F473131

General Info

Members Datasets Scaffolds Average Seq Length
657 252 1314 152

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0130249|Ga0501033_0130249_1340_1789
Length 149
Sequence VEQKGLRGSAPARIDDKGRLKVPTIFRTVIHDQQGPDVFVTSLTGECVRIYPMAVWLEIERKISTPGSHPSLLKFLDRVNYYGQTGELDDQGRIVIPAHLRSSASIVGDVRVFGRISYLEVWNDERFVQKLQREPWTDEDGLRLSEHGI

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
227 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
228 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 99.39
Stem 0
Stem Tuber 0
Unclassified 28.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0130249 3300049570 Bacteria 1823
2 JGI24749J21850_1025236 3300002076 Unclassified 847
3 JGI24033J26618_1050848 3300002155 Unclassified 594
4 JGI25406J46586_10015124 3300003203 Unclassified 3262
5 JGI25406J46586_10234660 3300003203 Bacteria 538
6 Ga0058859_11306900 3300004798 Bacteria 934
7 Ga0065714_10281948 3300005288 Unclassified 710
8 Ga0065704_10071765 3300005289 Bacteria 9984
9 Ga0065704_10111622 3300005289 Unclassified 1952
10 Ga0065712_10438045 3300005290 Unclassified 673
11 Ga0065707_10097643 3300005295 Bacteria 3156
12 Ga0065707_10193097 3300005295 Bacteria 1350
13 Ga0070658_10182282 3300005327 Bacteria 1767
14 Ga0070676_10071004 3300005328 Bacteria 2090
15 Ga0070676_10218500 3300005328 Bacteria 1258
16 Ga0070683_100072532 3300005329 Bacteria 3214
17 Ga0070683_101427232 3300005329 Unclassified 665
18 Ga0070690_100008259 3300005330 Bacteria 5989
19 Ga0070690_100227143 3300005330 Bacteria 1311
20 Ga0070670_100000967 3300005331 Bacteria 22560
21 Ga0070670_100053755 3300005331 Bacteria 3458
22 Ga0070670_100259182 3300005331 Unclassified 1516
23 Ga0070670_100734171 3300005331 Unclassified 889
24 Ga0070677_10616156 3300005333 Unclassified 603
25 Ga0068869_100097370 3300005334 Bacteria 2221
26 Ga0068869_100353969 3300005334 Bacteria 1197
27 Ga0068869_100503169 3300005334 Unclassified 1012
28 Ga0068869_100559492 3300005334 Bacteria 962
29 Ga0070666_10042068 3300005335 Bacteria 3056
30 Ga0070666_10442315 3300005335 Bacteria 938
31 Ga0070680_100118021 3300005336 Bacteria 2213
32 Ga0070680_100672144 3300005336 Bacteria 891
33 Ga0070680_101396549 3300005336 Bacteria 606
34 Ga0068868_100001154 3300005338 Bacteria 18097
35 Ga0068868_100078536 3300005338 Bacteria 2643
36 Ga0068868_100628832 3300005338 Bacteria 954
37 Ga0070660_100902978 3300005339 Unclassified 745
38 Ga0070689_100106783 3300005340 Unclassified 2222
39 Ga0070689_100239248 3300005340 Bacteria 1495
40 Ga0070689_100308549 3300005340 Bacteria 1319
41 Ga0070689_100822912 3300005340 Bacteria 818
42 Ga0070691_10063693 3300005341 Bacteria 1778
43 Ga0070687_100018003 3300005343 Bacteria 3260
44 Ga0070687_100053631 3300005343 Unclassified 2098
45 Ga0070687_100079117 3300005343 Bacteria 1788
46 Ga0070687_100234228 3300005343 Unclassified 1132
47 Ga0070661_100028198 3300005344 Unclassified 4048
48 Ga0070692_10001948 3300005345 Bacteria 7817
49 Ga0070692_10434890 3300005345 Bacteria 836
50 Ga0070692_10493889 3300005345 Bacteria 792
51 Ga0070692_10633164 3300005345 Unclassified 712
52 Ga0070668_100011612 3300005347 Bacteria 6558
53 Ga0070668_100401704 3300005347 Bacteria 1170
54 Ga0070669_100001131 3300005353 Bacteria 19486
55 Ga0070669_100005292 3300005353 Bacteria 9315
56 Ga0070669_100107569 3300005353 Bacteria 2113
57 Ga0070675_100003599 3300005354 Bacteria 11787
58 Ga0070675_100005236 3300005354 Bacteria 9898
59 Ga0070675_100028566 3300005354 Bacteria 4489
60 Ga0070675_100067630 3300005354 Bacteria 2957
61 Ga0070675_100435123 3300005354 Bacteria 1175
62 Ga0070675_101136520 3300005354 Unclassified 719
63 Ga0070671_100002291 3300005355 Bacteria 14774
64 Ga0070671_100036209 3300005355 Unclassified 4091
65 Ga0070671_100037221 3300005355 Bacteria 4035
66 Ga0070671_100331103 3300005355 Bacteria 1298
67 Ga0070674_100294936 3300005356 Bacteria 1290
68 Ga0070674_101242124 3300005356 Unclassified 663
69 Ga0070673_100020949 3300005364 Unclassified 4727
70 Ga0070673_100035259 3300005364 Bacteria 3792
71 Ga0070673_100053714 3300005364 Bacteria 3166
72 Ga0070673_100065578 3300005364 Bacteria 2897
73 Ga0070673_100094163 3300005364 Bacteria 2455
74 Ga0070673_100169052 3300005364 Bacteria 1865
75 Ga0070673_100338553 3300005364 Unclassified 1333
76 Ga0070673_100606518 3300005364 Bacteria 999
77 Ga0070688_100071472 3300005365 Bacteria 2222
78 Ga0070688_100110602 3300005365 Bacteria 1826
79 Ga0070688_100194221 3300005365 Unclassified 1416
80 Ga0070667_100000874 3300005367 Bacteria 27890
81 Ga0070667_100074661 3300005367 Bacteria 2893
82 Ga0070667_100573043 3300005367 Bacteria 1039
83 Ga0070701_10286981 3300005438 Unclassified 1007
84 Ga0070701_10399295 3300005438 Unclassified 871
85 Ga0070701_10408458 3300005438 Bacteria 862
86 Ga0070701_10848108 3300005438 Unclassified 627
87 Ga0070705_100089964 3300005440 Bacteria 1909
88 Ga0070705_100196300 3300005440 Bacteria 1380
89 Ga0070705_100541298 3300005440 Bacteria 891
90 Ga0070705_101014975 3300005440 Bacteria 674
91 Ga0070700_100005817 3300005441 Bacteria 6547
92 Ga0070700_100006394 3300005441 Bacteria 6296
93 Ga0070700_100139348 3300005441 Unclassified 1646
94 Ga0070700_100982322 3300005441 Bacteria 693
95 Ga0070700_101535284 3300005441 Unclassified 567
96 Ga0070694_100239688 3300005444 Unclassified 1368
97 Ga0070694_100420703 3300005444 Bacteria 1050
98 Ga0070694_100446125 3300005444 Unclassified 1021
99 Ga0070694_100551291 3300005444 Bacteria 923
100 Ga0070708_100758943 3300005445 Unclassified 912
101 Ga0070663_100481366 3300005455 Unclassified 1028
102 Ga0070678_100164490 3300005456 Bacteria 1801
103 Ga0070678_100328039 3300005456 Unclassified 1309
104 Ga0070678_100581720 3300005456 Bacteria 998
105 Ga0070678_100674316 3300005456 Unclassified 929
106 Ga0070662_100018620 3300005457 Bacteria 4701
107 Ga0070681_10342959 3300005458 Bacteria 1404
108 Ga0068867_100005370 3300005459 Bacteria 9060
109 Ga0068867_100007082 3300005459 Bacteria 7925
110 Ga0068867_100374395 3300005459 Bacteria 1195
111 Ga0068867_100663146 3300005459 Unclassified 916
112 Ga0070685_10164467 3300005466 Bacteria 1417
113 Ga0070685_11255541 3300005466 Bacteria 565
114 Ga0070698_100002994 3300005471 Bacteria 18609
115 Ga0070698_100053416 3300005471 Bacteria 4106
116 Ga0070698_100220017 3300005471 Unclassified 1832
