 394 | Ga0466965_0004181 | 3300044683 | Bacteria | 6416 |
| 395 | Ga0466966_0001859 | 3300044684 | Bacteria | 13697 |
| 396 | Ga0466966_0004214 | 3300044684 | Bacteria | 9490 |
| 397 | Ga0466966_0013306 | 3300044684 | Bacteria | 5447 |
| 398 | Ga0466966_0022867 | 3300044684 | Bacteria | 4096 |
| 399 | Ga0466966_0089499 | 3300044684 | Bacteria | 1912 |
| 400 | Ga0466961_0001396 | 3300044693 | Bacteria | 14959 |
| 401 | Ga0466961_0002770 | 3300044693 | Bacteria | 10909 |
| 402 | Ga0466961_0016856 | 3300044693 | Bacteria | 4695 |
| 403 | Ga0466961_0068835 | 3300044693 | Bacteria | 2247 |
| 404 | Ga0466961_0095725 | 3300044693 | Bacteria | 1872 |
| 405 | Ga0466963_0001299 | 3300044694 | Bacteria | 13271 |
| 406 | Ga0466963_0001487 | 3300044694 | Bacteria | 12654 |
| 407 | Ga0466963_0008033 | 3300044694 | Bacteria | 6317 |
| 408 | Ga0466963_0040543 | 3300044694 | Bacteria | 3052 |
| 409 | Ga0466963_0132852 | 3300044694 | Bacteria | 1720 |
| 410 | Ga0466963_0133200 | 3300044694 | Bacteria | 1718 |
| 411 | Ga0466964_0012279 | 3300044706 | Bacteria | 3242 |
| 412 | Ga0466964_0096034 | 3300044706 | Bacteria | 1298 |
| 413 | Ga0466971_0001862 | 3300044719 | Bacteria | 8980 |
| 414 | Ga0466971_0027693 | 3300044719 | Bacteria | 2539 |
| 415 | Ga0466971_0056094 | 3300044719 | Bacteria | 1777 |
| 416 | Ga0466971_0060540 | 3300044719 | Bacteria | 1711 |
| 417 | Ga0466968_0000508 | 3300044735 | Bacteria | 13208 |
| 418 | Ga0466968_0041430 | 3300044735 | Bacteria | 1944 |
| 419 | Ga0466970_0006801 | 3300044765 | Bacteria | 5725 |
| 420 | Ga0466970_0014201 | 3300044765 | Bacteria | 4085 |
| 421 | Ga0466970_0019429 | 3300044765 | Bacteria | 3523 |
| 422 | Ga0466957_0007701 | 3300044842 | Bacteria | 6090 |
| 423 | Ga0466957_0029764 | 3300044842 | Bacteria | 3258 |
| 424 | Ga0466960_0000412 | 3300044901 | Bacteria | 14752 |
| 425 | Ga0466959_0001272 | 3300045049 | Bacteria | 15252 |
| 426 | Ga0466959_0006432 | 3300045049 | Bacteria | 8134 |
| 427 | Ga0466959_0007060 | 3300045049 | Bacteria | 7850 |
| 428 | Ga0466959_0163076 | 3300045049 | Bacteria | 1566 |
| 429 | Ga0466958_0000116 | 3300045836 | Bacteria | 25851 |
| 430 | Ga0466958_0046431 | 3300045836 | Bacteria | 2621 |
| 431 | Ga0466958_0060052 | 3300045836 | Bacteria | 2314 |
| 432 | Ga0466967_0000924 | 3300045976 | Bacteria | 15792 |
| 433 | Ga0466967_0002676 | 3300045976 | Bacteria | 11247 |
| 434 | Ga0466967_0002704 | 3300045976 | Bacteria | 11204 |
| 435 | Ga0466967_0007673 | 3300045976 | Bacteria | 7812 |
| 436 | Ga0466967_0121203 | 3300045976 | Bacteria | 2416 |
| 437 | Ga0495592_0055242 | 3300046454 | Bacteria | 2938 |
| 438 | Ga0495629_0003195 | 3300046459 | Bacteria | 12402 |
| 439 | Ga0495641_0011885 | 3300046461 | Bacteria | 4916 |
| 440 | Ga0495651_0009515 | 3300046462 | Bacteria | 7463 |
| 441 | Ga0495582_0002562 | 3300046473 | Bacteria | 10116 |
| 442 | Ga0495639_0017334 | 3300046475 | Bacteria | 3128 |
| 443 | Ga0495662_0020498 | 3300046476 | Bacteria | 3198 |
| 444 | Ga0495608_0009657 | 3300046511 | Bacteria | 6732 |
| 445 | Ga0495630_0090057 | 3300046517 | Bacteria | 2317 |
| 446 | Ga0495630_0175985 | 3300046517 | Bacteria | 1631 |
| 447 | Ga0495665_0012173 | 3300046531 | Bacteria | 4655 |
| 448 | Ga0495640_0048191 | 3300046533 | Bacteria | 2945 |
| 449 | Ga0495598_0006230 | 3300046537 | Bacteria | 2686 |
| 450 | Ga0495621_0021044 | 3300046539 | Bacteria | 2147 |
| 451 | Ga0495645_0009696 | 3300046543 | Bacteria | 6734 |
| 452 | Ga0495667_0057518 | 3300046559 | Bacteria | 2555 |
| 453 | Ga0495635_0014323 | 3300046663 | Bacteria | 5547 |
| 454 | Ga0495657_0020345 | 3300046675 | Bacteria | 4771 |
| 455 | Ga0495599_0061354 | 3300046678 | Bacteria | 2350 |
| 456 | Ga0495658_0009331 | 3300046683 | Bacteria | 4887 |
| 457 | Ga0495613_0109622 | 3300046689 | Bacteria | 1990 |
| 458 | Ga0495624_0036086 | 3300046690 | Bacteria | 3189 |
| 459 | Ga0495624_0141757 | 3300046690 | Bacteria | 1472 |
| 460 | Ga0495581_0007738 | 3300047315 | Bacteria | 6218 |
| 461 | Ga0495604_0055898 | 3300047317 | Bacteria | 3040 |
| 462 | Ga0495680_0071345 | 3300047322 | Bacteria | 2644 |
| 463 | Ga0495684_0030287 | 3300047471 | Bacteria | 4155 |
| 464 | Ga0495686_0002331 | 3300047472 | Bacteria | 18152 |
| 465 | Ga0495602_0045280 | 3300048088 | Bacteria | 3982 |
| 466 | Ga0495614_0023959 | 3300048089 | Bacteria | 2634 |
| 467 | Ga0496100_0010318 | 3300048903 | Bacteria | 5285 |
| 468 | Ga0496100_0028650 | 3300048903 | Bacteria | 3436 |
| 469 | Ga0496100_0029701 | 3300048903 | Bacteria | 3384 |
| 470 | Ga0496101_0005719 | 3300048904 | Bacteria | 7941 |
| 471 | Ga0496102_0000292 | 3300048905 | Bacteria | 64203 |
| 472 | Ga0496102_0000409 | 3300048905 | Bacteria | 49825 |
| 473 | Ga0496102_0114293 | 3300048905 | Bacteria | 2518 |
| 474 | Ga0496103_0008519 | 3300048906 | Bacteria | 6092 |
| 475 | Ga0496103_0015040 | 3300048906 | Bacteria | 4600 |
| 476 | Ga0496103_0016423 | 3300048906 | Bacteria | 4417 |
| 477 | Ga0496104_0003042 | 3300048907 | Bacteria | 14443 |
| 478 | Ga0496104_0118439 | 3300048907 | Bacteria | 2542 |
| 479 | Ga0496104_0174030 | 3300048907 | Bacteria | 2063 |
| 480 | Ga0496105_0006019 | 3300048908 | Bacteria | 9270 |
| 481 | Ga0496106_0113115 | 3300048909 | Bacteria | 2115 |
| 482 | Ga0496107_0004037 | 3300048910 | Bacteria | 9885 |
| 483 | Ga0496108_0001993 | 3300048911 | Bacteria | 16350 |
| 484 | Ga0496108_0141950 | 3300048911 | Bacteria | 2069 |
| 485 | Ga0496108_0248515 | 3300048911 | Bacteria | 1547 |
| 486 | Ga0496109_0001047 | 3300048912 | Bacteria | 22883 |
| 487 | Ga0496110_0274425 | 3300048913 | Bacteria | 1535 |
| 488 | Ga0496112_0010431 | 3300048915 | Bacteria | 8426 |
| 489 | Ga0496112_0114299 | 3300048915 | Bacteria | 2670 |
| 490 | Ga0496112_0144919 | 3300048915 | Bacteria | 2343 |
| 491 | Ga0496113_0126539 | 3300048916 | Bacteria | 2002 |
| 492 | Ga0496114_0002107 | 3300048917 | Bacteria | 15111 |
| 493 | Ga0496114_0080999 | 3300048917 | Bacteria | 2742 |
| 494 | Ga0496115_0015008 | 3300048918 | Bacteria | 5871 |
| 495 | Ga0496116_0003840 | 3300048919 | Bacteria | 14667 |
| 496 | Ga0496117_0000572 | 3300048920 | Bacteria | 60381 |
| 497 | Ga0496118_0004828 | 3300048921 | Bacteria | 15719 |
| 498 | Ga0496118_0117707 | 3300048921 | Bacteria | 1742 |
| 499 | Ga0496119_0000200 | 3300048922 | Bacteria | 84506 |
| 500 | Ga0496119_0023406 | 3300048922 | Bacteria | 4380 |
| 501 | Ga0496120_0005099 | 3300048923 | Bacteria | 10624 |
| 502 | Ga0496120_0008461 | 3300048923 | Bacteria | 7468 |
| 503 | Ga0496124_0036597 | 3300048927 | Bacteria | 4279 |
| 504 | Ga0496125_0043573 | 3300048928 | Bacteria | 3805 |
| 505 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 506 | Ga0496126_0000344 | 3300048929 | Bacteria | 97456 |
| 507 | Ga0496126_0005807 | 3300048929 | Bacteria | 13950 |
| 508 | Ga0496126_0142815 | 3300048929 | Bacteria | 2059 |
| 509 | Ga0501031_0000786 | 3300049568 | Bacteria | 19065 |
| 510 | Ga0501031_0001466 | 3300049568 | Bacteria | 14643 |
| 511 | Ga0501031_0001689 | 3300049568 | Bacteria | 13873 |
| 512 | Ga0501031_0107159 | 3300049568 | Bacteria | 1824 |
| 513 | Ga0501032_0000529 | 3300049569 | Bacteria | 31035 |
| 514 | Ga0501032_0079701 | 3300049569 | Bacteria | 2180 |
| 515 | Ga0501033_0007352 | 3300049570 | Bacteria | 8577 |
| 516 | Ga0501033_0017409 | 3300049570 | Bacteria | 5429 |
| 517 | Ga0501033_0150472 | 3300049570 | Bacteria | 1679 |
| 518 | Ga0501034_0005705 | 3300049571 | Bacteria | 13530 |
| 519 | Ga0501034_0022894 | 3300049571 | Bacteria | 6365 |
| 520 | Ga0501034_0029795 | 3300049571 | Bacteria | 5548 |
| 521 | Ga0501036_0000208 | 3300049572 | Bacteria | 39217 |
| 522 | Ga0501036_0002407 | 3300049572 | Bacteria | 14642 |
| 523 | Ga0501036_0024907 | 3300049572 | Bacteria | 5047 |
| 524 | Ga0501037_0001621 | 3300049573 | Bacteria | 16347 |
| 525 | Ga0501037_0014597 | 3300049573 | Bacteria | 5779 |
| 526 | Ga0501037_0114019 | 3300049573 | Bacteria | 1946 |
| 527 | Ga0501038_0003875 | 3300049574 | Bacteria | 13905 |
| 528 | Ga0501038_0008098 | 3300049574 | Bacteria | 9672 |
| 529 | Ga0501039_0000629 | 3300049575 | Bacteria | 25532 |
| 530 | Ga0501039_0008229 | 3300049575 | Bacteria | 7949 |
| 531 | Ga0501039_0012507 | 3300049575 | Bacteria | 6482 |
| 532 | Ga0501040_0000013 | 3300049576 | Bacteria | 76297 |
| 533 | Ga0501040_0003285 | 3300049576 | Bacteria | 10452 |
| 534 | Ga0501040_0044155 | 3300049576 | Bacteria | 3038 |
| 535 | Ga0501041_0000134 | 3300049577 | Bacteria | 31802 |
| 536 | Ga0501041_0001378 | 3300049577 | Bacteria | 13433 |
| 537 | Ga0501042_0000426 | 3300049578 | Bacteria | 21400 |
| 538 | Ga0501042_0001684 | 3300049578 | Bacteria | 13181 |
| 539 | Ga0501043_0014156 | 3300049579 | Bacteria | 6241 |
| 540 | Ga0501043_0020981 | 3300049579 | Bacteria | 5122 |
| 541 | Ga0501046_0001172 | 3300049580 | Bacteria | 25515 |
| 542 | Ga0501046_0001681 | 3300049580 | Bacteria | 21164 |
| 543 | Ga0501046_0004074 | 3300049580 | Bacteria | 13323 |
| 544 | Ga0501047_0002802 | 3300049581 | Bacteria | 16555 |
| 545 | Ga0501047_0046413 | 3300049581 | Bacteria | 4198 |
| 546 | Ga0501048_0000215 | 3300049582 | Bacteria | 37866 |
| 547 | Ga0501048_0002334 | 3300049582 | Bacteria | 14481 |
| 548 | Ga0501048_0008359 | 3300049582 | Bacteria | 7824 |
| 549 | Ga0501067_0040637 | 3300049583 | Bacteria | 2582 |
| 550 | Ga0501068_0017459 | 3300049584 | Bacteria | 4151 |
| 551 | Ga0501069_0010476 | 3300049585 | Bacteria | 4908 |
| 552 | Ga0501069_0040757 | 3300049585 | Bacteria | 2566 |
| 553 | Ga0501070_0006467 | 3300049586 | Bacteria | 9973 |
| 554 | Ga0501070_0025483 | 3300049586 | Bacteria | 4960 |
| 555 | Ga0501071_0014902 | 3300049587 | Bacteria | 5326 |
| 556 | Ga0501072_0000218 | 3300049588 | Bacteria | 41909 |
| 557 | Ga0501072_0041820 | 3300049588 | Bacteria | 3599 |
| 558 | Ga0501073_0026995 | 3300049589 | Bacteria | 4109 |
| 559 | Ga0501074_0023632 | 3300049590 | Bacteria | 4467 |
| 560 | Ga0501074_0067877 | 3300049590 | Bacteria | 2563 |
| 561 | Ga0501075_0000029 | 3300049591 | Bacteria | 58190 |
| 562 | Ga0501075_0008416 | 3300049591 | Bacteria | 7196 |
| 563 | Ga0501076_0000173 | 3300049592 | Bacteria | 37869 |
| 564 | Ga0501076_0001857 | 3300049592 | Bacteria | 14373 |
| 565 | Ga0501076_0049135 | 3300049592 | Bacteria | 3335 |
| 566 | Ga0501077_0000077 | 3300049593 | Bacteria | 49358 |
| 567 | Ga0501077_0058031 | 3300049593 | Bacteria | 2457 |
| 568 | Ga0501079_0000721 | 3300049741 | Bacteria | 22321 |
| 569 | Ga0501079_0001150 | 3300049741 | Bacteria | 18499 |
| 570 | Ga0501079_0061214 | 3300049741 | Bacteria | 2903 |
| 571 | Ga0501080_0000266 | 3300049742 | Bacteria | 39496 |
| 572 | Ga0501080_0011290 | 3300049742 | Bacteria | 8175 |
| 573 | Ga0501080_0011433 | 3300049742 | Bacteria | 8129 |
| 574 | Ga0501081_0002166 | 3300049743 | Bacteria | 12325 |
| 575 | Ga0501081_0007931 | 3300049743 | Bacteria | 6887 |
| 576 | Ga0501083_0024502 | 3300049744 | Bacteria | 4180 |
| 577 | Ga0501035_0000602 | 3300049822 | Bacteria | 39639 |
| 578 | Ga0501035_0003399 | 3300049822 | Bacteria | 15224 |
| 579 | Ga0501035_0010290 | 3300049822 | Bacteria | 8676 |
| 580 | Ga0501035_0027898 | 3300049822 | Bacteria | 5158 |
| 581 | Ga0501044_0002108 | 3300049823 | Bacteria | 22875 |
| 582 | Ga0501044_0007990 | 3300049823 | Bacteria | 11625 |
| 583 | Ga0501044_0012463 | 3300049823 | Bacteria | 9207 |
| 584 | Ga0501044_0171028 | 3300049823 | Bacteria | 2144 |
| 585 | Ga0501044_0302782 | 3300049823 | Bacteria | 1527 |
| 586 | Ga0501045_0002189 | 3300049824 | Bacteria | 13251 |
| 587 | Ga0501045_0025660 | 3300049824 | Bacteria | 4237 |
| 588 | Ga0501045_0047607 | 3300049824 | Bacteria | 3123 |
| 589 | nmdc:mga00v17_7817_c1 | 3300050491 | Bacteria | 5732 |
| 590 | nmdc:mga05p37_35803_c1 | 3300050507 | Bacteria | 6089 |
| 591 | nmdc:mga05p37_672_c1 | 3300050507 | Bacteria | 37785 |
| 592 | nmdc:mga09592_2964_c1 | 3300050508 | Bacteria | 13758 |
| 593 | nmdc:mga0qj67_294_c1 | 3300050509 | Bacteria | 34748 |
| 594 | nmdc:mga0qj67_59950_c1 | 3300050509 | Bacteria | 3019 |
| 595 | nmdc:mga06r32_285_c2 | 3300050510 | Bacteria | 37898 |
| 596 | nmdc:mga08y16_116013_c1 | 3300050511 | Bacteria | 2788 |
| 597 | nmdc:mga0n895_43331_c1 | 3300050512 | Bacteria | 4385 |
| 598 | nmdc:mga0a205_10272_c1 | 3300050515 | Bacteria | 8600 |
| 599 | nmdc:mga0a205_55902_c1 | 3300050515 | Bacteria | 3811 |
| 600 | nmdc:mga0sz30_3432_c1 | 3300050516 | Bacteria | 5710 |
| 601 | Ga0495612_0043296 | 3300053078 | Bacteria | 1839 |
| 602 | Ga0495595_0076644 | 3300053084 | Bacteria | 1587 |
| 603 | Ga0495619_0024500 | 3300053085 | Bacteria | 3871 |
| 604 | Ga0500652_000323 | 3300053131 | Bacteria | 17135 |
| 605 | Ga0501084_0001702 | 3300054114 | Bacteria | 17475 |
| 606 | Ga0501082_0000853 | 3300060353 | Bacteria | 26885 |
| 607 | Ga0501082_0294315 | 3300060353 | Bacteria | 1413 |
| 608 | Ga0466962_0000566 | 3300061719 | Bacteria | 16241 |
| 609 | Ga0466962_0011231 | 3300061719 | Bacteria | 4312 |
| 610 | Ga0530510_0000142 | 3300061734 | Bacteria | 42031 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053078 | Ga0495612_0043296 | Ga0495612_0043296_39_1145 | 365 |
| 2 | 3300044706 | Ga0466964_0096034 | Ga0466964_0096034_61_1281 | 384 |
| 3 | 3300005455 | Ga0070663_100081598 | Ga0070663_1000815983 | 386 |
| 4 | 3300037853 | Ga0436364_0090786 | Ga0436364_0090786_1083_2279 | 388 |
| 5 | 3300005347 | Ga0070668_100014822 | Ga0070668_1000148224 | 389 |
| 6 | 3300005367 | Ga0070667_100003861 | Ga0070667_10000386110 | 389 |
| 7 | 3300025986 | Ga0207658_10018143 | Ga0207658_100181433 | 389 |
| 8 | 3300005548 | Ga0070665_100000401 | Ga0070665_10000040144 | 391 |
| 9 | 3300005843 | Ga0068860_100000114 | Ga0068860_10000011444 | 391 |
| 10 | 3300028379 | Ga0268266_10001585 | Ga0268266_100015858 | 391 |
| 11 | 3300028381 | Ga0268264_10000147 | Ga0268264_1000014744 | 391 |
| 12 | iso_pu_bacteria | 2775506925 | 2776371604 | 392 |
| 13 | 3300035117 | Ga0373953_0038220 | Ga0373953_0038220_441_1631 | 393 |
| 14 | 3300044658 | Ga0466972_0036883 | Ga0466972_0036883_1143_2327 | 394 |
| 15 | 3300044693 | Ga0466961_0068835 | Ga0466961_0068835_507_1697 | 394 |
| 16 | 3300045049 | Ga0466959_0163076 | Ga0466959_0163076_344_1528 | 394 |
| 17 | 3300005334 | Ga0068869_100181182 | Ga0068869_1001811821 | 396 |
| 18 | 3300005338 | Ga0068868_100084430 | Ga0068868_1000844303 | 396 |
| 19 | 3300005347 | Ga0070668_100008184 | Ga0070668_1000081844 | 396 |
| 20 | 3300005353 | Ga0070669_100044389 | Ga0070669_1000443893 | 396 |
| 21 | 3300005355 | Ga0070671_100014146 | Ga0070671_1000141461 | 396 |
| 22 | 3300005364 | Ga0070673_100086039 | Ga0070673_1000860393 | 396 |
| 23 | 3300005434 | Ga0070709_10060166 | Ga0070709_100601662 | 396 |
| 24 | 3300005439 | Ga0070711_100150308 | Ga0070711_1001503082 | 396 |
| 25 | 3300005466 | Ga0070685_10063826 | Ga0070685_100638261 | 396 |
| 26 | 3300005546 | Ga0070696_100017874 | Ga0070696_1000178741 | 396 |
| 27 | 3300005549 | Ga0070704_100179609 | Ga0070704_1001796091 | 396 |
| 28 | 3300005614 | Ga0068856_100219116 | Ga0068856_1002191162 | 396 |
| 29 | 3300005616 | Ga0068852_100005953 | Ga0068852_1000059533 | 396 |
| 30 | 3300005842 | Ga0068858_100011913 | Ga0068858_1000119134 | 396 |
| 31 | 3300006237 | Ga0097621_100243256 | Ga0097621_1002432561 | 396 |
| 32 | 3300006914 | Ga0075436_100097534 | Ga0075436_1000975341 | 396 |
| 33 | 3300025923 | Ga0207681_10156698 | Ga0207681_101566982 | 396 |
| 34 | 3300026118 | Ga0207675_100010155 | Ga0207675_1000101556 | 396 |
| 35 | 3300031824 | Ga0307413_10011436 | Ga0307413_100114365 | 396 |
| 36 | 3300039437 | Ga0436365_1226639 | Ga0436365_1226639_421_1611 | 396 |
| 37 | 3300046690 | Ga0495624_0141757 | Ga0495624_0141757_137_1327 | 396 |