117 Ga0070698_100452259 3300005471 Unclassified 1220
118 Ga0070698_100602832 3300005471 Bacteria 1039
119 Ga0070698_100660529 3300005471 Bacteria 987
120 Ga0070699_100000346 3300005518 Bacteria 44833
121 Ga0070699_100244644 3300005518 Unclassified 1602
122 Ga0070699_100598982 3300005518 Viruses 1005
123 Ga0070684_100090606 3300005535 Bacteria 2719
124 Ga0070697_101581467 3300005536 Bacteria 586
125 Ga0068853_100174434 3300005539 Unclassified 1947
126 Ga0070672_100002338 3300005543 Bacteria 11987
127 Ga0070672_100180198 3300005543 Bacteria 1760
128 Ga0070672_100260120 3300005543 Bacteria 1463
129 Ga0070672_100316468 3300005543 Bacteria 1326
130 Ga0070672_100347769 3300005543 Unclassified 1263
131 Ga0070672_100724746 3300005543 Unclassified 872
132 Ga0070686_100044130 3300005544 Bacteria 2800
133 Ga0070686_100053261 3300005544 Unclassified 2583
134 Ga0070686_100082173 3300005544 Unclassified 2136
135 Ga0070686_100180485 3300005544 Bacteria 1499
136 Ga0070686_100422260 3300005544 Bacteria 1019
137 Ga0070695_100215408 3300005545 Bacteria 1381
138 Ga0070695_100633621 3300005545 Bacteria 843
139 Ga0070695_100668311 3300005545 Unclassified 822
140 Ga0070695_100783514 3300005545 Bacteria 763
141 Ga0070696_100184000 3300005546 Bacteria 1551
142 Ga0070696_100277895 3300005546 Unclassified 1276
143 Ga0070696_100572694 3300005546 Unclassified 907
144 Ga0070696_100620226 3300005546 Bacteria 874
145 Ga0070693_100823941 3300005547 Unclassified 690
146 Ga0070665_101600533 3300005548 Unclassified 659
147 Ga0070704_100005803 3300005549 Bacteria 7223
148 Ga0070704_100026651 3300005549 Bacteria 3823
149 Ga0070704_100033903 3300005549 Bacteria 3457
150 Ga0070704_100114877 3300005549 Bacteria 2056
151 Ga0070704_100627339 3300005549 Bacteria 947
152 Ga0070664_100001791 3300005564 Bacteria 17231
153 Ga0070664_100139899 3300005564 Bacteria 2131
154 Ga0070664_100881471 3300005564 Unclassified 839
155 Ga0070664_101049440 3300005564 Unclassified 767
156 Ga0068857_100113644 3300005577 Bacteria 2435
157 Ga0068857_100479370 3300005577 Bacteria 1166
158 Ga0068857_100480729 3300005577 Bacteria 1164
159 Ga0068857_101393393 3300005577 Bacteria 682
160 Ga0068854_100017307 3300005578 Bacteria 4822
161 Ga0068854_100243881 3300005578 Bacteria 1432
162 Ga0068854_101192893 3300005578 Unclassified 682
163 Ga0070702_100020154 3300005615 Bacteria 3488
164 Ga0070702_100148063 3300005615 Bacteria 1504
165 Ga0068852_100886016 3300005616 Unclassified 909
166 Ga0068852_101246374 3300005616 Bacteria 765
167 Ga0068859_100014194 3300005617 Bacteria 7988
168 Ga0068859_100021478 3300005617 Bacteria 6480
169 Ga0068859_100167880 3300005617 Bacteria 2275
170 Ga0068859_100422996 3300005617 Unclassified 1428
171 Ga0068859_101330284 3300005617 Unclassified 792
172 Ga0068864_100028492 3300005618 Bacteria 4722
173 Ga0068864_100043301 3300005618 Bacteria 3854
174 Ga0068864_100065825 3300005618 Bacteria 3144
175 Ga0068864_100098916 3300005618 Bacteria 2584
176 Ga0068864_100749269 3300005618 Unclassified 957
177 Ga0068864_100882202 3300005618 Unclassified 883
178 Ga0068866_10029003 3300005718 Bacteria 2642
179 Ga0068866_10422990 3300005718 Bacteria 865
180 Ga0068861_100004154 3300005719 Bacteria 9714
181 Ga0068861_100278164 3300005719 Bacteria 1440
182 Ga0068861_100316935 3300005719 Bacteria 1357
183 Ga0068861_100580627 3300005719 Unclassified 1026
184 Ga0068861_100613608 3300005719 Bacteria 1000
185 Ga0068861_100771817 3300005719 Bacteria 900
186 Ga0068861_101049252 3300005719 Unclassified 781
187 Ga0068870_10004036 3300005840 Bacteria 6271
188 Ga0068870_10006336 3300005840 Bacteria 5212
189 Ga0068870_10282046 3300005840 Unclassified 1042
190 Ga0068870_10886978 3300005840 Unclassified 629
191 Ga0068863_100105627 3300005841 Bacteria 2679
192 Ga0068863_100284192 3300005841 Bacteria 1603
193 Ga0068863_100291983 3300005841 Bacteria 1580
194 Ga0068863_100985061 3300005841 Unclassified 845
195 Ga0068858_100042400 3300005842 Bacteria 4219
196 Ga0068858_100065645 3300005842 Unclassified 3358
197 Ga0068858_100105796 3300005842 Bacteria 2626
198 Ga0068860_100098111 3300005843 Bacteria 2794
199 Ga0068860_100468790 3300005843 Unclassified 1254
200 Ga0068862_100004806 3300005844 Bacteria 11375
201 Ga0068862_100382538 3300005844 Bacteria 1313
202 Ga0068862_100571302 3300005844 Unclassified 1082
203 Ga0068862_100757471 3300005844 Unclassified 945
204 Ga0068862_100934596 3300005844 Bacteria 854
205 Ga0068862_101090584 3300005844 Unclassified 793
206 Ga0081455_10313517 3300005937 Bacteria 1120
207 Ga0081539_10000093 3300005985 Bacteria 207314
208 Ga0081539_10003103 3300005985 Bacteria 21299
209 Ga0081539_10009296 3300005985 Bacteria 8252
210 Ga0075432_10054913 3300006058 Bacteria 1411
211 Ga0070715_10140008 3300006163 Bacteria 1174
212 Ga0097621_100008611 3300006237 Bacteria 7356
213 Ga0097621_100060282 3300006237 Unclassified 3110
214 Ga0068871_100349562 3300006358 Bacteria 1307
215 Ga0075428_100005450 3300006844 Bacteria 14145
216 Ga0075428_100009991 3300006844 Bacteria 10544
217 Ga0075428_100017801 3300006844 Bacteria 7850
218 Ga0075428_100021606 3300006844 Bacteria 7124
219 Ga0075428_100248242 3300006844 Bacteria 1918
220 Ga0075428_100298251 3300006844 Bacteria 1733
221 Ga0075428_100302059 3300006844 Bacteria 1721
222 Ga0075428_101289245 3300006844 Unclassified 768
223 Ga0075428_101448636 3300006844 Unclassified 720
224 Ga0075430_100003023 3300006846 Bacteria 14074
225 Ga0075430_100013797 3300006846 Bacteria 6884
226 Ga0075430_100028644 3300006846 Unclassified 4731
227 Ga0075431_100209217 3300006847 Unclassified 1993
228 Ga0075431_100303935 3300006847 Archaea 1611
229 Ga0075433_10002985 3300006852 Bacteria 12993
230 Ga0075433_10004390 3300006852 Bacteria 10969
231 Ga0075433_10185718 3300006852 Bacteria 1850
232 Ga0075433_10207798 3300006852 Bacteria 1740
233 Ga0075433_10571732 3300006852 Unclassified 993
234 Ga0075433_10932579 3300006852 Unclassified 757
235 Ga0075433_11257827 3300006852 Unclassified 642
236 Ga0075434_100008333 3300006871 Bacteria 9631
237 Ga0075434_100015195 3300006871 Bacteria 7376
238 Ga0075434_100054690 3300006871 Bacteria 3965
239 Ga0075434_100223055 3300006871 Bacteria 1905
240 Ga0075429_100008167 3300006880 Bacteria 9099
241 Ga0075429_100011555 3300006880 Bacteria 7658
242 Ga0075429_100020196 3300006880 Bacteria 5777