| 38 | 3300048929 | Ga0496126_0000003 | Ga0496126_0000003_505928_507121 | 396 |
| 39 | 3300045976 | Ga0466967_0007673 | Ga0466967_0007673_1492_2727 | 401 |
| 40 | iso_pu_bacteria | 2795385472 | 2795791772 | 405 |
| 41 | 3300037312 | Ga0395899_0083821 | Ga0395899_0083821_30_1286 | 407 |
| 42 | 3300005467 | Ga0070706_100010721 | Ga0070706_1000107214 | 408 |
| 43 | 3300005468 | Ga0070707_100000213 | Ga0070707_10000021344 | 408 |
| 44 | 3300005471 | Ga0070698_100000527 | Ga0070698_10000052733 | 408 |
| 45 | 3300025910 | Ga0207684_10020476 | Ga0207684_100204764 | 408 |
| 46 | 3300025922 | Ga0207646_10000105 | Ga0207646_1000010566 | 408 |
| 47 | 3300035111 | Ga0373923_0029939 | Ga0373923_0029939_416_1651 | 408 |
| 48 | 3300035113 | Ga0373936_0049371 | Ga0373936_0049371_198_1433 | 408 |
| 49 | 3300035118 | Ga0373954_0027618 | Ga0373954_0027618_374_1609 | 408 |
| 50 | 3300035172 | Ga0373955_0035391 | Ga0373955_0035391_199_1434 | 408 |
| 51 | 3300046454 | Ga0495592_0055242 | Ga0495592_0055242_786_2021 | 408 |
| 52 | 3300046459 | Ga0495629_0003195 | Ga0495629_0003195_71_1306 | 408 |
| 53 | 3300046461 | Ga0495641_0011885 | Ga0495641_0011885_997_2232 | 408 |
| 54 | 3300046462 | Ga0495651_0009515 | Ga0495651_0009515_3860_5095 | 408 |
| 55 | 3300046473 | Ga0495582_0002562 | Ga0495582_0002562_2152_3387 | 408 |
| 56 | 3300046475 | Ga0495639_0017334 | Ga0495639_0017334_626_1861 | 408 |
| 57 | 3300046476 | Ga0495662_0020498 | Ga0495662_0020498_917_2152 | 408 |
| 58 | 3300046511 | Ga0495608_0009657 | Ga0495608_0009657_3129_4364 | 408 |
| 59 | 3300046517 | Ga0495630_0090057 | Ga0495630_0090057_246_1481 | 408 |
| 60 | 3300046533 | Ga0495640_0048191 | Ga0495640_0048191_921_2156 | 408 |
| 61 | 3300046543 | Ga0495645_0009696 | Ga0495645_0009696_1371_2606 | 408 |
| 62 | 3300046559 | Ga0495667_0057518 | Ga0495667_0057518_785_2020 | 408 |
| 63 | 3300046663 | Ga0495635_0014323 | Ga0495635_0014323_870_2105 | 408 |
| 64 | 3300046675 | Ga0495657_0020345 | Ga0495657_0020345_3129_4364 | 408 |
| 65 | 3300046683 | Ga0495658_0009331 | Ga0495658_0009331_2420_3655 | 408 |
| 66 | 3300046689 | Ga0495613_0109622 | Ga0495613_0109622_348_1583 | 408 |
| 67 | 3300046690 | Ga0495624_0036086 | Ga0495624_0036086_836_2071 | 408 |
| 68 | 3300047315 | Ga0495581_0007738 | Ga0495581_0007738_373_1608 | 408 |
| 69 | 3300047317 | Ga0495604_0055898 | Ga0495604_0055898_1778_3013 | 408 |
| 70 | 3300047322 | Ga0495680_0071345 | Ga0495680_0071345_199_1434 | 408 |
| 71 | 3300047471 | Ga0495684_0030287 | Ga0495684_0030287_1339_2574 | 408 |
| 72 | 3300048088 | Ga0495602_0045280 | Ga0495602_0045280_199_1434 | 408 |
| 73 | 3300048089 | Ga0495614_0023959 | Ga0495614_0023959_521_1756 | 408 |
| 74 | 3300053084 | Ga0495595_0076644 | Ga0495595_0076644_109_1344 | 408 |
| 75 | 3300035119 | Ga0373956_0004349 | Ga0373956_0004349_3743_5083 | 409 |
| 76 | 3300005334 | Ga0068869_100015064 | Ga0068869_1000150644 | 410 |
| 77 | 3300005336 | Ga0070680_100090769 | Ga0070680_1000907691 | 410 |
| 78 | 3300005338 | Ga0068868_100028502 | Ga0068868_1000285022 | 410 |
| 79 | 3300005339 | Ga0070660_100146654 | Ga0070660_1001466541 | 410 |
| 80 | 3300005366 | Ga0070659_100023115 | Ga0070659_1000231153 | 410 |
| 81 | 3300005441 | Ga0070700_100010160 | Ga0070700_1000101606 | 410 |
| 82 | 3300005455 | Ga0070663_100003410 | Ga0070663_1000034105 | 410 |
| 83 | 3300005457 | Ga0070662_100024724 | Ga0070662_1000247243 | 410 |
| 84 | 3300005577 | Ga0068857_100019120 | Ga0068857_1000191206 | 410 |
| 85 | 3300005578 | Ga0068854_100094689 | Ga0068854_1000946892 | 410 |
| 86 | 3300005616 | Ga0068852_100099945 | Ga0068852_1000999452 | 410 |
| 87 | 3300009094 | Ga0111539_10005914 | Ga0111539_1000591413 | 410 |
| 88 | 3300009148 | Ga0105243_10070243 | Ga0105243_100702431 | 410 |
| 89 | 3300014325 | Ga0163163_10134731 | Ga0163163_101347312 | 410 |
| 90 | 3300014745 | Ga0157377_10002864 | Ga0157377_100028644 | 410 |
| 91 | 3300025933 | Ga0207706_10014937 | Ga0207706_100149377 | 410 |
| 92 | 3300025940 | Ga0207691_10206751 | Ga0207691_102067512 | 410 |
| 93 | 3300025942 | Ga0207689_10023158 | Ga0207689_100231584 | 410 |
| 94 | 3300025945 | Ga0207679_10002163 | Ga0207679_1000216312 | 410 |
| 95 | 3300025981 | Ga0207640_10075498 | Ga0207640_100754982 | 410 |
| 96 | 3300026023 | Ga0207677_10052034 | Ga0207677_100520344 | 410 |
| 97 | 3300026067 | Ga0207678_10004102 | Ga0207678_100041026 | 410 |
| 98 | 3300026075 | Ga0207708_10018507 | Ga0207708_100185072 | 410 |
| 99 | 3300026116 | Ga0207674_10017440 | Ga0207674_100174406 | 410 |
| 100 | 3300026121 | Ga0207683_10090615 | Ga0207683_100906152 | 410 |
| 101 | 3300026142 | Ga0207698_10039771 | Ga0207698_100397712 | 410 |
| 102 | 3300050511 | nmdc:mga08y16_116013_c1 | nmdc:mga08y16_116013_c1_690_2000 | 410 |
| 103 | 3300044694 | Ga0466963_0133200 | Ga0466963_0133200_333_1580 | 411 |
| 104 | 3300044735 | Ga0466968_0041430 | Ga0466968_0041430_541_1788 | 411 |
| 105 | 3300049575 | Ga0501039_0012507 | Ga0501039_0012507_246_1550 | 411 |
| 106 | 3300049576 | Ga0501040_0003285 | Ga0501040_0003285_2776_4080 | 411 |
| 107 | 3300049577 | Ga0501041_0000134 | Ga0501041_0000134_437_1741 | 411 |
| 108 | 3300049580 | Ga0501046_0001172 | Ga0501046_0001172_23933_25237 | 411 |
| 109 | 3300049584 | Ga0501068_0017459 | Ga0501068_0017459_242_1546 | 411 |
| 110 | 3300049824 | Ga0501045_0002189 | Ga0501045_0002189_155_1459 | 411 |
| 111 | 3300046539 | Ga0495621_0021044 | Ga0495621_0021044_871_2118 | 412 |
| 112 | 3300049568 | Ga0501031_0107159 | Ga0501031_0107159_282_1586 | 413 |
| 113 | iso_pu_bacteria | 2808606522 | 2809586052 | 413 |
| 114 | 3300009148 | Ga0105243_10000176 | Ga0105243_1000017627 | 415 |
| 115 | 3300025935 | Ga0207709_10000739 | Ga0207709_1000073917 | 415 |
| 116 | 3300042136 | Ga0450900_001900 | Ga0450900_001900_16_1329 | 415 |
| 117 | 3300032002 | Ga0307416_100209866 | Ga0307416_1002098662 | 416 |
| 118 | 3300032126 | Ga0307415_100005308 | Ga0307415_1000053082 | 416 |
| 119 | 3300048929 | Ga0496126_0005807 | Ga0496126_0005807_6642_7940 | 416 |
| 120 | 3300009545 | Ga0105237_10160494 | Ga0105237_101604942 | 417 |
| 121 | 3300025914 | Ga0207671_10117837 | Ga0207671_101178373 | 417 |
| 122 | 3300044684 | Ga0466966_0013306 | Ga0466966_0013306_1328_2641 | 417 |
| 123 | 3300045049 | Ga0466959_0006432 | Ga0466959_0006432_4670_5983 | 417 |
| 124 | 3300005327 | Ga0070658_10016833 | Ga0070658_100168332 | 418 |
| 125 | 3300005344 | Ga0070661_100036432 | Ga0070661_1000364325 | 418 |
| 126 | 3300005530 | Ga0070679_100078617 | Ga0070679_1000786174 | 418 |
| 127 | 3300037466 | Ga0395898_0189323 | Ga0395898_0189323_456_1799 | 418 |
| 128 | 3300037471 | Ga0395905_0198768 | Ga0395905_0198768_358_1701 | 418 |
| 129 | 3300038443 | Ga0395901_0005633 | Ga0395901_0005633_478_1821 | 418 |
| 130 | 3300049572 | Ga0501036_0024907 | Ga0501036_0024907_3408_4709 | 418 |
| 131 | 3300049573 | Ga0501037_0114019 | Ga0501037_0114019_472_1773 | 418 |
| 132 | 3300049591 | Ga0501075_0008416 | Ga0501075_0008416_362_1663 | 418 |
| 133 | 3300049592 | Ga0501076_0001857 | Ga0501076_0001857_201_1502 | 418 |
| 134 | 3300049743 | Ga0501081_0002166 | Ga0501081_0002166_7058_8362 | 418 |
| 135 | 3300025920 | Ga0207649_10033586 | Ga0207649_100335863 | 419 |
| 136 | 3300038443 | Ga0395901_0020193 | Ga0395901_0020193_3967_5298 | 419 |
| 137 | 3300049569 | Ga0501032_0079701 | Ga0501032_0079701_725_2044 | 419 |
| 138 | 3300049570 | Ga0501033_0017409 | Ga0501033_0017409_2423_3742 | 419 |
| 139 | 3300049571 | Ga0501034_0022894 | Ga0501034_0022894_4966_6285 | 419 |
| 140 | 3300049581 | Ga0501047_0046413 | Ga0501047_0046413_760_2079 | 419 |
| 141 | 3300049822 | Ga0501035_0000602 | Ga0501035_0000602_30959_32278 | 419 |
| 142 | 3300049823 | Ga0501044_0012463 | Ga0501044_0012463_7397_8716 | 419 |
| 143 | 3300005441 | Ga0070700_100000064 | Ga0070700_10000006471 | 420 |
| 144 | 3300026075 | Ga0207708_10000076 | Ga0207708_100000762 | 420 |
| 145 | 3300037418 | Ga0395900_0019899 | Ga0395900_0019899_4267_5598 | 420 |
| 146 | 3300037418 | Ga0395900_0046784 | Ga0395900_0046784_437_1768 | 420 |
| 147 | 3300037466 | Ga0395898_0044449 | Ga0395898_0044449_336_1667 | 420 |
| 148 | 3300038443 | Ga0395901_0021278 | Ga0395901_0021278_3896_5227 | 420 |
| 149 | 3300046678 | Ga0495599_0061354 | Ga0495599_0061354_735_2006 | 420 |
| 150 | iso_pu_bacteria | 2837183177 | 2837185787 | 420 |
| 151 | 3300005435 | Ga0070714_100062406 | Ga0070714_1000624063 | 421 |
| 152 | 3300005437 | Ga0070710_10000174 | Ga0070710_1000017423 | 421 |
| 153 | 3300006844 | Ga0075428_100025634 | Ga0075428_1000256344 | 421 |
| 154 | 3300006846 | Ga0075430_100003241 | Ga0075430_10000324110 | 421 |
| 155 | 3300006847 | Ga0075431_100002314 | Ga0075431_10000231415 | 421 |
| 156 | 3300006880 | Ga0075429_100003556 | Ga0075429_10000355610 | 421 |
| 157 | 3300009147 | Ga0114129_10008813 | Ga0114129_1000881310 | 421 |
| 158 | 3300025898 | Ga0207692_10000925 | Ga0207692_100009259 | 421 |
| 159 | 3300044694 | Ga0466963_0008033 | Ga0466963_0008033_1158_2498 | 421 |
| 160 | 3300050507 | nmdc:mga05p37_672_c1 | nmdc:mga05p37_672_c1_5563_6861 | 421 |
| 161 | 3300050508 | nmdc:mga09592_2964_c1 | nmdc:mga09592_2964_c1_3219_4517 | 421 |
| 162 | 3300050509 | nmdc:mga0qj67_294_c1 | nmdc:mga0qj67_294_c1_3219_4517 | 421 |
| 163 | 3300050510 | nmdc:mga06r32_285_c2 | nmdc:mga06r32_285_c2_33322_34620 | 421 |
| 164 | 3300005436 | Ga0070713_100043437 | Ga0070713_1000434374 | 422 |
| 165 | 3300005981 | Ga0081538_10000392 | Ga0081538_1000039217 | 422 |
| 166 | 3300009551 | Ga0105238_10057780 | Ga0105238_100577804 | 422 |
| 167 | 3300025924 | Ga0207694_10069041 | Ga0207694_100690413 | 422 |
| 168 | 3300044656 | Ga0466969_0004839 | Ga0466969_0004839_1995_3317 | 422 |
| 169 | 3300044684 | Ga0466966_0004214 | Ga0466966_0004214_4797_6119 | 422 |
| 170 | 3300044693 | Ga0466961_0002770 | Ga0466961_0002770_8020_9342 | 422 |
| 171 | 3300044719 | Ga0466971_0027693 | Ga0466971_0027693_495_1817 | 422 |
| 172 | 3300045049 | Ga0466959_0007060 | Ga0466959_0007060_3617_4939 | 422 |
| 173 | 3300048923 | Ga0496120_0008461 | Ga0496120_0008461_1142_2440 | 422 |
| 174 | 3300049741 | Ga0501079_0061214 | Ga0501079_0061214_1271_2563 | 422 |
| 175 | 3300061719 | Ga0466962_0011231 | Ga0466962_0011231_2109_3431 | 422 |
| 176 | 3300005841 | Ga0068863_100168409 | Ga0068863_1001684093 | 423 |
| 177 | 3300044684 | Ga0466966_0022867 | Ga0466966_0022867_2711_4039 | 423 |
| 178 | 3300048903 | Ga0496100_0028650 | Ga0496100_0028650_62_1360 | 423 |
| 179 | 3300048905 | Ga0496102_0000292 | Ga0496102_0000292_142_1440 | 423 |
| 180 | 3300048906 | Ga0496103_0016423 | Ga0496103_0016423_120_1418 | 423 |
| 181 | 3300048907 | Ga0496104_0118439 | Ga0496104_0118439_121_1419 | 423 |
| 182 | 3300048907 | Ga0496104_0174030 | Ga0496104_0174030_75_1358 | 423 |
| 183 | 3300048911 | Ga0496108_0248515 | Ga0496108_0248515_236_1534 | 423 |
| 184 | 3300048915 | Ga0496112_0144919 | Ga0496112_0144919_19_1302 | 423 |
| 185 | 3300048916 | Ga0496113_0126539 | Ga0496113_0126539_430_1713 | 423 |
| 186 | 3300048919 | Ga0496116_0003840 | Ga0496116_0003840_11393_12691 | 423 |
| 187 | 3300048920 | Ga0496117_0000572 | Ga0496117_0000572_47678_48976 | 423 |
| 188 | 3300048921 | Ga0496118_0004828 | Ga0496118_0004828_3010_4308 | 423 |
| 189 | 3300048922 | Ga0496119_0023406 | Ga0496119_0023406_103_1401 | 423 |
| 190 | 3300048927 | Ga0496124_0036597 | Ga0496124_0036597_2940_4238 | 423 |
| 191 | 3300048928 | Ga0496125_0043573 | Ga0496125_0043573_1448_2746 | 423 |
| 192 | 3300048929 | Ga0496126_0000344 | Ga0496126_0000344_62610_63908 | 423 |
| 193 | 3300005445 | Ga0070708_100119891 | Ga0070708_1001198912 | 424 |
| 194 | 3300005467 | Ga0070706_100054604 | Ga0070706_1000546044 | 424 |
| 195 | 3300005468 | Ga0070707_100028377 | Ga0070707_1000283775 | 424 |
| 196 | 3300005471 | Ga0070698_100267108 | Ga0070698_1002671082 | 424 |
| 197 | 3300006028 | Ga0070717_10015998 | Ga0070717_100159983 | 424 |
| 198 | 3300009147 | Ga0114129_10161528 | Ga0114129_101615283 | 424 |
| 199 | 3300022467 | Ga0224712_10009980 | Ga0224712_100099802 | 424 |
| 200 | 3300025906 | Ga0207699_10154642 | Ga0207699_101546422 | 424 |
| 201 | 3300025922 | Ga0207646_10005244 | Ga0207646_100052442 | 424 |
| 202 | 3300025922 | Ga0207646_10007603 | Ga0207646_100076038 | 424 |
| 203 | 3300025922 | Ga0207646_10255243 | Ga0207646_102552431 | 424 |
| 204 | 3300046517 | Ga0495630_0175985 | Ga0495630_0175985_168_1475 | 424 |
| 205 | 3300005458 | Ga0070681_10000077 | Ga0070681_100000778 | 425 |
| 206 | 3300005530 | Ga0070679_100000016 | Ga0070679_100000016135 | 425 |
| 207 | 3300013105 | Ga0157369_10001482 | Ga0157369_1000148219 | 425 |
| 208 | 3300013105 | Ga0157369_10022930 | Ga0157369_100229306 | 425 |
| 209 | 3300020082 | Ga0206353_11821398 | Ga0206353_118213984 | 425 |
| 210 | 3300021388 | Ga0213875_10015991 | Ga0213875_100159912 | 425 |
| 211 | 3300025912 | Ga0207707_10000089 | Ga0207707_100000898 | 425 |
| 212 | 3300025917 | Ga0207660_10006327 | Ga0207660_100063274 | 425 |
| 213 | 3300025921 | Ga0207652_10000015 | Ga0207652_1000001596 | 425 |
| 214 | 3300037853 | Ga0436364_0251182 | Ga0436364_0251182_5804_7141 | 425 |
| 215 | 3300044694 | Ga0466963_0132852 | Ga0466963_0132852_324_1649 | 425 |
| 216 | 3300049823 | Ga0501044_0007990 | Ga0501044_0007990_4385_5665 | 425 |
| 217 | iso_pu_bacteria | 2918501144 | 2918506935 | 425 |
| 218 | 3300003203 | JGI25406J46586_10017546 | JGI25406J46586_100175462 | 426 |
| 219 | 3300005455 | Ga0070663_100009904 | Ga0070663_1000099043 | 426 |
| 220 | 3300005985 | Ga0081539_10003154 | Ga0081539_100031547 | 426 |
| 221 | 3300021388 | Ga0213875_10001286 | Ga0213875_100012869 | 426 |
| 222 | 3300025921 | Ga0207652_10138007 | Ga0207652_101380072 | 426 |
| 223 | 3300028379 | Ga0268266_10245668 | Ga0268266_102456682 | 426 |
| 224 | 3300031548 | Ga0307408_100161744 | Ga0307408_1001617441 | 426 |
| 225 | 3300031731 | Ga0307405_10002200 | Ga0307405_100022008 | 426 |
| 226 | 3300031824 | Ga0307413_10040751 | Ga0307413_100407513 | 426 |
| 227 | 3300031852 | Ga0307410_10003205 | Ga0307410_100032056 | 426 |
| 228 | 3300031901 | Ga0307406_10007359 | Ga0307406_100073594 | 426 |
| 229 | 3300031903 | Ga0307407_10006451 | Ga0307407_100064513 | 426 |
| 230 | 3300031995 | Ga0307409_100000197 | Ga0307409_10000019715 | 426 |
| 231 | 3300032002 | Ga0307416_100003728 | Ga0307416_1000037287 | 426 |
| 232 | 3300032005 | Ga0307411_10006006 | Ga0307411_100060065 | 426 |
| 233 | 3300032126 | Ga0307415_100003572 | Ga0307415_1000035725 | 426 |
| 234 | 3300037853 | Ga0436364_0512751 | Ga0436364_0512751_23699_25036 | 426 |
| 235 | 3300044693 | Ga0466961_0001396 | Ga0466961_0001396_12719_14014 | 426 |
| 236 | 3300044694 | Ga0466963_0040543 | Ga0466963_0040543_294_1592 | 426 |
| 237 | 3300045836 | Ga0466958_0046431 | Ga0466958_0046431_790_2085 | 426 |
| 238 | 3300048929 | Ga0496126_0142815 | Ga0496126_0142815_676_1971 | 426 |
| 239 | 3300049570 | Ga0501033_0150472 | Ga0501033_0150472_17_1333 | 426 |
| 240 | iso_pu_bacteria | 2523231044 | 2523386566 | 426 |
| 241 | iso_pu_bacteria | 2899370129 | 2899373743 | 426 |
| 242 | iso_pu_bacteria | 8003314358 | 8003316372 | 426 |
| 243 | 3300005328 | Ga0070676_10039604 | Ga0070676_100396042 | 427 |
| 244 | 3300005337 | Ga0070682_100034956 | Ga0070682_1000349563 | 427 |
| 245 | 3300005340 | Ga0070689_100125006 | Ga0070689_1001250062 | 427 |
| 246 | 3300005458 | Ga0070681_10012712 | Ga0070681_100127128 | 427 |
| 247 | 3300005530 | Ga0070679_100137619 | Ga0070679_1001376192 | 427 |
| 248 | 3300005614 | Ga0068856_100183267 | Ga0068856_1001832671 | 427 |
| 249 | 3300005615 | Ga0070702_100128942 | Ga0070702_1001289422 | 427 |
| 250 | 3300005618 | Ga0068864_100039541 | Ga0068864_1000395414 | 427 |