243 Ga0075429_100041572 3300006880 Bacteria 4004
244 Ga0075429_100121183 3300006880 Bacteria 2286
245 Ga0075429_100213654 3300006880 Bacteria 1690
246 Ga0068865_100014141 3300006881 Bacteria 5066
247 Ga0068865_100146426 3300006881 Bacteria 1787
248 Ga0068865_100286264 3300006881 Unclassified 1314
249 Ga0068865_100835350 3300006881 Unclassified 797
250 Ga0097620_100014195 3300006931 Bacteria 7988
251 Ga0097620_100021477 3300006931 Bacteria 6480
252 Ga0097620_100167876 3300006931 Bacteria 2275
253 Ga0097620_100422988 3300006931 Unclassified 1428
254 Ga0097620_101330232 3300006931 Unclassified 792
255 Ga0075435_100649884 3300007076 Bacteria 915
256 Ga0099795_10244254 3300007788 Bacteria 772
257 Ga0111539_10002949 3300009094 Bacteria 22579
258 Ga0111539_10008296 3300009094 Bacteria 13224
259 Ga0111539_10055282 3300009094 Bacteria 4718
260 Ga0111539_10144509 3300009094 Bacteria 2785
261 Ga0111539_10151718 3300009094 Bacteria 2712
262 Ga0111539_11825405 3300009094 Unclassified 705
263 Ga0105245_10425107 3300009098 Bacteria 1332
264 Ga0105245_10635105 3300009098 Bacteria 1097
265 Ga0105247_10654734 3300009101 Unclassified 785
266 Ga0105247_10999342 3300009101 Unclassified 653
267 Ga0105247_11159070 3300009101 Unclassified 613
268 Ga0114129_10002512 3300009147 Bacteria 25458
269 Ga0114129_10006480 3300009147 Bacteria 16606
270 Ga0114129_10020166 3300009147 Bacteria 9488
271 Ga0114129_10058280 3300009147 Bacteria 5402
272 Ga0114129_10081552 3300009147 Bacteria 4496
273 Ga0114129_10513828 3300009147 Bacteria 1563
274 Ga0114129_10602392 3300009147 Bacteria 1423
275 Ga0114129_11311444 3300009147 Bacteria 897
276 Ga0114129_11435045 3300009147 Bacteria 850
277 Ga0105243_10019452 3300009148 Bacteria 5149
278 Ga0105243_10306392 3300009148 Bacteria 1441
279 Ga0105243_10321770 3300009148 Bacteria 1410
280 Ga0105243_11868995 3300009148 Unclassified 633
281 Ga0105241_10763259 3300009174 Bacteria 888
282 Ga0105242_10030024 3300009176 Bacteria 4339
283 Ga0105242_10314064 3300009176 Bacteria 1435
284 Ga0105242_11509897 3300009176 Unclassified 703
285 Ga0105248_10042363 3300009177 Bacteria 5106
286 Ga0105248_10202348 3300009177 Bacteria 2237
287 Ga0105248_10791025 3300009177 Bacteria 1070
288 Ga0105238_10088527 3300009551 Bacteria 3082
289 Ga0105238_11898322 3300009551 Unclassified 628
290 Ga0105249_10075681 3300009553 Bacteria 3118
291 Ga0105249_10294424 3300009553 Bacteria 1626
292 Ga0105249_11411517 3300009553 Unclassified 768
293 Ga0105249_12245646 3300009553 Unclassified 618
294 Ga0105246_10117410 3300011119 Bacteria 1965
295 Ga0105246_10488632 3300011119 Bacteria 1043
296 Ga0157374_10115157 3300013296 Unclassified 2589
297 Ga0157374_10689506 3300013296 Bacteria 1034
298 Ga0157378_10183642 3300013297 Bacteria 1969
299 Ga0157378_11826712 3300013297 Unclassified 656
300 Ga0157378_11899019 3300013297 Bacteria 644
301 Ga0163162_10566760 3300013306 Bacteria 1263
302 Ga0163162_10781136 3300013306 Bacteria 1073
303 Ga0157375_10001140 3300013308 Bacteria 23009
304 Ga0157375_10016504 3300013308 Bacteria 6637
305 Ga0157375_10141363 3300013308 Bacteria 2534
306 Ga0157375_10477989 3300013308 Bacteria 1411
307 Ga0157375_10498893 3300013308 Bacteria 1381
308 Ga0157375_11623558 3300013308 Unclassified 765
309 Ga0163163_10049091 3300014325 Bacteria 4152
310 Ga0163163_10064132 3300014325 Bacteria 3645
311 Ga0163163_10763121 3300014325 Unclassified 1030
312 Ga0163163_11405773 3300014325 Bacteria 759
313 Ga0163163_12337359 3300014325 Unclassified 593
314 Ga0157380_10162042 3300014326 Bacteria 1945
315 Ga0157380_10255773 3300014326 Bacteria 1588
316 Ga0157380_10311654 3300014326 Unclassified 1455
317 Ga0157380_10379793 3300014326 Unclassified 1333
318 Ga0157380_10403723 3300014326 Bacteria 1297
319 Ga0157380_10414134 3300014326 Bacteria 1283
320 Ga0157380_10743691 3300014326 Bacteria 991
321 Ga0157380_10878301 3300014326 Unclassified 921
322 Ga0157380_11046985 3300014326 Bacteria 852
323 Ga0157377_10019480 3300014745 Bacteria 3546
324 Ga0157377_10030696 3300014745 Bacteria 2913
325 Ga0157377_10161386 3300014745 Bacteria 1394
326 Ga0157377_10565726 3300014745 Bacteria 805
327 Ga0157377_10825256 3300014745 Unclassified 686
328 Ga0157379_10086776 3300014968 Bacteria 2806
329 Ga0157379_10193032 3300014968 Bacteria 1840
330 Ga0157379_10757221 3300014968 Bacteria 915
331 Ga0157379_11010118 3300014968 Unclassified 793
332 Ga0157376_10131979 3300014969 Bacteria 2230
333 Ga0157376_10396491 3300014969 Bacteria 1333
334 Ga0163161_10293999 3300017792 Bacteria 1277
335 Ga0163161_10327674 3300017792 Unclassified 1212
336 Ga0207666_1039808 3300025271 Unclassified 734
337 Ga0207653_10215511 3300025885 Bacteria 728
338 Ga0207682_10015369 3300025893 Unclassified 2979
339 Ga0207682_10057484 3300025893 Bacteria 1622
340 Ga0207642_10005777 3300025899 Bacteria 4067
341 Ga0207642_10244520 3300025899 Bacteria 1015
342 Ga0207688_10088323 3300025901 Unclassified 1778
343 Ga0207680_10068799 3300025903 Bacteria 2185
344 Ga0207680_10240501 3300025903 Bacteria 1247
345 Ga0207680_10294889 3300025903 Bacteria 1129
346 Ga0207680_10720175 3300025903 Unclassified 715
347 Ga0207645_10022058 3300025907 Bacteria 4148
348 Ga0207645_10035883 3300025907 Bacteria 3183
349 Ga0207645_10104508 3300025907 Bacteria 1829
350 Ga0207645_10136347 3300025907 Unclassified 1598
351 Ga0207645_10327414 3300025907 Unclassified 1023
352 Ga0207643_10006771 3300025908 Bacteria 6147
353 Ga0207643_10039970 3300025908 Bacteria 2639
354 Ga0207643_10146853 3300025908 Bacteria 1411
355 Ga0207643_10151041 3300025908 Unclassified 1392
356 Ga0207643_10229929 3300025908 Unclassified 1137
357 Ga0207643_10250859 3300025908 Bacteria 1090
358 Ga0207705_10172502 3300025909 Bacteria 1629
359 Ga0207654_10601568 3300025911 Bacteria 784
360 Ga0207707_10645978 3300025912 Unclassified 892
361 Ga0207693_10245428 3300025915 Bacteria 1405
362 Ga0207660_10316151 3300025917 Bacteria 1246
363 Ga0207660_10769976 3300025917 Bacteria 785
364 Ga0207662_10025161 3300025918 Bacteria 3427
365 Ga0207662_10047922 3300025918 Unclassified 2531
366 Ga0207662_10061724 3300025918 Unclassified 2251
367 Ga0207662_10074696 3300025918 Bacteria 2058
368 Ga0207662_10251737 3300025918 Bacteria 1160
369 Ga0207657_10583476 3300025919 Bacteria 873
370 Ga0207649_10011260 3300025920 Unclassified 4927