| 251 | 3300009174 | Ga0105241_10094905 | Ga0105241_100949052 | 427 |
| 252 | 3300020082 | Ga0206353_10379419 | Ga0206353_103794192 | 427 |
| 253 | 3300025901 | Ga0207688_10063870 | Ga0207688_100638702 | 427 |
| 254 | 3300025912 | Ga0207707_10013813 | Ga0207707_100138135 | 427 |
| 255 | 3300025921 | Ga0207652_10111298 | Ga0207652_101112983 | 427 |
| 256 | 3300025933 | Ga0207706_10033507 | Ga0207706_100335072 | 427 |
| 257 | 3300025949 | Ga0207667_10213704 | Ga0207667_102137041 | 427 |
| 258 | 3300026088 | Ga0207641_10168454 | Ga0207641_101684542 | 427 |
| 259 | 3300030733 | Ga0314311_1001867 | Ga0314311_10018674 | 427 |
| 260 | 3300032005 | Ga0307411_10012993 | Ga0307411_100129932 | 427 |
| 261 | 3300044658 | Ga0466972_0008802 | Ga0466972_0008802_2894_4189 | 427 |
| 262 | 3300044683 | Ga0466965_0000962 | Ga0466965_0000962_5321_6616 | 427 |
| 263 | 3300044683 | Ga0466965_0003981 | Ga0466965_0003981_4611_5906 | 427 |
| 264 | 3300044683 | Ga0466965_0004181 | Ga0466965_0004181_4027_5322 | 427 |
| 265 | 3300044684 | Ga0466966_0089499 | Ga0466966_0089499_568_1866 | 427 |
| 266 | 3300044693 | Ga0466961_0016856 | Ga0466961_0016856_927_2228 | 427 |
| 267 | 3300044901 | Ga0466960_0000412 | Ga0466960_0000412_5135_6430 | 427 |
| 268 | iso_pu_bacteria | 2915768154 | 2915773536 | 427 |
| 269 | iso_pu_bacteria | 2917736166 | 2917741298 | 427 |
| 270 | 3300005327 | Ga0070658_10004695 | Ga0070658_100046952 | 428 |
| 271 | 3300005563 | Ga0068855_100004544 | Ga0068855_1000045448 | 428 |
| 272 | 3300005614 | Ga0068856_100077264 | Ga0068856_1000772642 | 428 |
| 273 | 3300005719 | Ga0068861_100120019 | Ga0068861_1001200192 | 428 |
| 274 | 3300006058 | Ga0075432_10008885 | Ga0075432_100088853 | 428 |
| 275 | 3300006846 | Ga0075430_100006724 | Ga0075430_1000067249 | 428 |
| 276 | 3300009094 | Ga0111539_10003093 | Ga0111539_100030932 | 428 |
| 277 | 3300009553 | Ga0105249_10009099 | Ga0105249_100090999 | 428 |
| 278 | 3300013307 | Ga0157372_10000678 | Ga0157372_1000067821 | 428 |
| 279 | 3300025909 | Ga0207705_10023506 | Ga0207705_100235061 | 428 |
| 280 | 3300025909 | Ga0207705_10041874 | Ga0207705_100418743 | 428 |
| 281 | 3300025925 | Ga0207650_10072040 | Ga0207650_100720402 | 428 |
| 282 | 3300025949 | Ga0207667_10023404 | Ga0207667_100234046 | 428 |
| 283 | 3300026118 | Ga0207675_100002509 | Ga0207675_1000025097 | 428 |
| 284 | 3300027907 | Ga0207428_10001475 | Ga0207428_100014752 | 428 |
| 285 | 3300031731 | Ga0307405_10064876 | Ga0307405_100648762 | 428 |
| 286 | 3300031852 | Ga0307410_10004504 | Ga0307410_100045044 | 428 |
| 287 | 3300031852 | Ga0307410_10057563 | Ga0307410_100575632 | 428 |
| 288 | 3300031911 | Ga0307412_10116208 | Ga0307412_101162082 | 428 |
| 289 | 3300031995 | Ga0307409_100000337 | Ga0307409_1000003379 | 428 |
| 290 | 3300032004 | Ga0307414_10020370 | Ga0307414_100203701 | 428 |
| 291 | 3300032126 | Ga0307415_100003928 | Ga0307415_1000039284 | 428 |
| 292 | 3300032126 | Ga0307415_100081508 | Ga0307415_1000815082 | 428 |
| 293 | 3300042005 | Ga0439448_0000133 | Ga0439448_0000133_3053_4363 | 428 |
| 294 | 3300042008 | Ga0439450_000171 | Ga0439450_000171_424_1734 | 428 |
| 295 | 3300042016 | Ga0439463_000090 | Ga0439463_000090_8703_10013 | 428 |
| 296 | 3300042437 | Ga0439444_0001658 | Ga0439444_0001658_1512_2822 | 428 |
| 297 | 3300042439 | Ga0439464_0000125 | Ga0439464_0000125_4397_5707 | 428 |
| 298 | 3300042530 | Ga0450916_001317 | Ga0450916_001317_728_2038 | 428 |
| 299 | 3300042993 | Ga0439440_0000024 | Ga0439440_0000024_8840_10150 | 428 |
| 300 | 3300044658 | Ga0466972_0004496 | Ga0466972_0004496_2362_3663 | 428 |
| 301 | 3300046537 | Ga0495598_0006230 | Ga0495598_0006230_904_2214 | 428 |
| 302 | 3300049568 | Ga0501031_0000786 | Ga0501031_0000786_6020_7330 | 428 |
| 303 | 3300049568 | Ga0501031_0001466 | Ga0501031_0001466_3670_5013 | 428 |
| 304 | 3300049568 | Ga0501031_0001689 | Ga0501031_0001689_4927_6234 | 428 |
| 305 | 3300049569 | Ga0501032_0000529 | Ga0501032_0000529_9450_10793 | 428 |
| 306 | 3300049570 | Ga0501033_0007352 | Ga0501033_0007352_5829_7172 | 428 |
| 307 | 3300049571 | Ga0501034_0005705 | Ga0501034_0005705_8518_9861 | 428 |
| 308 | 3300049571 | Ga0501034_0029795 | Ga0501034_0029795_3453_4760 | 428 |
| 309 | 3300049572 | Ga0501036_0000208 | Ga0501036_0000208_35890_37200 | 428 |
| 310 | 3300049572 | Ga0501036_0002407 | Ga0501036_0002407_11581_12924 | 428 |
| 311 | 3300049573 | Ga0501037_0001621 | Ga0501037_0001621_1059_2402 | 428 |
| 312 | 3300049573 | Ga0501037_0014597 | Ga0501037_0014597_3162_4472 | 428 |
| 313 | 3300049574 | Ga0501038_0003875 | Ga0501038_0003875_11504_12847 | 428 |
| 314 | 3300049574 | Ga0501038_0008098 | Ga0501038_0008098_5738_7048 | 428 |
| 315 | 3300049575 | Ga0501039_0000629 | Ga0501039_0000629_13133_14443 | 428 |
| 316 | 3300049575 | Ga0501039_0008229 | Ga0501039_0008229_5548_6891 | 428 |
| 317 | 3300049576 | Ga0501040_0000013 | Ga0501040_0000013_62391_63701 | 428 |
| 318 | 3300049576 | Ga0501040_0044155 | Ga0501040_0044155_1568_2911 | 428 |
| 319 | 3300049577 | Ga0501041_0001378 | Ga0501041_0001378_8726_10036 | 428 |
| 320 | 3300049578 | Ga0501042_0000426 | Ga0501042_0000426_5819_7129 | 428 |
| 321 | 3300049578 | Ga0501042_0001684 | Ga0501042_0001684_2818_4161 | 428 |
| 322 | 3300049579 | Ga0501043_0014156 | Ga0501043_0014156_174_1481 | 428 |
| 323 | 3300049579 | Ga0501043_0020981 | Ga0501043_0020981_3670_5013 | 428 |
| 324 | 3300049580 | Ga0501046_0001681 | Ga0501046_0001681_12406_13716 | 428 |
| 325 | 3300049580 | Ga0501046_0004074 | Ga0501046_0004074_2486_3829 | 428 |
| 326 | 3300049581 | Ga0501047_0002802 | Ga0501047_0002802_3670_5013 | 428 |
| 327 | 3300049582 | Ga0501048_0000215 | Ga0501048_0000215_8743_10053 | 428 |
| 328 | 3300049582 | Ga0501048_0002334 | Ga0501048_0002334_10321_11664 | 428 |
| 329 | 3300049582 | Ga0501048_0008359 | Ga0501048_0008359_2182_3489 | 428 |
| 330 | 3300049583 | Ga0501067_0040637 | Ga0501067_0040637_1059_2402 | 428 |
| 331 | 3300049585 | Ga0501069_0040757 | Ga0501069_0040757_1059_2402 | 428 |
| 332 | 3300049586 | Ga0501070_0006467 | Ga0501070_0006467_6578_7921 | 428 |
| 333 | 3300049587 | Ga0501071_0014902 | Ga0501071_0014902_107_1450 | 428 |
| 334 | 3300049588 | Ga0501072_0000218 | Ga0501072_0000218_35075_36385 | 428 |
| 335 | 3300049588 | Ga0501072_0041820 | Ga0501072_0041820_140_1483 | 428 |
| 336 | 3300049589 | Ga0501073_0026995 | Ga0501073_0026995_1708_3051 | 428 |
| 337 | 3300049590 | Ga0501074_0023632 | Ga0501074_0023632_1456_2766 | 428 |
| 338 | 3300049590 | Ga0501074_0067877 | Ga0501074_0067877_90_1433 | 428 |
| 339 | 3300049591 | Ga0501075_0000029 | Ga0501075_0000029_54863_56173 | 428 |
| 340 | 3300049592 | Ga0501076_0000173 | Ga0501076_0000173_35102_36412 | 428 |
| 341 | 3300049592 | Ga0501076_0049135 | Ga0501076_0049135_1900_3243 | 428 |
| 342 | 3300049593 | Ga0501077_0000077 | Ga0501077_0000077_33587_34897 | 428 |
| 343 | 3300049593 | Ga0501077_0058031 | Ga0501077_0058031_53_1396 | 428 |
| 344 | 3300049741 | Ga0501079_0000721 | Ga0501079_0000721_15201_16511 | 428 |
| 345 | 3300049741 | Ga0501079_0001150 | Ga0501079_0001150_7385_8728 | 428 |
| 346 | 3300049742 | Ga0501080_0011290 | Ga0501080_0011290_1157_2500 | 428 |
| 347 | 3300049742 | Ga0501080_0011433 | Ga0501080_0011433_6045_7355 | 428 |
| 348 | 3300049743 | Ga0501081_0007931 | Ga0501081_0007931_1882_3192 | 428 |
| 349 | 3300049744 | Ga0501083_0024502 | Ga0501083_0024502_2780_4123 | 428 |
| 350 | 3300049822 | Ga0501035_0003399 | Ga0501035_0003399_7332_8642 | 428 |
| 351 | 3300049822 | Ga0501035_0010290 | Ga0501035_0010290_1516_2823 | 428 |
| 352 | 3300049822 | Ga0501035_0027898 | Ga0501035_0027898_3667_5010 | 428 |
| 353 | 3300049823 | Ga0501044_0002108 | Ga0501044_0002108_3898_5241 | 428 |
| 354 | 3300049823 | Ga0501044_0171028 | Ga0501044_0171028_434_1741 | 428 |
| 355 | 3300049823 | Ga0501044_0302782 | Ga0501044_0302782_28_1329 | 428 |
| 356 | 3300049824 | Ga0501045_0025660 | Ga0501045_0025660_1836_3179 | 428 |
| 357 | 3300049824 | Ga0501045_0047607 | Ga0501045_0047607_491_1801 | 428 |
| 358 | 3300050507 | nmdc:mga05p37_35803_c1 | nmdc:mga05p37_35803_c1_4610_5920 | 428 |
| 359 | 3300050509 | nmdc:mga0qj67_59950_c1 | nmdc:mga0qj67_59950_c1_425_1735 | 428 |
| 360 | 3300050512 | nmdc:mga0n895_43331_c1 | nmdc:mga0n895_43331_c1_2224_3534 | 428 |
| 361 | 3300050515 | nmdc:mga0a205_55902_c1 | nmdc:mga0a205_55902_c1_400_1710 | 428 |
| 362 | 3300054114 | Ga0501084_0001702 | Ga0501084_0001702_13727_15037 | 428 |
| 363 | 3300060353 | Ga0501082_0000853 | Ga0501082_0000853_11219_12529 | 428 |
| 364 | 3300060353 | Ga0501082_0294315 | Ga0501082_0294315_23_1366 | 428 |
| 365 | 3300061734 | Ga0530510_0000142 | Ga0530510_0000142_25672_26982 | 428 |
| 366 | iso_pu_bacteria | 2551306166 | 2552111067 | 428 |
| 367 | iso_pu_bacteria | 2643221692 | 2644514143 | 428 |
| 368 | iso_pu_bacteria | 2744054611 | 2744957395 | 428 |
| 369 | iso_pu_bacteria | 2751185725 | 2753035971 | 428 |
| 370 | iso_pu_bacteria | 2751185792 | 2753326004 | 428 |
| 371 | iso_pu_bacteria | 2795385470 | 2795781309 | 428 |
| 372 | iso_pu_bacteria | 2842888712 | 2842890633 | 428 |
| 373 | iso_pu_bacteria | 2866612099 | 2866617267 | 428 |
| 374 | iso_pu_bacteria | 2899359706 | 2899361154 | 428 |
| 375 | 3300005334 | Ga0068869_100027180 | Ga0068869_1000271803 | 429 |
| 376 | 3300005335 | Ga0070666_10025799 | Ga0070666_100257993 | 429 |
| 377 | 3300005347 | Ga0070668_100001503 | Ga0070668_10000150315 | 429 |
| 378 | 3300005436 | Ga0070713_100235480 | Ga0070713_1002354802 | 429 |
| 379 | 3300005455 | Ga0070663_100000466 | Ga0070663_10000046613 | 429 |
| 380 | 3300005535 | Ga0070684_100086143 | Ga0070684_1000861433 | 429 |
| 381 | 3300005563 | Ga0068855_100003813 | Ga0068855_1000038137 | 429 |
| 382 | 3300005618 | Ga0068864_100048460 | Ga0068864_1000484604 | 429 |
| 383 | 3300005841 | Ga0068863_100005170 | Ga0068863_1000051703 | 429 |
| 384 | 3300005842 | Ga0068858_100083714 | Ga0068858_1000837142 | 429 |
| 385 | 3300005937 | Ga0081455_10000071 | Ga0081455_1000007195 | 429 |
| 386 | 3300005937 | Ga0081455_10001759 | Ga0081455_1000175917 | 429 |
| 387 | 3300005983 | Ga0081540_1001045 | Ga0081540_100104511 | 429 |
| 388 | 3300006028 | Ga0070717_10098859 | Ga0070717_100988592 | 429 |
| 389 | 3300006852 | Ga0075433_10001489 | Ga0075433_1000148914 | 429 |
| 390 | 3300006871 | Ga0075434_100005169 | Ga0075434_10000516910 | 429 |
| 391 | 3300009093 | Ga0105240_10054115 | Ga0105240_100541153 | 429 |
| 392 | 3300009098 | Ga0105245_10044404 | Ga0105245_100444043 | 429 |
| 393 | 3300009101 | Ga0105247_10034450 | Ga0105247_100344503 | 429 |
| 394 | 3300009176 | Ga0105242_10025964 | Ga0105242_100259643 | 429 |
| 395 | 3300009545 | Ga0105237_10118830 | Ga0105237_101188303 | 429 |
| 396 | 3300009551 | Ga0105238_10004587 | Ga0105238_100045873 | 429 |
| 397 | 3300009553 | Ga0105249_10010376 | Ga0105249_100103767 | 429 |
| 398 | 3300013105 | Ga0157369_10068398 | Ga0157369_100683984 | 429 |
| 399 | 3300013297 | Ga0157378_10116250 | Ga0157378_101162502 | 429 |
| 400 | 3300013306 | Ga0163162_10006240 | Ga0163162_100062402 | 429 |
| 401 | 3300014968 | Ga0157379_10124618 | Ga0157379_101246182 | 429 |
| 402 | 3300017792 | Ga0163161_10008455 | Ga0163161_100084555 | 429 |
| 403 | 3300017792 | Ga0163161_10070900 | Ga0163161_100709002 | 429 |
| 404 | 3300025321 | Ga0207656_10015051 | Ga0207656_100150513 | 429 |
| 405 | 3300025900 | Ga0207710_10008663 | Ga0207710_100086635 | 429 |
| 406 | 3300025907 | Ga0207645_10082455 | Ga0207645_100824552 | 429 |
| 407 | 3300025911 | Ga0207654_10052418 | Ga0207654_100524182 | 429 |
| 408 | 3300025915 | Ga0207693_10031758 | Ga0207693_100317583 | 429 |
| 409 | 3300025927 | Ga0207687_10023953 | Ga0207687_100239534 | 429 |
| 410 | 3300025928 | Ga0207700_10142070 | Ga0207700_101420702 | 429 |
| 411 | 3300025937 | Ga0207669_10042854 | Ga0207669_100428542 | 429 |
| 412 | 3300025937 | Ga0207669_10062475 | Ga0207669_100624752 | 429 |
| 413 | 3300025939 | Ga0207665_10000912 | Ga0207665_100009123 | 429 |
| 414 | 3300025942 | Ga0207689_10011876 | Ga0207689_100118766 | 429 |
| 415 | 3300025942 | Ga0207689_10032836 | Ga0207689_100328364 | 429 |
| 416 | 3300025949 | Ga0207667_10194828 | Ga0207667_101948281 | 429 |
| 417 | 3300025961 | Ga0207712_10002242 | Ga0207712_1000224210 | 429 |
| 418 | 3300025961 | Ga0207712_10113207 | Ga0207712_101132072 | 429 |
| 419 | 3300026023 | Ga0207677_10063117 | Ga0207677_100631173 | 429 |
| 420 | 3300026067 | Ga0207678_10016705 | Ga0207678_100167056 | 429 |
| 421 | 3300026067 | Ga0207678_10022386 | Ga0207678_100223863 | 429 |
| 422 | 3300026075 | Ga0207708_10004349 | Ga0207708_100043499 | 429 |
| 423 | 3300026088 | Ga0207641_10009537 | Ga0207641_100095375 | 429 |
| 424 | 3300026089 | Ga0207648_10050640 | Ga0207648_100506404 | 429 |
| 425 | 3300026121 | Ga0207683_10004394 | Ga0207683_1000439410 | 429 |
| 426 | 3300026142 | Ga0207698_10022456 | Ga0207698_100224562 | 429 |
| 427 | 3300031240 | Ga0265320_10025164 | Ga0265320_100251643 | 429 |
| 428 | 3300031241 | Ga0265325_10024399 | Ga0265325_100243994 | 429 |
| 429 | 3300031247 | Ga0265340_10006275 | Ga0265340_100062755 | 429 |
| 430 | 3300031711 | Ga0265314_10007762 | Ga0265314_100077626 | 429 |
| 431 | 3300031824 | Ga0307413_10122783 | Ga0307413_101227832 | 429 |
| 432 | 3300031852 | Ga0307410_10051997 | Ga0307410_100519972 | 429 |
| 433 | 3300031995 | Ga0307409_100115222 | Ga0307409_1001152222 | 429 |
| 434 | 3300035112 | Ga0373932_0015187 | Ga0373932_0015187_238_1542 | 429 |
| 435 | 3300037418 | Ga0395900_0265159 | Ga0395900_0265159_100_1413 | 429 |
| 436 | 3300037853 | Ga0436364_0955899 | Ga0436364_0955899_7458_8783 | 429 |
| 437 | 3300044656 | Ga0466969_0006017 | Ga0466969_0006017_3752_5071 | 429 |
| 438 | 3300044658 | Ga0466972_0003690 | Ga0466972_0003690_4232_5533 | 429 |
| 439 | 3300044658 | Ga0466972_0009094 | Ga0466972_0009094_51_1358 | 429 |
| 440 | 3300044684 | Ga0466966_0001859 | Ga0466966_0001859_886_2190 | 429 |
| 441 | 3300044693 | Ga0466961_0095725 | Ga0466961_0095725_89_1426 | 429 |
| 442 | 3300044694 | Ga0466963_0001299 | Ga0466963_0001299_5286_6590 | 429 |
| 443 | 3300044694 | Ga0466963_0001487 | Ga0466963_0001487_3013_4320 | 429 |
| 444 | 3300044719 | Ga0466971_0001862 | Ga0466971_0001862_5178_6482 | 429 |
| 445 | 3300044719 | Ga0466971_0056094 | Ga0466971_0056094_115_1476 | 429 |
| 446 | 3300044719 | Ga0466971_0060540 | Ga0466971_0060540_359_1666 | 429 |
| 447 | 3300044765 | Ga0466970_0019429 | Ga0466970_0019429_110_1429 | 429 |
| 448 | 3300044842 | Ga0466957_0007701 | Ga0466957_0007701_770_2074 | 429 |
| 449 | 3300045049 | Ga0466959_0001272 | Ga0466959_0001272_528_1832 | 429 |
| 450 | 3300045836 | Ga0466958_0000116 | Ga0466958_0000116_14711_16015 | 429 |
| 451 | 3300045836 | Ga0466958_0060052 | Ga0466958_0060052_630_1946 | 429 |
| 452 | 3300045976 | Ga0466967_0000924 | Ga0466967_0000924_11683_12990 | 429 |
| 453 | 3300045976 | Ga0466967_0121203 | Ga0466967_0121203_134_1438 | 429 |
| 454 | 3300048903 | Ga0496100_0029701 | Ga0496100_0029701_1900_3204 | 429 |
| 455 | 3300048907 | Ga0496104_0003042 | Ga0496104_0003042_12736_14040 | 429 |
| 456 | 3300048908 | Ga0496105_0006019 | Ga0496105_0006019_3334_4638 | 429 |
| 457 | 3300049585 | Ga0501069_0010476 | Ga0501069_0010476_736_2040 | 429 |
| 458 | 3300049586 | Ga0501070_0025483 | Ga0501070_0025483_952_2256 | 429 |
| 459 | 3300049742 | Ga0501080_0000266 | Ga0501080_0000266_27255_28559 | 429 |
| 460 | 3300050515 | nmdc:mga0a205_10272_c1 | nmdc:mga0a205_10272_c1_5567_6871 | 429 |
| 461 | 3300061719 | Ga0466962_0000566 | Ga0466962_0000566_5313_6617 | 429 |
| 462 | 3300005355 | Ga0070671_100000653 | Ga0070671_1000006536 | 430 |
| 463 | 3300005548 | Ga0070665_100005239 | Ga0070665_1000052397 | 430 |