371 Ga0207649_10804355 3300025920 Unclassified 734
372 Ga0207681_10000808 3300025923 Bacteria 20616
373 Ga0207681_10008481 3300025923 Bacteria 6280
374 Ga0207681_10017086 3300025923 Bacteria 4552
375 Ga0207681_10021640 3300025923 Bacteria 4091
376 Ga0207694_10076958 3300025924 Bacteria 2613
377 Ga0207694_10435434 3300025924 Bacteria 1093
378 Ga0207650_10003205 3300025925 Bacteria 11284
379 Ga0207650_10704450 3300025925 Unclassified 853
380 Ga0207650_11793782 3300025925 Unclassified 519
381 Ga0207659_10002812 3300025926 Bacteria 10376
382 Ga0207659_10004134 3300025926 Bacteria 8761
383 Ga0207659_10010099 3300025926 Bacteria 5917
384 Ga0207659_10033856 3300025926 Bacteria 3520
385 Ga0207659_10064871 3300025926 Bacteria 2645
386 Ga0207659_10393879 3300025926 Unclassified 1157
387 Ga0207659_10699552 3300025926 Bacteria 868
388 Ga0207687_10096335 3300025927 Bacteria 2168
389 Ga0207700_10002261 3300025928 Bacteria 11058
390 Ga0207644_10031474 3300025931 Bacteria 3696
391 Ga0207644_10033567 3300025931 Unclassified 3587
392 Ga0207644_10051175 3300025931 Bacteria 2964
393 Ga0207690_10654580 3300025932 Unclassified 861
394 Ga0207706_10011236 3300025933 Bacteria 8165
395 Ga0207706_10170550 3300025933 Bacteria 1912
396 Ga0207686_10004699 3300025934 Bacteria 7322
397 Ga0207709_10010088 3300025935 Bacteria 5202
398 Ga0207709_10195264 3300025935 Bacteria 1441
399 Ga0207709_10721056 3300025935 Unclassified 799
400 Ga0207670_10001732 3300025936 Bacteria 11390
401 Ga0207670_10078783 3300025936 Bacteria 2299
402 Ga0207670_10147587 3300025936 Bacteria 1741
403 Ga0207670_10160614 3300025936 Bacteria 1677
404 Ga0207670_10696855 3300025936 Bacteria 840
405 Ga0207669_10525805 3300025937 Unclassified 951
406 Ga0207704_10002597 3300025938 Bacteria 8149
407 Ga0207704_10190073 3300025938 Unclassified 1493
408 Ga0207704_10429905 3300025938 Unclassified 1049
409 Ga0207691_10016385 3300025940 Bacteria 7035
410 Ga0207691_10103381 3300025940 Bacteria 2540
411 Ga0207691_10134452 3300025940 Bacteria 2183
412 Ga0207691_10186689 3300025940 Unclassified 1809
413 Ga0207691_10198837 3300025940 Bacteria 1745
414 Ga0207691_10291137 3300025940 Unclassified 1404
415 Ga0207691_10302261 3300025940 Bacteria 1375
416 Ga0207691_10357699 3300025940 Bacteria 1248
417 Ga0207691_10408049 3300025940 Bacteria 1158
418 Ga0207691_10571195 3300025940 Bacteria 958
419 Ga0207691_10760361 3300025940 Bacteria 815
420 Ga0207711_10008451 3300025941 Bacteria 8611
421 Ga0207711_10164948 3300025941 Bacteria 2007
422 Ga0207711_10541099 3300025941 Bacteria 1086
423 Ga0207711_10944810 3300025941 Unclassified 801
424 Ga0207689_10001675 3300025942 Bacteria 21042
425 Ga0207689_10121175 3300025942 Bacteria 2152
426 Ga0207689_10148087 3300025942 Bacteria 1934
427 Ga0207689_10399909 3300025942 Bacteria 1145
428 Ga0207689_10496726 3300025942 Unclassified 1022
429 Ga0207661_10155084 3300025944 Bacteria 1983
430 Ga0207661_10469120 3300025944 Unclassified 1148
431 Ga0207679_10006393 3300025945 Bacteria 7442
432 Ga0207679_10463364 3300025945 Bacteria 1126
433 Ga0207679_10520742 3300025945 Unclassified 1063
434 Ga0207679_10941234 3300025945 Unclassified 791
435 Ga0207651_10016361 3300025960 Bacteria 4342
436 Ga0207651_10099002 3300025960 Bacteria 2158
437 Ga0207651_10119701 3300025960 Unclassified 1994
438 Ga0207651_10499219 3300025960 Bacteria 1051
439 Ga0207651_10823315 3300025960 Unclassified 824
440 Ga0207712_10063609 3300025961 Bacteria 2627
441 Ga0207712_10436408 3300025961 Unclassified 1108
442 Ga0207668_10008478 3300025972 Bacteria 6131
443 Ga0207668_10081904 3300025972 Bacteria 2343
444 Ga0207640_10004703 3300025981 Bacteria 7414
445 Ga0207640_10617982 3300025981 Unclassified 919
446 Ga0207658_10010096 3300025986 Bacteria 6413
447 Ga0207658_10077668 3300025986 Bacteria 2534
448 Ga0207658_10348445 3300025986 Bacteria 1289
449 Ga0207677_10010336 3300026023 Bacteria 5278
450 Ga0207677_10230418 3300026023 Bacteria 1492
451 Ga0207677_10507675 3300026023 Unclassified 1044
452 Ga0207677_11897131 3300026023 Unclassified 553
453 Ga0207703_10038461 3300026035 Unclassified 3818
454 Ga0207703_10044024 3300026035 Bacteria 3585
455 Ga0207703_10101827 3300026035 Bacteria 2436
456 Ga0207703_10125576 3300026035 Unclassified 2208
457 Ga0207703_10630835 3300026035 Bacteria 1015
458 Ga0207639_10417381 3300026041 Bacteria 1212
459 Ga0207678_10506344 3300026067 Unclassified 1053
460 Ga0207708_10005103 3300026075 Bacteria 9688
461 Ga0207708_10010273 3300026075 Bacteria 6949
462 Ga0207708_10045986 3300026075 Bacteria 3325
463 Ga0207708_10149826 3300026075 Bacteria 1835
464 Ga0207708_10573270 3300026075 Bacteria 954
465 Ga0207708_10619497 3300026075 Bacteria 918
466 Ga0207708_11267140 3300026075 Unclassified 645
467 Ga0207708_11529075 3300026075 Unclassified 586
468 Ga0207641_10074623 3300026088 Unclassified 2926
469 Ga0207641_10117729 3300026088 Bacteria 2366
470 Ga0207641_10140425 3300026088 Bacteria 2179
471 Ga0207641_10626082 3300026088 Bacteria 1055
472 Ga0207641_10867943 3300026088 Unclassified 895
473 Ga0207648_10000821 3300026089 Bacteria 35108
474 Ga0207648_10013935 3300026089 Bacteria 7455
475 Ga0207648_10039419 3300026089 Bacteria 4155
476 Ga0207648_10512129 3300026089 Bacteria 1099
477 Ga0207648_10555160 3300026089 Bacteria 1055
478 Ga0207676_10025460 3300026095 Bacteria 4390
479 Ga0207676_10041108 3300026095 Unclassified 3546
480 Ga0207676_10184142 3300026095 Bacteria 1831
481 Ga0207676_10453428 3300026095 Bacteria 1209
482 Ga0207676_10606196 3300026095 Unclassified 1052
483 Ga0207674_10122112 3300026116 Bacteria 2571
484 Ga0207674_10131607 3300026116 Bacteria 2464
485 Ga0207675_100004831 3300026118 Bacteria 12978
486 Ga0207675_100013814 3300026118 Bacteria 7530
487 Ga0207675_100052920 3300026118 Bacteria 3788
488 Ga0207675_100114431 3300026118 Bacteria 2548
489 Ga0207675_100214993 3300026118 Unclassified 1850
490 Ga0207675_100692887 3300026118 Unclassified 1027
491 Ga0207675_101160980 3300026118 Unclassified 792
492 Ga0207683_10082995 3300026121 Bacteria 2848
493 Ga0207683_10117126 3300026121 Unclassified 2389
494 Ga0207683_10459318 3300026121 Unclassified 1174
495 Ga0207683_10824177 3300026121 Bacteria 861
496 Ga0207698_10349860 3300026142 Unclassified 1395
497 Ga0209968_1045523 3300027526 Bacteria 755
498 Ga0207428_10000481 3300027907 Bacteria 48194
499 Ga0207428_10000970 3300027907 Bacteria 31814
500 Ga0207428_10056353 3300027907 Bacteria 3123
501 Ga0207428_10170966 3300027907 Unclassified 1646
502 Ga0268266_10542432 3300028379 Unclassified 1114
503 Ga0268265_10001312 3300028380 Bacteria 21329
504 Ga0268265_10075093 3300028380 Bacteria 2647
505 Ga0268265_10100289 3300028380 Bacteria 2337
506 Ga0268265_10829355 3300028380 Bacteria 903
507 Ga0268265_10962645 3300028380 Unclassified 841
508 Ga0268265_11147408 3300028380 Bacteria 773
509 Ga0268265_11625439 3300028380 Unclassified 651
510 Ga0268264_10006226 3300028381 Bacteria 10069
511 Ga0268264_10103656 3300028381 Bacteria 2478
512 Ga0268264_10295955 3300028381 Unclassified 1522
513 Ga0307405_10000373 3300031731 Bacteria 16766
514 Ga0307413_10005717 3300031824 Bacteria 5588
515 Ga0307407_10017230 3300031903 Bacteria 3618
516 Ga0307412_10599294 3300031911 Bacteria 933
517 Ga0307409_100001999 3300031995 Bacteria 10458
518 Ga0307416_100004987 3300032002 Bacteria 8096
519 Ga0307416_100301358 3300032002 Bacteria 1593
520 Ga0307416_102768685 3300032002 Unclassified 586
521 Ga0307416_103712252 3300032002 Bacteria 511
522 Ga0307414_10303691 3300032004 Bacteria 1351
523 Ga0307414_11052975 3300032004 Unclassified 750
524 Ga0307411_10000802 3300032005 Bacteria 11716
525 Ga0307411_11247972 3300032005 Unclassified 675
526 Ga0307415_100004066 3300032126 Bacteria 7545
527 Ga0307415_101553850 3300032126 Unclassified 634
528 Ga0373959_0015313 3300034820 Unclassified 1407
529 Ga0373932_0163765 3300035112 Unclassified 771
530 Ga0373939_0059451 3300035114 Bacteria 1212
531 Ga0373941_0164965 3300035115 Bacteria 822
532 Ga0373961_0107096 3300035241 Bacteria 912
533 Ga0451807_0921254 3300041486 Bacteria 959
534 Ga0439433_0026136 3300041999 Bacteria 1321
535 Ga0450920_076491 3300042122 Unclassified 683
536 Ga0439446_0227042 3300042156 Bacteria 638
537 Ga0439434_0114643 3300042435 Unclassified 875
538 Ga0439435_0113912 3300042436 Unclassified 842
539 Ga0451576_0025664 3300045051 Bacteria 6348
540 Ga0451576_1033293 3300045051 Unclassified 861
541 Ga0495603_0031048 3300046455 Bacteria 3216
542 Ga0495603_0069347 3300046455 Bacteria 2074
543 Ga0495629_0006203 3300046459 Bacteria 8872
544 Ga0495629_0091396 3300046459 Bacteria 2124
545 Ga0495580_0204194 3300046472 Unclassified 1361
546 Ga0495582_0132244 3300046473 Bacteria 1410
547 Ga0495639_0014203 3300046475 Unclassified 3447
548 Ga0495662_0076730 3300046476 Bacteria 1623
549 Ga0495630_0957077 3300046517 Unclassified 651
550 Ga0495643_0005513 3300046522 Bacteria 8540
551 Ga0495598_0009727 3300046537 Bacteria 2283
552 Ga0495598_0103795 3300046537 Bacteria 944
553 Ga0495621_0013691 3300046539 Bacteria 2553
554 Ga0495621_0122556 3300046539 Bacteria 1006
555 Ga0495622_0141061 3300046557 Bacteria 1094
556 Ga0495633_0290060 3300046558 Unclassified 744
557 Ga0495656_0124054 3300046615 Bacteria 1222
558 Ga0495635_1015473 3300046663 Unclassified 527
559 Ga0495659_0297277 3300046664 Unclassified 681
560 Ga0495658_0031816 3300046683 Bacteria 2876
561 Ga0495669_0011491 3300046684 Bacteria 3759
562 Ga0495670_0156981 3300046691 Bacteria 1194
563 Ga0495670_0569153 3300046691 Unclassified 617
564 Ga0495636_0138170 3300047318 Unclassified 1087
565 Ga0495677_0023572 3300047445 Bacteria 2234
566 Ga0495677_0223705 3300047445 Unclassified 733
567 Ga0496107_0971959 3300048910 Unclassified 617
568 Ga0496110_1516892 3300048913 Unclassified 580
569 Ga0501290_059565 3300049513 Unclassified 612
570 Ga0501036_0073556 3300049572 Bacteria 2889
571 Ga0501036_0230382 3300049572 Bacteria 1555
572 Ga0501037_0122483 3300049573 Bacteria 1869
573 Ga0501038_0100938 3300049574 Bacteria 2403
574 Ga0501039_0023930 3300049575 Bacteria 4689
575 Ga0501039_0068292 3300049575 Bacteria 2760
576 Ga0501040_0019567 3300049576 Bacteria 4505
577 Ga0501041_0070777 3300049577 Bacteria 2141
578 Ga0501041_0084100 3300049577 Bacteria 1961
579 Ga0501042_0018062 3300049578 Bacteria 4878
580 Ga0501042_0020239 3300049578 Bacteria 4630
581 Ga0501046_0041837 3300049580 Bacteria 3655
582 Ga0501046_0814032 3300049580 Unclassified 654
583 Ga0501068_0145437 3300049584 Bacteria 1488
584 Ga0501071_0049305 3300049587 Bacteria 3031
585 Ga0501071_0098767 3300049587 Bacteria 2151
586 Ga0501072_0008960 3300049588 Bacteria 7607
587 Ga0501072_0168500 3300049588 Unclassified 1748
588 Ga0501073_0369955 3300049589 Bacteria 990
589 Ga0501074_0036836 3300049590 Bacteria 3544
590 Ga0501075_0097748 3300049591 Bacteria 2228
591 Ga0501075_0108498 3300049591 Bacteria 2110
592 Ga0501075_0412269 3300049591 Bacteria 1030
593 Ga0501076_0232413 3300049592 Bacteria 1507
594 Ga0501077_0783528 3300049593 Unclassified 613
595 Ga0501202_115559 3300049652 Bacteria 669
596 Ga0501208_024244 3300049655 Bacteria 1022
597 Ga0501233_030548 3300049668 Bacteria 1215
598 Ga0501247_053533 3300049677 Bacteria 604
599 Ga0501249_030948 3300049679 Bacteria 1193
600 Ga0501079_0013615 3300049741 Bacteria 6204
601 Ga0501080_0156096 3300049742 Bacteria 2108
602 Ga0501081_0009011 3300049743 Bacteria 6486
603 Ga0501262_095629 3300049759 Bacteria 507
604 Ga0501283_042187 3300049779 Bacteria 792
605 Ga0501035_1042651 3300049822 Unclassified 641
606 Ga0501204_090005 3300049850 Unclassified 534
607 nmdc:mga05p37_1033_c1 3300050507 Bacteria 31719
608 nmdc:mga05p37_132646_c1 3300050507 Bacteria 3056
609 nmdc:mga05p37_1358601_c1 3300050507 Unclassified 719
610 nmdc:mga05p37_21351_c1 3300050507 Bacteria 7841
611 nmdc:mga05p37_27001_c1 3300050507 Bacteria 6987
612 nmdc:mga05p37_38368_c1 3300050507 Bacteria 5875
613 nmdc:mga05p37_397353_c1 3300050507 Bacteria 1610
614 nmdc:mga05p37_468125_c1 3300050507 Bacteria 1455
615 nmdc:mga05p37_496087_c1 3300050507 Bacteria 1403
616 nmdc:mga05p37_636104_c1 3300050507 Bacteria 1198
617 nmdc:mga09592_11525_c1 3300050508 Bacteria 7193
618 nmdc:mga09592_131667_c1 3300050508 Bacteria 2152
619 nmdc:mga09592_153835_c1 3300050508 Bacteria 1985
620 nmdc:mga09592_185942_c1 3300050508 Bacteria 1798
621 nmdc:mga09592_48273_c1 3300050508 Bacteria 3589
622 nmdc:mga09592_48348_c1 3300050508 Bacteria 3586
623 nmdc:mga0qj67_115828_c1 3300050509 Bacteria 2166
624 nmdc:mga0qj67_116314_c1 3300050509 Bacteria 2161
625 nmdc:mga06r32_1619788_c1 3300050510 Unclassified 586
626 nmdc:mga06r32_413294_c1 3300050510 Unclassified 1331
627 nmdc:mga06r32_45223_c1 3300050510 Bacteria 4196
628 nmdc:mga06r32_65525_c1 3300050510 Bacteria 3504
629 nmdc:mga08y16_1215_c1 3300050511 Bacteria 25486
630 nmdc:mga08y16_13461_c1 3300050511 Bacteria 8607
631 nmdc:mga08y16_14693_c1 3300050511 Bacteria 8231
632 nmdc:mga08y16_1646_c1 3300050511 Bacteria 22621
633 nmdc:mga08y16_5683_c1 3300050511 Bacteria 13067
634 nmdc:mga08y16_573188_c1 3300050511 Unclassified 1140
635 nmdc:mga08y16_821661_c1 3300050511 Bacteria 921
636 nmdc:mga08y16_98651_c1 3300050511 Bacteria 3042
637 nmdc:mga0n895_1316_c1 3300050512 Bacteria 18393
638 nmdc:mga0rr50_70205_c1 3300050513 Bacteria 2669
639 nmdc:mga08x19_710466_c1 3300050514 Unclassified 713
640 nmdc:mga0a205_1529_c1 3300050515 Bacteria 19766
641 nmdc:mga0a205_1881_c1 3300050515 Bacteria 18198
642 nmdc:mga0a205_308785_c1 3300050515 Bacteria 1454
643 nmdc:mga0a205_818119_c1 3300050515 Unclassified 779
644 nmdc:mga0a205_863929_c1 3300050515 Bacteria 752
645 nmdc:mga0a205_95165_c1 3300050515 Bacteria 2877
646 nmdc:mga0a205_971242_c1 3300050515 Unclassified 696
647 Ga0501084_0106447 3300054114 Bacteria 2356
648 Ga0501084_0547156 3300054114 Bacteria 978
649 Ga0590071_000286 3300059421 Bacteria 14746
650 Ga0590074_005354 3300059423 Bacteria 2124
651 Ga0590075_003143 3300059424 Bacteria 3927
652 Ga0590077_000879 3300059426 Bacteria 7697
653 Ga0501082_0141124 3300060353 Bacteria 2091
654 Ga0501082_0264201 3300060353 Bacteria 1497
655 Ga0501082_1339368 3300060353 Unclassified 625
656 Ga0530510_0002864 3300061734 Bacteria 11858
657 Ga0530510_0215550 3300061734 Bacteria 1426
658 Ga0501033_0130249
659 JGI24749J21850_1025236
660 JGI24033J26618_1050848
661 JGI25406J46586_10015124
662 JGI25406J46586_10234660
663 Ga0058859_11306900
664 Ga0065714_10281948
665 Ga0065704_10071765
666 Ga0065704_10111622
667 Ga0065712_10438045
668 Ga0065707_10097643
669 Ga0065707_10193097
670 Ga0070658_10182282
671 Ga0070676_10071004
672 Ga0070676_10218500
673 Ga0070683_100072532
674 Ga0070683_101427232
675 Ga0070690_100008259
676 Ga0070690_100227143
677 Ga0070670_100000967
678 Ga0070670_100053755
679 Ga0070670_100259182
680 Ga0070670_100734171
681 Ga0070677_10616156
682 Ga0068869_100097370
683 Ga0068869_100353969
684 Ga0068869_100503169
685 Ga0068869_100559492
686 Ga0070666_10042068
687 Ga0070666_10442315
688 Ga0070680_100118021
689 Ga0070680_100672144
690 Ga0070680_101396549
691 Ga0068868_100001154
692 Ga0068868_100078536
693 Ga0068868_100628832
694 Ga0070660_100902978
695 Ga0070689_100106783
696 Ga0070689_100239248
697 Ga0070689_100308549
698 Ga0070689_100822912
699 Ga0070691_10063693
700 Ga0070687_100018003
701 Ga0070687_100053631
702 Ga0070687_100079117
703 Ga0070687_100234228
704 Ga0070661_100028198
705 Ga0070692_10001948
706 Ga0070692_10434890
707 Ga0070692_10493889
708 Ga0070692_10633164
709 Ga0070668_100011612
710 Ga0070668_100401704
711 Ga0070669_100001131
712 Ga0070669_100005292
713 Ga0070669_100107569
714 Ga0070675_100003599
715 Ga0070675_100005236
716 Ga0070675_100028566
717 Ga0070675_100067630
718 Ga0070675_100435123
719 Ga0070675_101136520
720 Ga0070671_100002291
721 Ga0070671_100036209
722 Ga0070671_100037221
723 Ga0070671_100331103
724 Ga0070674_100294936
725 Ga0070674_101242124
726 Ga0070673_100020949
727 Ga0070673_100035259
728 Ga0070673_100053714
729 Ga0070673_100065578
730 Ga0070673_100094163
731 Ga0070673_100169052
732 Ga0070673_100338553
733 Ga0070673_100606518
734 Ga0070688_100071472
735 Ga0070688_100110602
736 Ga0070688_100194221
737 Ga0070667_100000874
738 Ga0070667_100074661
739 Ga0070667_100573043
740 Ga0070701_10286981
741 Ga0070701_10399295
742 Ga0070701_10408458
743 Ga0070701_10848108
744 Ga0070705_100089964
745 Ga0070705_100196300
746 Ga0070705_100541298
747 Ga0070705_101014975
748 Ga0070700_100005817
749 Ga0070700_100006394
750 Ga0070700_100139348
751 Ga0070700_100982322
752 Ga0070700_101535284
753 Ga0070694_100239688
754 Ga0070694_100420703
755 Ga0070694_100446125
756 Ga0070694_100551291
757 Ga0070708_100758943
758 Ga0070663_100481366
759 Ga0070678_100164490
760 Ga0070678_100328039
761 Ga0070678_100581720
762 Ga0070678_100674316
763 Ga0070662_100018620
764 Ga0070681_10342959
765 Ga0068867_100005370
766 Ga0068867_100007082
767 Ga0068867_100374395
768 Ga0068867_100663146
769 Ga0070685_10164467
770 Ga0070685_11255541
771 Ga0070698_100002994
772 Ga0070698_100053416
773 Ga0070698_100220017
774 Ga0070698_100452259
775 Ga0070698_100602832
776 Ga0070698_100660529
777 Ga0070699_100000346
778 Ga0070699_100244644
779 Ga0070699_100598982
780 Ga0070684_100090606
781 Ga0070697_101581467
782 Ga0068853_100174434
783 Ga0070672_100002338
784 Ga0070672_100180198
785 Ga0070672_100260120
786 Ga0070672_100316468
787 Ga0070672_100347769
788 Ga0070672_100724746
789 Ga0070686_100044130
790 Ga0070686_100053261
791 Ga0070686_100082173
792 Ga0070686_100180485
793 Ga0070686_100422260
794 Ga0070695_100215408
795 Ga0070695_100633621
796 Ga0070695_100668311
797 Ga0070695_100783514
798 Ga0070696_100184000
799 Ga0070696_100277895
800 Ga0070696_100572694
801 Ga0070696_100620226
802 Ga0070693_100823941
803 Ga0070665_101600533
804 Ga0070704_100005803
805 Ga0070704_100026651
806 Ga0070704_100033903
807 Ga0070704_100114877
808 Ga0070704_100627339
809 Ga0070664_100001791
810 Ga0070664_100139899
811 Ga0070664_100881471
812 Ga0070664_101049440
813 Ga0068857_100113644
814 Ga0068857_100479370
815 Ga0068857_100480729
816 Ga0068857_101393393
817 Ga0068854_100017307
818 Ga0068854_100243881
819 Ga0068854_101192893
820 Ga0070702_100020154
821 Ga0070702_100148063
822 Ga0068852_100886016
823 Ga0068852_101246374
824 Ga0068859_100014194
825 Ga0068859_100021478
826 Ga0068859_100167880
827 Ga0068859_100422996
828 Ga0068859_101330284
829 Ga0068864_100028492
830 Ga0068864_100043301
831 Ga0068864_100065825
832 Ga0068864_100098916
833 Ga0068864_100749269
834 Ga0068864_100882202
835 Ga0068866_10029003
836 Ga0068866_10422990
837 Ga0068861_100004154
838 Ga0068861_100278164
839 Ga0068861_100316935
840 Ga0068861_100580627
841 Ga0068861_100613608
842 Ga0068861_100771817
843 Ga0068861_101049252
844 Ga0068870_10004036
845 Ga0068870_10006336
846 Ga0068870_10282046
847 Ga0068870_10886978
848 Ga0068863_100105627
849 Ga0068863_100284192
850 Ga0068863_100291983
851 Ga0068863_100985061
852 Ga0068858_100042400
853 Ga0068858_100065645
854 Ga0068858_100105796
855 Ga0068860_100098111
856 Ga0068860_100468790
857 Ga0068862_100004806
858 Ga0068862_100382538
859 Ga0068862_100571302
860 Ga0068862_100757471
861 Ga0068862_100934596
862 Ga0068862_101090584
863 Ga0081455_10313517
864 Ga0081539_10000093
865 Ga0081539_10003103
866 Ga0081539_10009296
867 Ga0075432_10054913
868 Ga0070715_10140008
869 Ga0097621_100008611
870 Ga0097621_100060282
871 Ga0068871_100349562
872 Ga0075428_100005450
873 Ga0075428_100009991
874 Ga0075428_100017801
875 Ga0075428_100021606
876 Ga0075428_100248242
877 Ga0075428_100298251
878 Ga0075428_100302059
879 Ga0075428_101289245
880 Ga0075428_101448636
881 Ga0075430_100003023
882 Ga0075430_100013797
883 Ga0075430_100028644
884 Ga0075431_100209217
885 Ga0075431_100303935
886 Ga0075433_10002985
887 Ga0075433_10004390
888 Ga0075433_10185718
889 Ga0075433_10207798
890 Ga0075433_10571732
891 Ga0075433_10932579
892 Ga0075433_11257827
893 Ga0075434_100008333
894 Ga0075434_100015195
895 Ga0075434_100054690
896 Ga0075434_100223055
897 Ga0075429_100008167
898 Ga0075429_100011555
899 Ga0075429_100020196
900 Ga0075429_100041572
901 Ga0075429_100121183
902 Ga0075429_100213654
903 Ga0068865_100014141
904 Ga0068865_100146426
905 Ga0068865_100286264
906 Ga0068865_100835350
907 Ga0097620_100014195
908 Ga0097620_100021477
909 Ga0097620_100167876
910 Ga0097620_100422988
911 Ga0097620_101330232
912 Ga0075435_100649884
913 Ga0099795_10244254
914 Ga0111539_10002949
915 Ga0111539_10008296
916 Ga0111539_10055282
917 Ga0111539_10144509
918 Ga0111539_10151718
919 Ga0111539_11825405
920 Ga0105245_10425107
921 Ga0105245_10635105
922 Ga0105247_10654734
923 Ga0105247_10999342
924 Ga0105247_11159070
925 Ga0114129_10002512
926 Ga0114129_10006480
927 Ga0114129_10020166
928 Ga0114129_10058280
929 Ga0114129_10081552
930 Ga0114129_10513828
931 Ga0114129_10602392
932 Ga0114129_11311444
933 Ga0114129_11435045
934 Ga0105243_10019452
935 Ga0105243_10306392
936 Ga0105243_10321770
937 Ga0105243_11868995
938 Ga0105241_10763259
939 Ga0105242_10030024
940 Ga0105242_10314064
941 Ga0105242_11509897
942 Ga0105248_10042363
943 Ga0105248_10202348
944 Ga0105248_10791025
945 Ga0105238_10088527
946 Ga0105238_11898322
947 Ga0105249_10075681
948 Ga0105249_10294424
949 Ga0105249_11411517
950 Ga0105249_12245646
951 Ga0105246_10117410
952 Ga0105246_10488632
953 Ga0157374_10115157
954 Ga0157374_10689506
955 Ga0157378_10183642
956 Ga0157378_11826712
957 Ga0157378_11899019
958 Ga0163162_10566760
959 Ga0163162_10781136
960 Ga0157375_10001140
961 Ga0157375_10016504
962 Ga0157375_10141363
963 Ga0157375_10477989
964 Ga0157375_10498893
965 Ga0157375_11623558
966 Ga0163163_10049091
967 Ga0163163_10064132
968 Ga0163163_10763121
969 Ga0163163_11405773
970 Ga0163163_12337359
971 Ga0157380_10162042
972 Ga0157380_10255773
973 Ga0157380_10311654
974 Ga0157380_10379793
975 Ga0157380_10403723
976 Ga0157380_10414134
977 Ga0157380_10743691
978 Ga0157380_10878301
979 Ga0157380_11046985
980 Ga0157377_10019480
981 Ga0157377_10030696
982 Ga0157377_10161386
983 Ga0157377_10565726
984 Ga0157377_10825256
985 Ga0157379_10086776
986 Ga0157379_10193032
987 Ga0157379_10757221
988 Ga0157379_11010118
989 Ga0157376_10131979
990 Ga0157376_10396491
991 Ga0163161_10293999
992 Ga0163161_10327674
993 Ga0207666_1039808
994 Ga0207653_10215511
995 Ga0207682_10015369
996 Ga0207682_10057484
997 Ga0207642_10005777
998 Ga0207642_10244520
999 Ga0207688_10088323
1000 Ga0207680_10068799
1001 Ga0207680_10240501
1002 Ga0207680_10294889
1003 Ga0207680_10720175
1004 Ga0207645_10022058
1005 Ga0207645_10035883
1006 Ga0207645_10104508
1007 Ga0207645_10136347
1008 Ga0207645_10327414
1009 Ga0207643_10006771
1010 Ga0207643_10039970
1011 Ga0207643_10146853
1012 Ga0207643_10151041
1013 Ga0207643_10229929
1014 Ga0207643_10250859
1015 Ga0207705_10172502
1016 Ga0207654_10601568
1017 Ga0207707_10645978
1018 Ga0207693_10245428
1019 Ga0207660_10316151
1020 Ga0207660_10769976
1021 Ga0207662_10025161
1022 Ga0207662_10047922
1023 Ga0207662_10061724
1024 Ga0207662_10074696
1025 Ga0207662_10251737
1026 Ga0207657_10583476
1027 Ga0207649_10011260
1028 Ga0207649_10804355
1029 Ga0207681_10000808
1030 Ga0207681_10008481
1031 Ga0207681_10017086
1032 Ga0207681_10021640
1033 Ga0207694_10076958
1034 Ga0207694_10435434
1035 Ga0207650_10003205
1036 Ga0207650_10704450
1037 Ga0207650_11793782
1038 Ga0207659_10002812
1039 Ga0207659_10004134
1040 Ga0207659_10010099
1041 Ga0207659_10033856
1042 Ga0207659_10064871
1043 Ga0207659_10393879
1044 Ga0207659_10699552
1045 Ga0207687_10096335
1046 Ga0207700_10002261
1047 Ga0207644_10031474
1048 Ga0207644_10033567
1049 Ga0207644_10051175
1050 Ga0207690_10654580
1051 Ga0207706_10011236
1052 Ga0207706_10170550
1053 Ga0207686_10004699
1054 Ga0207709_10010088
1055 Ga0207709_10195264
1056 Ga0207709_10721056
1057 Ga0207670_10001732
1058 Ga0207670_10078783
1059 Ga0207670_10147587
1060 Ga0207670_10160614
1061 Ga0207670_10696855
1062 Ga0207669_10525805
1063 Ga0207704_10002597
1064 Ga0207704_10190073
1065 Ga0207704_10429905
1066 Ga0207691_10016385
1067 Ga0207691_10103381
1068 Ga0207691_10134452
1069 Ga0207691_10186689
1070 Ga0207691_10198837
1071 Ga0207691_10291137
1072 Ga0207691_10302261
1073 Ga0207691_10357699
1074 Ga0207691_10408049
1075 Ga0207691_10571195
1076 Ga0207691_10760361
1077 Ga0207711_10008451
1078 Ga0207711_10164948
1079 Ga0207711_10541099
1080 Ga0207711_10944810
1081 Ga0207689_10001675
1082 Ga0207689_10121175
1083 Ga0207689_10148087
1084 Ga0207689_10399909
1085 Ga0207689_10496726
1086 Ga0207661_10155084
1087 Ga0207661_10469120
1088 Ga0207679_10006393
1089 Ga0207679_10463364
1090 Ga0207679_10520742
1091 Ga0207679_10941234
1092 Ga0207651_10016361
1093 Ga0207651_10099002
1094 Ga0207651_10119701
1095 Ga0207651_10499219
1096 Ga0207651_10823315
1097 Ga0207712_10063609
1098 Ga0207712_10436408
1099 Ga0207668_10008478
1100 Ga0207668_10081904
1101 Ga0207640_10004703
1102 Ga0207640_10617982
1103 Ga0207658_10010096
1104 Ga0207658_10077668
1105 Ga0207658_10348445
1106 Ga0207677_10010336
1107 Ga0207677_10230418
1108 Ga0207677_10507675
1109 Ga0207677_11897131
1110 Ga0207703_10038461
1111 Ga0207703_10044024
1112 Ga0207703_10101827
1113 Ga0207703_10125576
1114 Ga0207703_10630835
1115 Ga0207639_10417381
1116 Ga0207678_10506344
1117 Ga0207708_10005103
1118 Ga0207708_10010273
1119 Ga0207708_10045986
1120 Ga0207708_10149826
1121 Ga0207708_10573270
1122 Ga0207708_10619497
1123 Ga0207708_11267140
1124 Ga0207708_11529075
1125 Ga0207641_10074623
1126 Ga0207641_10117729
1127 Ga0207641_10140425
1128 Ga0207641_10626082
1129 Ga0207641_10867943
1130 Ga0207648_10000821
1131 Ga0207648_10013935
1132 Ga0207648_10039419
1133 Ga0207648_10512129
1134 Ga0207648_10555160
1135 Ga0207676_10025460
1136 Ga0207676_10041108
1137 Ga0207676_10184142
1138 Ga0207676_10453428
1139 Ga0207676_10606196
1140 Ga0207674_10122112
1141 Ga0207674_10131607
1142 Ga0207675_100004831
1143 Ga0207675_100013814
1144 Ga0207675_100052920
1145 Ga0207675_100114431
1146 Ga0207675_100214993
1147 Ga0207675_100692887
1148 Ga0207675_101160980
1149 Ga0207683_10082995
1150 Ga0207683_10117126
1151 Ga0207683_10459318
1152 Ga0207683_10824177
1153 Ga0207698_10349860
1154 Ga0209968_1045523
1155 Ga0207428_10000481
1156 Ga0207428_10000970
1157 Ga0207428_10056353
1158 Ga0207428_10170966
1159 Ga0268266_10542432
1160 Ga0268265_10001312
1161 Ga0268265_10075093
1162 Ga0268265_10100289
1163 Ga0268265_10829355
1164 Ga0268265_10962645
1165 Ga0268265_11147408
1166 Ga0268265_11625439
1167 Ga0268264_10006226
1168 Ga0268264_10103656
1169 Ga0268264_10295955
1170 Ga0307405_10000373
1171 Ga0307413_10005717
1172 Ga0307407_10017230
1173 Ga0307412_10599294
1174 Ga0307409_100001999
1175 Ga0307416_100004987
1176 Ga0307416_100301358
1177 Ga0307416_102768685
1178 Ga0307416_103712252
1179 Ga0307414_10303691
1180 Ga0307414_11052975
1181 Ga0307411_10000802
1182 Ga0307411_11247972
1183 Ga0307415_100004066
1184 Ga0307415_101553850
1185 Ga0373959_0015313
1186 Ga0373932_0163765
1187 Ga0373939_0059451
1188 Ga0373941_0164965
1189 Ga0373961_0107096
1190 Ga0451807_0921254
1191 Ga0439433_0026136
1192 Ga0450920_076491
1193 Ga0439446_0227042
1194 Ga0439434_0114643
1195 Ga0439435_0113912
1196 Ga0451576_0025664
1197 Ga0451576_1033293
1198 Ga0495603_0031048
1199 Ga0495603_0069347
1200 Ga0495629_0006203
1201 Ga0495629_0091396
1202 Ga0495580_0204194
1203 Ga0495582_0132244
1204 Ga0495639_0014203
1205 Ga0495662_0076730
1206 Ga0495630_0957077
1207 Ga0495643_0005513
1208 Ga0495598_0009727
1209 Ga0495598_0103795
1210 Ga0495621_0013691
1211 Ga0495621_0122556
1212 Ga0495622_0141061
1213 Ga0495633_0290060
1214 Ga0495656_0124054
1215 Ga0495635_1015473
1216 Ga0495659_0297277
1217 Ga0495658_0031816
1218 Ga0495669_0011491
1219 Ga0495670_0156981
1220 Ga0495670_0569153
1221 Ga0495636_0138170
1222 Ga0495677_0023572
1223 Ga0495677_0223705
1224 Ga0496107_0971959
1225 Ga0496110_1516892
1226 Ga0501290_059565
1227 Ga0501036_0073556
1228 Ga0501036_0230382
1229 Ga0501037_0122483
1230 Ga0501038_0100938
1231 Ga0501039_0023930
1232 Ga0501039_0068292
1233 Ga0501040_0019567
1234 Ga0501041_0070777
1235 Ga0501041_0084100
1236 Ga0501042_0018062
1237 Ga0501042_0020239
1238 Ga0501046_0041837
1239 Ga0501046_0814032
1240 Ga0501068_0145437
1241 Ga0501071_0049305
1242 Ga0501071_0098767
1243 Ga0501072_0008960
1244 Ga0501072_0168500
1245 Ga0501073_0369955
1246 Ga0501074_0036836
1247 Ga0501075_0097748
1248 Ga0501075_0108498
1249 Ga0501075_0412269
1250 Ga0501076_0232413
1251 Ga0501077_0783528
1252 Ga0501202_115559
1253 Ga0501208_024244
1254 Ga0501233_030548
1255 Ga0501247_053533
1256 Ga0501249_030948
1257 Ga0501079_0013615
1258 Ga0501080_0156096
1259 Ga0501081_0009011
1260 Ga0501262_095629
1261 Ga0501283_042187
1262 Ga0501035_1042651
1263 Ga0501204_090005
1264 nmdc:mga05p37_1033_c1
1265 nmdc:mga05p37_132646_c1
1266 nmdc:mga05p37_1358601_c1
1267 nmdc:mga05p37_21351_c1
1268 nmdc:mga05p37_27001_c1
1269 nmdc:mga05p37_38368_c1
1270 nmdc:mga05p37_397353_c1
1271 nmdc:mga05p37_468125_c1
1272 nmdc:mga05p37_496087_c1
1273 nmdc:mga05p37_636104_c1
1274 nmdc:mga09592_11525_c1
1275 nmdc:mga09592_131667_c1
1276 nmdc:mga09592_153835_c1
1277 nmdc:mga09592_185942_c1
1278 nmdc:mga09592_48273_c1
1279 nmdc:mga09592_48348_c1
1280 nmdc:mga0qj67_115828_c1
1281 nmdc:mga0qj67_116314_c1
1282 nmdc:mga06r32_1619788_c1
1283 nmdc:mga06r32_413294_c1
1284 nmdc:mga06r32_45223_c1
1285 nmdc:mga06r32_65525_c1
1286 nmdc:mga08y16_1215_c1
1287 nmdc:mga08y16_13461_c1
1288 nmdc:mga08y16_14693_c1
1289 nmdc:mga08y16_1646_c1
1290 nmdc:mga08y16_5683_c1
1291 nmdc:mga08y16_573188_c1
1292 nmdc:mga08y16_821661_c1
1293 nmdc:mga08y16_98651_c1
1294 nmdc:mga0n895_1316_c1
1295 nmdc:mga0rr50_70205_c1
1296 nmdc:mga08x19_710466_c1
1297 nmdc:mga0a205_1529_c1
1298 nmdc:mga0a205_1881_c1
1299 nmdc:mga0a205_308785_c1
1300 nmdc:mga0a205_818119_c1
1301 nmdc:mga0a205_863929_c1
1302 nmdc:mga0a205_95165_c1
1303 nmdc:mga0a205_971242_c1
1304 Ga0501084_0106447
1305 Ga0501084_0547156
1306 Ga0590071_000286
1307 Ga0590074_005354
1308 Ga0590075_003143
1309 Ga0590077_000879
1310 Ga0501082_0141124
1311 Ga0501082_0264201
1312 Ga0501082_1339368
1313 Ga0530510_0002864
1314 Ga0530510_0215550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02381

MraZ

MraZ protein, putative antitoxin-like

83

141

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.9009 5 144
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.8655 5 144
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.5517 4 122
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.4949 4 122
6zqh-assembly2.cif.gz_C yeast uba1 in complex with ubiquitin 0.4555 9 123
ID Description Score Start End Superfamily
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.891 6 133 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.881 3 144 3.40.1550.20
af_P22186_1_143_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8732 6 135 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8523 6 148 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8207 3 144 3.40.1550.20
ID Description Score Start End GO Terms
AF-A0A2V8HQF4-F1-model_v4 Transcriptional regulator MraZ 0.9625 1 150 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2V8YFG5-F1-model_v4 Transcriptional regulator MraZ 0.9565 5 125 GO:0000976
GO:0003700
GO:0005737
GO:2000143
AF-A0A2V8HQF4-F1-model_v4 Transcriptional regulator MraZ 0.9562 1 150 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A1Q7JWI9-F1-model_v4 Transcriptional regulator MraZ 0.9533 6 150 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A7W1PAG8-F1-model_v4 Transcriptional regulator MraZ 0.9515 6 126 GO:0000976
GO:0003700
GO:0005737
GO:2000143

Map