| 464 | 3300005841 | Ga0068863_100034594 | Ga0068863_1000345943 | 430 |
| 465 | 3300025931 | Ga0207644_10001889 | Ga0207644_100018896 | 430 |
| 466 | 3300025972 | Ga0207668_10078949 | Ga0207668_100789492 | 430 |
| 467 | 3300026088 | Ga0207641_10036495 | Ga0207641_100364955 | 430 |
| 468 | 3300028381 | Ga0268264_10019740 | Ga0268264_100197401 | 430 |
| 469 | 3300031616 | Ga0307508_10003996 | Ga0307508_1000399610 | 430 |
| 470 | 3300033180 | Ga0307510_10112253 | Ga0307510_101122533 | 430 |
| 471 | 3300048922 | Ga0496119_0000200 | Ga0496119_0000200_73780_75129 | 430 |
| 472 | 3300048923 | Ga0496120_0005099 | Ga0496120_0005099_3751_5100 | 430 |
| 473 | 3300053085 | Ga0495619_0024500 | Ga0495619_0024500_1654_2958 | 430 |
| 474 | iso_pu_bacteria | 2738543011 | 2739235941 | 430 |
| 475 | iso_pu_bacteria | 2889300758 | 2889305539 | 430 |
| 476 | iso_pu_bacteria | 2915358134 | 2915361536 | 430 |
| 477 | iso_pu_bacteria | 2939743619 | 2939743675 | 430 |
| 478 | iso_pu_bacteria | 8047710418 | 8047718431 | 430 |
| 479 | 3300006028 | Ga0070717_10037923 | Ga0070717_100379232 | 431 |
| 480 | 3300006353 | Ga0075370_10045494 | Ga0075370_100454942 | 431 |
| 481 | 3300025929 | Ga0207664_10054432 | Ga0207664_100544322 | 431 |
| 482 | 3300044765 | Ga0466970_0014201 | Ga0466970_0014201_157_1467 | 431 |
| 483 | 3300044842 | Ga0466957_0029764 | Ga0466957_0029764_143_1492 | 431 |
| 484 | 3300046531 | Ga0495665_0012173 | Ga0495665_0012173_2121_3446 | 431 |
| 485 | 3300048906 | Ga0496103_0008519 | Ga0496103_0008519_3676_5034 | 431 |
| 486 | 3300048911 | Ga0496108_0141950 | Ga0496108_0141950_515_1834 | 431 |
| 487 | 3300048921 | Ga0496118_0117707 | Ga0496118_0117707_22_1380 | 431 |
| 488 | iso_pu_bacteria | 2565956761 | 2566996745 | 431 |
| 489 | iso_pu_bacteria | 2738541308 | 2738887658 | 431 |
| 490 | iso_pu_bacteria | 2904535858 | 2904541488 | 431 |
| 491 | iso_pu_bacteria | 2922554459 | 2922560136 | 431 |
| 492 | iso_pu_bacteria | 2956939328 | 2956940875 | 431 |
| 493 | iso_pu_bacteria | 3001119090 | 3001120564 | 431 |
| 494 | 3300026067 | Ga0207678_10001240 | Ga0207678_1000124015 | 432 |
| 495 | 3300026116 | Ga0207674_10071173 | Ga0207674_100711733 | 432 |
| 496 | 3300031838 | Ga0307518_10005413 | Ga0307518_100054139 | 432 |
| 497 | 3300045976 | Ga0466967_0002676 | Ga0466967_0002676_9332_10693 | 432 |
| 498 | 3300048905 | Ga0496102_0000409 | Ga0496102_0000409_7328_8647 | 432 |
| 499 | 3300048906 | Ga0496103_0015040 | Ga0496103_0015040_3260_4579 | 432 |
| 500 | iso_pu_bacteria | 2738543005 | 2739202625 | 432 |
| 501 | iso_pu_bacteria | 2870782633 | 2870788412 | 432 |
| 502 | iso_pu_bacteria | 2904765812 | 2904767577 | 432 |
| 503 | iso_pu_bacteria | 2904770941 | 2904774925 | 432 |
| 504 | iso_pu_bacteria | 2908811453 | 2908813219 | 432 |
| 505 | iso_pu_bacteria | 2919420072 | 2919424560 | 432 |
| 506 | iso_pu_bacteria | 2919432681 | 2919437059 | 432 |
| 507 | iso_pu_bacteria | 2928142448 | 2928143155 | 432 |
| 508 | iso_pu_bacteria | 2974315732 | 2974316031 | 432 |
| 509 | iso_pu_bacteria | 2984523437 | 2984524194 | 432 |
| 510 | iso_pu_bacteria | 8056207758 | 8056210976 | 432 |
| 511 | 3300031838 | Ga0307518_10000304 | Ga0307518_1000030411 | 433 |
| 512 | 3300033179 | Ga0307507_10038408 | Ga0307507_100384085 | 433 |
| 513 | 3300047472 | Ga0495686_0002331 | Ga0495686_0002331_14273_15586 | 433 |
| 514 | 3300048915 | Ga0496112_0114299 | Ga0496112_0114299_1056_2357 | 433 |
| 515 | 3300053131 | Ga0500652_000323 | Ga0500652_000323_12341_13648 | 433 |
| 516 | iso_pu_bacteria | 2585427649 | 2586064717 | 433 |
| 517 | iso_pu_bacteria | 2738541274 | 2738702743 | 433 |
| 518 | iso_pu_bacteria | 2738543028 | 2739329652 | 433 |
| 519 | 3300002077 | JGI24744J21845_10009136 | JGI24744J21845_100091362 | 434 |
| 520 | 3300002077 | JGI24744J21845_10009863 | JGI24744J21845_100098632 | 434 |
| 521 | 3300005328 | Ga0070676_10093615 | Ga0070676_100936151 | 434 |
| 522 | 3300005330 | Ga0070690_100010311 | Ga0070690_1000103112 | 434 |
| 523 | 3300005334 | Ga0068869_100010623 | Ga0068869_1000106234 | 434 |
| 524 | 3300005334 | Ga0068869_100113549 | Ga0068869_1001135493 | 434 |
| 525 | 3300005338 | Ga0068868_100006215 | Ga0068868_1000062156 | 434 |
| 526 | 3300005338 | Ga0068868_100051984 | Ga0068868_1000519844 | 434 |
| 527 | 3300005341 | Ga0070691_10004199 | Ga0070691_100041994 | 434 |
| 528 | 3300005341 | Ga0070691_10086277 | Ga0070691_100862771 | 434 |
| 529 | 3300005347 | Ga0070668_100023950 | Ga0070668_1000239502 | 434 |
| 530 | 3300005353 | Ga0070669_100003990 | Ga0070669_1000039904 | 434 |
| 531 | 3300005356 | Ga0070674_100008667 | Ga0070674_1000086674 | 434 |
| 532 | 3300005364 | Ga0070673_100032954 | Ga0070673_1000329543 | 434 |
| 533 | 3300005365 | Ga0070688_100014774 | Ga0070688_1000147742 | 434 |
| 534 | 3300005365 | Ga0070688_100020938 | Ga0070688_1000209385 | 434 |
| 535 | 3300005366 | Ga0070659_100015049 | Ga0070659_1000150494 | 434 |
| 536 | 3300005366 | Ga0070659_100129592 | Ga0070659_1001295922 | 434 |
| 537 | 3300005367 | Ga0070667_100003097 | Ga0070667_10000309719 | 434 |
| 538 | 3300005434 | Ga0070709_10044865 | Ga0070709_100448652 | 434 |
| 539 | 3300005437 | Ga0070710_10006635 | Ga0070710_100066352 | 434 |
| 540 | 3300005438 | Ga0070701_10002167 | Ga0070701_100021675 | 434 |
| 541 | 3300005439 | Ga0070711_100007734 | Ga0070711_1000077344 | 434 |
| 542 | 3300005440 | Ga0070705_100044584 | Ga0070705_1000445843 | 434 |
| 543 | 3300005441 | Ga0070700_100037284 | Ga0070700_1000372842 | 434 |
| 544 | 3300005455 | Ga0070663_100021979 | Ga0070663_1000219794 | 434 |
| 545 | 3300005456 | Ga0070678_100001568 | Ga0070678_1000015689 | 434 |
| 546 | 3300005456 | Ga0070678_100121361 | Ga0070678_1001213612 | 434 |
| 547 | 3300005459 | Ga0068867_100008283 | Ga0068867_1000082834 | 434 |
| 548 | 3300005539 | Ga0068853_100005937 | Ga0068853_1000059375 | 434 |
| 549 | 3300005539 | Ga0068853_100235151 | Ga0068853_1002351511 | 434 |
| 550 | 3300005547 | Ga0070693_100059561 | Ga0070693_1000595612 | 434 |
| 551 | 3300005549 | Ga0070704_100005753 | Ga0070704_1000057535 | 434 |
| 552 | 3300005549 | Ga0070704_100087318 | Ga0070704_1000873183 | 434 |
| 553 | 3300005563 | Ga0068855_100030141 | Ga0068855_1000301417 | 434 |
| 554 | 3300005578 | Ga0068854_100061046 | Ga0068854_1000610461 | 434 |
| 555 | 3300005616 | Ga0068852_100025899 | Ga0068852_1000258992 | 434 |
| 556 | 3300005617 | Ga0068859_100014343 | Ga0068859_1000143435 | 434 |
| 557 | 3300005718 | Ga0068866_10004247 | Ga0068866_100042473 | 434 |
| 558 | 3300005719 | Ga0068861_100010212 | Ga0068861_1000102126 | 434 |
| 559 | 3300006051 | Ga0075364_10013585 | Ga0075364_100135852 | 434 |
| 560 | 3300006175 | Ga0070712_100003874 | Ga0070712_1000038746 | 434 |
| 561 | 3300006175 | Ga0070712_100018973 | Ga0070712_1000189734 | 434 |
| 562 | 3300006186 | Ga0075369_10001162 | Ga0075369_100011622 | 434 |
| 563 | 3300006237 | Ga0097621_100018361 | Ga0097621_1000183616 | 434 |
| 564 | 3300006881 | Ga0068865_100004566 | Ga0068865_1000045666 | 434 |
| 565 | 3300006931 | Ga0097620_100014343 | Ga0097620_1000143435 | 434 |
| 566 | 3300009098 | Ga0105245_10011470 | Ga0105245_100114705 | 434 |
| 567 | 3300009101 | Ga0105247_10000587 | Ga0105247_1000058733 | 434 |
| 568 | 3300009148 | Ga0105243_10017022 | Ga0105243_100170222 | 434 |
| 569 | 3300009148 | Ga0105243_10053042 | Ga0105243_100530422 | 434 |
| 570 | 3300009174 | Ga0105241_10130677 | Ga0105241_101306771 | 434 |
| 571 | 3300009176 | Ga0105242_10000541 | Ga0105242_1000054122 | 434 |
| 572 | 3300009176 | Ga0105242_10040131 | Ga0105242_100401314 | 434 |
| 573 | 3300009545 | Ga0105237_10050276 | Ga0105237_100502765 | 434 |
| 574 | 3300009553 | Ga0105249_10001455 | Ga0105249_100014555 | 434 |
| 575 | 3300009553 | Ga0105249_10206108 | Ga0105249_102061082 | 434 |
| 576 | 3300009979 | Ga0105032_101028 | Ga0105032_1010282 | 434 |
| 577 | 3300010375 | Ga0105239_10010931 | Ga0105239_100109317 | 434 |
| 578 | 3300011119 | Ga0105246_10057272 | Ga0105246_100572722 | 434 |
| 579 | 3300013105 | Ga0157369_10306372 | Ga0157369_103063721 | 434 |
| 580 | 3300013296 | Ga0157374_10067285 | Ga0157374_100672852 | 434 |
| 581 | 3300013297 | Ga0157378_10025526 | Ga0157378_100255262 | 434 |
| 582 | 3300013308 | Ga0157375_10011156 | Ga0157375_100111565 | 434 |
| 583 | 3300013308 | Ga0157375_10302950 | Ga0157375_103029502 | 434 |
| 584 | 3300014326 | Ga0157380_10062044 | Ga0157380_100620444 | 434 |
| 585 | 3300014968 | Ga0157379_10106086 | Ga0157379_101060862 | 434 |
| 586 | 3300017792 | Ga0163161_10006350 | Ga0163161_100063505 | 434 |
| 587 | 3300017792 | Ga0163161_10191079 | Ga0163161_101910791 | 434 |
| 588 | 3300025900 | Ga0207710_10018370 | Ga0207710_100183703 | 434 |
| 589 | 3300025901 | Ga0207688_10002201 | Ga0207688_100022015 | 434 |
| 590 | 3300025901 | Ga0207688_10014213 | Ga0207688_100142132 | 434 |
| 591 | 3300025901 | Ga0207688_10040260 | Ga0207688_100402602 | 434 |
| 592 | 3300025904 | Ga0207647_10065140 | Ga0207647_100651403 | 434 |
| 593 | 3300025905 | Ga0207685_10002600 | Ga0207685_100026004 | 434 |
| 594 | 3300025906 | Ga0207699_10041228 | Ga0207699_100412283 | 434 |
| 595 | 3300025915 | Ga0207693_10001988 | Ga0207693_1000198816 | 434 |
| 596 | 3300025915 | Ga0207693_10004400 | Ga0207693_1000440013 | 434 |
| 597 | 3300025916 | Ga0207663_10002104 | Ga0207663_100021045 | 434 |
| 598 | 3300025923 | Ga0207681_10010077 | Ga0207681_100100775 | 434 |
| 599 | 3300025927 | Ga0207687_10003407 | Ga0207687_1000340711 | 434 |
| 600 | 3300025927 | Ga0207687_10050024 | Ga0207687_100500243 | 434 |
| 601 | 3300025931 | Ga0207644_10167071 | Ga0207644_101670712 | 434 |
| 602 | 3300025932 | Ga0207690_10027252 | Ga0207690_100272524 | 434 |
| 603 | 3300025933 | Ga0207706_10005837 | Ga0207706_100058378 | 434 |
| 604 | 3300025933 | Ga0207706_10022323 | Ga0207706_100223234 | 434 |
| 605 | 3300025934 | Ga0207686_10038559 | Ga0207686_100385594 | 434 |
| 606 | 3300025935 | Ga0207709_10064063 | Ga0207709_100640632 | 434 |
| 607 | 3300025937 | Ga0207669_10003202 | Ga0207669_100032022 | 434 |
| 608 | 3300025937 | Ga0207669_10055780 | Ga0207669_100557805 | 434 |
| 609 | 3300025938 | Ga0207704_10002568 | Ga0207704_100025685 | 434 |
| 610 | 3300025942 | Ga0207689_10006351 | Ga0207689_1000635114 | 434 |
| 611 | 3300025942 | Ga0207689_10024668 | Ga0207689_100246682 | 434 |
| 612 | 3300025961 | Ga0207712_10010257 | Ga0207712_100102573 | 434 |
| 613 | 3300025972 | Ga0207668_10004560 | Ga0207668_100045602 | 434 |
| 614 | 3300025972 | Ga0207668_10048577 | Ga0207668_100485772 | 434 |
| 615 | 3300025981 | Ga0207640_10008628 | Ga0207640_100086283 | 434 |
| 616 | 3300025986 | Ga0207658_10013062 | Ga0207658_100130623 | 434 |
| 617 | 3300026023 | Ga0207677_10004360 | Ga0207677_100043605 | 434 |
| 618 | 3300026035 | Ga0207703_10016320 | Ga0207703_100163205 | 434 |
| 619 | 3300026041 | Ga0207639_10009529 | Ga0207639_100095293 | 434 |
| 620 | 3300026067 | Ga0207678_10013386 | Ga0207678_100133864 | 434 |
| 621 | 3300026075 | Ga0207708_10025739 | Ga0207708_100257392 | 434 |
| 622 | 3300026075 | Ga0207708_10055787 | Ga0207708_100557872 | 434 |
| 623 | 3300026089 | Ga0207648_10005879 | Ga0207648_100058792 | 434 |
| 624 | 3300026089 | Ga0207648_10008936 | Ga0207648_100089365 | 434 |
| 625 | 3300026116 | Ga0207674_10054790 | Ga0207674_100547903 | 434 |
| 626 | 3300026118 | Ga0207675_100001816 | Ga0207675_10000181622 | 434 |
| 627 | 3300026118 | Ga0207675_100028433 | Ga0207675_1000284334 | 434 |
| 628 | 3300026118 | Ga0207675_100150513 | Ga0207675_1001505132 | 434 |
| 629 | 3300026121 | Ga0207683_10001438 | Ga0207683_1000143822 | 434 |
| 630 | 3300026121 | Ga0207683_10107455 | Ga0207683_101074552 | 434 |
| 631 | 3300026121 | Ga0207683_10133921 | Ga0207683_101339212 | 434 |
| 632 | 3300026142 | Ga0207698_10067249 | Ga0207698_100672492 | 434 |
| 633 | 3300028379 | Ga0268266_10014769 | Ga0268266_100147695 | 434 |
| 634 | 3300028380 | Ga0268265_10060409 | Ga0268265_100604094 | 434 |
| 635 | 3300028381 | Ga0268264_10008608 | Ga0268264_100086085 | 434 |
| 636 | 3300044683 | Ga0466965_0001996 | Ga0466965_0001996_5134_6456 | 434 |
| 637 | 3300044706 | Ga0466964_0012279 | Ga0466964_0012279_1620_2948 | 434 |
| 638 | 3300044735 | Ga0466968_0000508 | Ga0466968_0000508_5707_7029 | 434 |
| 639 | 3300044765 | Ga0466970_0006801 | Ga0466970_0006801_3064_4386 | 434 |
| 640 | 3300045976 | Ga0466967_0002704 | Ga0466967_0002704_4371_5690 | 434 |
| 641 | 3300048903 | Ga0496100_0010318 | Ga0496100_0010318_440_1744 | 434 |
| 642 | 3300048904 | Ga0496101_0005719 | Ga0496101_0005719_6087_7391 | 434 |
| 643 | 3300048905 | Ga0496102_0114293 | Ga0496102_0114293_173_1477 | 434 |
| 644 | 3300048909 | Ga0496106_0113115 | Ga0496106_0113115_398_1702 | 434 |
| 645 | 3300048910 | Ga0496107_0004037 | Ga0496107_0004037_4825_6129 | 434 |
| 646 | 3300048911 | Ga0496108_0001993 | Ga0496108_0001993_11402_12706 | 434 |
| 647 | 3300048912 | Ga0496109_0001047 | Ga0496109_0001047_12896_14200 | 434 |
| 648 | 3300048913 | Ga0496110_0274425 | Ga0496110_0274425_137_1474 | 434 |
| 649 | 3300048915 | Ga0496112_0010431 | Ga0496112_0010431_645_1949 | 434 |
| 650 | 3300048917 | Ga0496114_0002107 | Ga0496114_0002107_2834_4138 | 434 |
| 651 | 3300048917 | Ga0496114_0080999 | Ga0496114_0080999_107_1411 | 434 |
| 652 | 3300048918 | Ga0496115_0015008 | Ga0496115_0015008_507_1811 | 434 |
| 653 | 3300050491 | nmdc:mga00v17_7817_c1 | nmdc:mga00v17_7817_c1_3384_4700 | 434 |
| 654 | 3300050516 | nmdc:mga0sz30_3432_c1 | nmdc:mga0sz30_3432_c1_679_1995 | 434 |
| 655 | iso_pu_bacteria | 2558860112 | 2558912561 | 434 |
| 656 | iso_pu_bacteria | 2816332139 | 2816505739 | 434 |
| 657 | iso_pu_bacteria | 2863067949 | 2863070182 | 434 |
| 658 | iso_pu_bacteria | 2866552031 | 2866555713 | 434 |
| 659 | iso_pu_bacteria | 8054472261 | 8054474499 | 434 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cfb-assembly1.cif.gz_A-2 | glutamate-1-semialdehyde 2,1-aminomutase from thermosynechococcus elongatus | 0.9677 | 36 | 424 |
| 2hp1-assembly1.cif.gz_B | inter-subunit signaling in gsam | 0.9647 | 6 | 425 |
| 2hoy-assembly1.cif.gz_A | inter-subunit signaling in gsam | 0.9634 | 6 | 424 |
| 4gsa-assembly1.cif.gz_A | crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase) reduced with cyanoborohydrate | 0.9621 | 6 | 424 |
| 2hp1-assembly1.cif.gz_A | inter-subunit signaling in gsam | 0.961 | 4 | 425 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dvsA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9431 | 72 | 317 | 3.40.640.10 |
| 2gsaA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9405 | 72 | 317 | 3.40.640.10 |
| 2cfbA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9394 | 323 | 424 | 3.90.1150.10 |
| af_Q2G283_321_426_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9377 | 323 | 423 | 3.90.1150.10 |
| 4e77A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9372 | 72 | 317 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X3HJA9-F1-model_v4 | Glutamate-1-semialdehyde 2,1-aminomutase (Glutamate-1-semialdehyde aminotransferase) | 0.9716 | 7 | 143 |
GO:0008483
GO:0030170 GO:0042286 |
| AF-A0A378UW51-F1-model_v4 | Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8) | 0.971 | 226 | 431 |
GO:0008483
GO:0030170 GO:0042286 |
| AF-A0A7K2NRA2-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.9703 | 182 | 431 |
GO:0008483
GO:0030170 |
| AF-W7SXH3-F1-model_v4 | Glutamate-1-semialdehyde 2,1-aminomutase | 0.9678 | 168 | 431 |
GO:0008483
GO:0030170 |
| AF-A0A813BXZ7-F1-model_v4 | glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) | 0.9659 | 10 | 425 |
GO:0005247
GO:0006782 GO:0008483 GO:0016020 GO:0030170 GO:0042286 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar