F473131

General Info

Members Datasets Scaffolds Average Seq Length
657 252 657 152

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0130249|Ga0501033_0130249_1340_1789
Length 149
Sequence VEQKGLRGSAPARIDDKGRLKVPTIFRTVIHDQQGPDVFVTSLTGECVRIYPMAVWLEIERKISTPGSHPSLLKFLDRVNYYGQTGELDDQGRIVIPAHLRSSASIVGDVRVFGRISYLEVWNDERFVQKLQREPWTDEDGLRLSEHGI

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
227 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
228 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.46
Rhizosphere 99.39
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1025236 3300002076 Unclassified 847
2 JGI24033J26618_1050848 3300002155 Unclassified 594
3 JGI25406J46586_10015124 3300003203 Unclassified 3262
4 JGI25406J46586_10234660 3300003203 Bacteria 538
5 Ga0058859_11306900 3300004798 Bacteria 934
6 Ga0065714_10281948 3300005288 Unclassified 710
7 Ga0065704_10071765 3300005289 Bacteria 9984
8 Ga0065704_10111622 3300005289 Unclassified 1952
9 Ga0065712_10438045 3300005290 Unclassified 673
10 Ga0065707_10097643 3300005295 Bacteria 3156
11 Ga0065707_10193097 3300005295 Bacteria 1350
12 Ga0070658_10182282 3300005327 Bacteria 1767
13 Ga0070676_10071004 3300005328 Bacteria 2090
14 Ga0070676_10218500 3300005328 Bacteria 1258
15 Ga0070683_100072532 3300005329 Bacteria 3214
16 Ga0070683_101427232 3300005329 Unclassified 665
17 Ga0070690_100008259 3300005330 Bacteria 5989
18 Ga0070690_100227143 3300005330 Bacteria 1311
19 Ga0070670_100000967 3300005331 Bacteria 22560
20 Ga0070670_100053755 3300005331 Bacteria 3458
21 Ga0070670_100259182 3300005331 Unclassified 1516
22 Ga0070670_100734171 3300005331 Unclassified 889
23 Ga0070677_10616156 3300005333 Unclassified 603
24 Ga0068869_100097370 3300005334 Bacteria 2221
25 Ga0068869_100353969 3300005334 Bacteria 1197
26 Ga0068869_100503169 3300005334 Unclassified 1012
27 Ga0068869_100559492 3300005334 Bacteria 962
28 Ga0070666_10042068 3300005335 Bacteria 3056
29 Ga0070666_10442315 3300005335 Bacteria 938
30 Ga0070680_100118021 3300005336 Bacteria 2213
31 Ga0070680_100672144 3300005336 Bacteria 891
32 Ga0070680_101396549 3300005336 Bacteria 606
33 Ga0068868_100001154 3300005338 Bacteria 18097
34 Ga0068868_100078536 3300005338 Bacteria 2643
35 Ga0068868_100628832 3300005338 Bacteria 954
36 Ga0070660_100902978 3300005339 Unclassified 745
37 Ga0070689_100106783 3300005340 Unclassified 2222
38 Ga0070689_100239248 3300005340 Bacteria 1495
39 Ga0070689_100308549 3300005340 Bacteria 1319
40 Ga0070689_100822912 3300005340 Bacteria 818
41 Ga0070691_10063693 3300005341 Bacteria 1778
42 Ga0070687_100018003 3300005343 Bacteria 3260
43 Ga0070687_100053631 3300005343 Unclassified 2098
44 Ga0070687_100079117 3300005343 Bacteria 1788
45 Ga0070687_100234228 3300005343 Unclassified 1132
46 Ga0070661_100028198 3300005344 Unclassified 4048
47 Ga0070692_10001948 3300005345 Bacteria 7817
48 Ga0070692_10434890 3300005345 Bacteria 836
49 Ga0070692_10493889 3300005345 Bacteria 792
50 Ga0070692_10633164 3300005345 Unclassified 712
51 Ga0070668_100011612 3300005347 Bacteria 6558
52 Ga0070668_100401704 3300005347 Bacteria 1170
53 Ga0070669_100001131 3300005353 Bacteria 19486
54 Ga0070669_100005292 3300005353 Bacteria 9315
55 Ga0070669_100107569 3300005353 Bacteria 2113
56 Ga0070675_100003599 3300005354 Bacteria 11787
57 Ga0070675_100005236 3300005354 Bacteria 9898
58 Ga0070675_100028566 3300005354 Bacteria 4489
59 Ga0070675_100067630 3300005354 Bacteria 2957
60 Ga0070675_100435123 3300005354 Bacteria 1175
61 Ga0070675_101136520 3300005354 Unclassified 719
62 Ga0070671_100002291 3300005355 Bacteria 14774
63 Ga0070671_100036209 3300005355 Unclassified 4091
64 Ga0070671_100037221 3300005355 Bacteria 4035
65 Ga0070671_100331103 3300005355 Bacteria 1298
66 Ga0070674_100294936 3300005356 Bacteria 1290
67 Ga0070674_101242124 3300005356 Unclassified 663
68 Ga0070673_100020949 3300005364 Unclassified 4727
69 Ga0070673_100035259 3300005364 Bacteria 3792
70 Ga0070673_100053714 3300005364 Bacteria 3166
71 Ga0070673_100065578 3300005364 Bacteria 2897
72 Ga0070673_100094163 3300005364 Bacteria 2455
73 Ga0070673_100169052 3300005364 Bacteria 1865
74 Ga0070673_100338553 3300005364 Unclassified 1333
75 Ga0070673_100606518 3300005364 Bacteria 999
76 Ga0070688_100071472 3300005365 Bacteria 2222
77 Ga0070688_100110602 3300005365 Bacteria 1826
78 Ga0070688_100194221 3300005365 Unclassified 1416
79 Ga0070667_100000874 3300005367 Bacteria 27890
80 Ga0070667_100074661 3300005367 Bacteria 2893
81 Ga0070667_100573043 3300005367 Bacteria 1039
82 Ga0070701_10286981 3300005438 Unclassified 1007
83 Ga0070701_10399295 3300005438 Unclassified 871
84 Ga0070701_10408458 3300005438 Bacteria 862
85 Ga0070701_10848108 3300005438 Unclassified 627
86 Ga0070705_100089964 3300005440 Bacteria 1909
87 Ga0070705_100196300 3300005440 Bacteria 1380
88 Ga0070705_100541298 3300005440 Bacteria 891
89 Ga0070705_101014975 3300005440 Bacteria 674
90 Ga0070700_100005817 3300005441 Bacteria 6547
91 Ga0070700_100006394 3300005441 Bacteria 6296
92 Ga0070700_100139348 3300005441 Unclassified 1646
93 Ga0070700_100982322 3300005441 Bacteria 693
94 Ga0070700_101535284 3300005441 Unclassified 567
95 Ga0070694_100239688 3300005444 Unclassified 1368
96 Ga0070694_100420703 3300005444 Bacteria 1050
97 Ga0070694_100446125 3300005444 Unclassified 1021
98 Ga0070694_100551291 3300005444 Bacteria 923
99 Ga0070708_100758943 3300005445 Unclassified 912
100 Ga0070663_100481366 3300005455 Unclassified 1028
101 Ga0070678_100164490 3300005456 Bacteria 1801
102 Ga0070678_100328039 3300005456 Unclassified 1309
103 Ga0070678_100581720 3300005456 Bacteria 998
104 Ga0070678_100674316 3300005456 Unclassified 929
105 Ga0070662_100018620 3300005457 Bacteria 4701
106 Ga0070681_10342959 3300005458 Bacteria 1404
107 Ga0068867_100005370 3300005459 Bacteria 9060
108 Ga0068867_100007082 3300005459 Bacteria 7925
109 Ga0068867_100374395 3300005459 Bacteria 1195
110 Ga0068867_100663146 3300005459 Unclassified 916
111 Ga0070685_10164467 3300005466 Bacteria 1417
112 Ga0070685_11255541 3300005466 Bacteria 565
113 Ga0070698_100002994 3300005471 Bacteria 18609
114 Ga0070698_100053416 3300005471 Bacteria 4106
115 Ga0070698_100220017 3300005471 Unclassified 1832
116 Ga0070698_100452259 3300005471 Unclassified 1220
117 Ga0070698_100602832 3300005471 Bacteria 1039
118 Ga0070698_100660529 3300005471 Bacteria 987
119 Ga0070699_100000346 3300005518 Bacteria 44833
120 Ga0070699_100244644 3300005518 Unclassified 1602
121 Ga0070699_100598982 3300005518 Viruses 1005
122 Ga0070684_100090606 3300005535 Bacteria 2719
123 Ga0070697_101581467 3300005536 Bacteria 586
124 Ga0068853_100174434 3300005539 Unclassified 1947
125 Ga0070672_100002338 3300005543 Bacteria 11987
126 Ga0070672_100180198 3300005543 Bacteria 1760
127 Ga0070672_100260120 3300005543 Bacteria 1463
128 Ga0070672_100316468 3300005543 Bacteria 1326
129 Ga0070672_100347769 3300005543 Unclassified 1263
130 Ga0070672_100724746 3300005543 Unclassified 872
131 Ga0070686_100044130 3300005544 Bacteria 2800
132 Ga0070686_100053261 3300005544 Unclassified 2583
133 Ga0070686_100082173 3300005544 Unclassified 2136
134 Ga0070686_100180485 3300005544 Bacteria 1499
135 Ga0070686_100422260 3300005544 Bacteria 1019
136 Ga0070695_100215408 3300005545 Bacteria 1381
137 Ga0070695_100633621 3300005545 Bacteria 843
138 Ga0070695_100668311 3300005545 Unclassified 822
139 Ga0070695_100783514 3300005545 Bacteria 763
140 Ga0070696_100184000 3300005546 Bacteria 1551
141 Ga0070696_100277895 3300005546 Unclassified 1276
142 Ga0070696_100572694 3300005546 Unclassified 907
143 Ga0070696_100620226 3300005546 Bacteria 874
144 Ga0070693_100823941 3300005547 Unclassified 690
145 Ga0070665_101600533 3300005548 Unclassified 659
146 Ga0070704_100005803 3300005549 Bacteria 7223
147 Ga0070704_100026651 3300005549 Bacteria 3823
148 Ga0070704_100033903 3300005549 Bacteria 3457
149 Ga0070704_100114877 3300005549 Bacteria 2056
150 Ga0070704_100627339 3300005549 Bacteria 947
151 Ga0070664_100001791 3300005564 Bacteria 17231
152 Ga0070664_100139899 3300005564 Bacteria 2131
153 Ga0070664_100881471 3300005564 Unclassified 839
154 Ga0070664_101049440 3300005564 Unclassified 767
155 Ga0068857_100113644 3300005577 Bacteria 2435
156 Ga0068857_100479370 3300005577 Bacteria 1166
157 Ga0068857_100480729 3300005577 Bacteria 1164
158 Ga0068857_101393393 3300005577 Bacteria 682
159 Ga0068854_100017307 3300005578 Bacteria 4822
160 Ga0068854_100243881 3300005578 Bacteria 1432
161 Ga0068854_101192893 3300005578 Unclassified 682
162 Ga0070702_100020154 3300005615 Bacteria 3488
163 Ga0070702_100148063 3300005615 Bacteria 1504
164 Ga0068852_100886016 3300005616 Unclassified 909
165 Ga0068852_101246374 3300005616 Bacteria 765
166 Ga0068859_100014194 3300005617 Bacteria 7988
167 Ga0068859_100021478 3300005617 Bacteria 6480
168 Ga0068859_100167880 3300005617 Bacteria 2275
169 Ga0068859_100422996 3300005617 Unclassified 1428
170 Ga0068859_101330284 3300005617 Unclassified 792
171 Ga0068864_100028492 3300005618 Bacteria 4722
172 Ga0068864_100043301 3300005618 Bacteria 3854
173 Ga0068864_100065825 3300005618 Bacteria 3144
174 Ga0068864_100098916 3300005618 Bacteria 2584
175 Ga0068864_100749269 3300005618 Unclassified 957
176 Ga0068864_100882202 3300005618 Unclassified 883
177 Ga0068866_10029003 3300005718 Bacteria 2642
178 Ga0068866_10422990 3300005718 Bacteria 865
179 Ga0068861_100004154 3300005719 Bacteria 9714
180 Ga0068861_100278164 3300005719 Bacteria 1440
181 Ga0068861_100316935 3300005719 Bacteria 1357
182 Ga0068861_100580627 3300005719 Unclassified 1026
183 Ga0068861_100613608 3300005719 Bacteria 1000
184 Ga0068861_100771817 3300005719 Bacteria 900
185 Ga0068861_101049252 3300005719 Unclassified 781
186 Ga0068870_10004036 3300005840 Bacteria 6271
187 Ga0068870_10006336 3300005840 Bacteria 5212
188 Ga0068870_10282046 3300005840 Unclassified 1042
189 Ga0068870_10886978 3300005840 Unclassified 629
190 Ga0068863_100105627 3300005841 Bacteria 2679
191 Ga0068863_100284192 3300005841 Bacteria 1603
192 Ga0068863_100291983 3300005841 Bacteria 1580
193 Ga0068863_100985061 3300005841 Unclassified 845
194 Ga0068858_100042400 3300005842 Bacteria 4219
195 Ga0068858_100065645 3300005842 Unclassified 3358
196 Ga0068858_100105796 3300005842 Bacteria 2626
197 Ga0068860_100098111 3300005843 Bacteria 2794
198 Ga0068860_100468790 3300005843 Unclassified 1254
199 Ga0068862_100004806 3300005844 Bacteria 11375
200 Ga0068862_100382538 3300005844 Bacteria 1313
201 Ga0068862_100571302 3300005844 Unclassified 1082
202 Ga0068862_100757471 3300005844 Unclassified 945
203 Ga0068862_100934596 3300005844 Bacteria 854
204 Ga0068862_101090584 3300005844 Unclassified 793
205 Ga0081455_10313517 3300005937 Bacteria 1120
206 Ga0081539_10000093 3300005985 Bacteria 207314
207 Ga0081539_10003103 3300005985 Bacteria 21299
208 Ga0081539_10009296 3300005985 Bacteria 8252
209 Ga0075432_10054913 3300006058 Bacteria 1411
210 Ga0070715_10140008 3300006163 Bacteria 1174
211 Ga0097621_100008611 3300006237 Bacteria 7356
212 Ga0097621_100060282 3300006237 Unclassified 3110
213 Ga0068871_100349562 3300006358 Bacteria 1307
214 Ga0075428_100005450 3300006844 Bacteria 14145
215 Ga0075428_100009991 3300006844 Bacteria 10544
216 Ga0075428_100017801 3300006844 Bacteria 7850
217 Ga0075428_100021606 3300006844 Bacteria 7124
218 Ga0075428_100248242 3300006844 Bacteria 1918
219 Ga0075428_100298251 3300006844 Bacteria 1733
220 Ga0075428_100302059 3300006844 Bacteria 1721
221 Ga0075428_101289245 3300006844 Unclassified 768
222 Ga0075428_101448636 3300006844 Unclassified 720
223 Ga0075430_100003023 3300006846 Bacteria 14074
224 Ga0075430_100013797 3300006846 Bacteria 6884
225 Ga0075430_100028644 3300006846 Unclassified 4731
226 Ga0075431_100209217 3300006847 Unclassified 1993
227 Ga0075431_100303935 3300006847 Archaea 1611
228 Ga0075433_10002985 3300006852 Bacteria 12993
229 Ga0075433_10004390 3300006852 Bacteria 10969
230 Ga0075433_10185718 3300006852 Bacteria 1850
231 Ga0075433_10207798 3300006852 Bacteria 1740
232 Ga0075433_10571732 3300006852 Unclassified 993
233 Ga0075433_10932579 3300006852 Unclassified 757
234 Ga0075433_11257827 3300006852 Unclassified 642
235 Ga0075434_100008333 3300006871 Bacteria 9631
236 Ga0075434_100015195 3300006871 Bacteria 7376
237 Ga0075434_100054690 3300006871 Bacteria 3965
238 Ga0075434_100223055 3300006871 Bacteria 1905
239 Ga0075429_100008167 3300006880 Bacteria 9099
240 Ga0075429_100011555 3300006880 Bacteria 7658
241 Ga0075429_100020196 3300006880 Bacteria 5777
242 Ga0075429_100041572 3300006880 Bacteria 4004
243 Ga0075429_100121183 3300006880 Bacteria 2286
244 Ga0075429_100213654 3300006880 Bacteria 1690
245 Ga0068865_100014141 3300006881 Bacteria 5066
246 Ga0068865_100146426 3300006881 Bacteria 1787
247 Ga0068865_100286264 3300006881 Unclassified 1314
248 Ga0068865_100835350 3300006881 Unclassified 797
249 Ga0097620_100014195 3300006931 Bacteria 7988
250 Ga0097620_100021477 3300006931 Bacteria 6480
251 Ga0097620_100167876 3300006931 Bacteria 2275
252 Ga0097620_100422988 3300006931 Unclassified 1428
253 Ga0097620_101330232 3300006931 Unclassified 792
254 Ga0075435_100649884 3300007076 Bacteria 915
255 Ga0099795_10244254 3300007788 Bacteria 772
256 Ga0111539_10002949 3300009094 Bacteria 22579
257 Ga0111539_10008296 3300009094 Bacteria 13224
258 Ga0111539_10055282 3300009094 Bacteria 4718
259 Ga0111539_10144509 3300009094 Bacteria 2785
260 Ga0111539_10151718 3300009094 Bacteria 2712
261 Ga0111539_11825405 3300009094 Unclassified 705
262 Ga0105245_10425107 3300009098 Bacteria 1332
263 Ga0105245_10635105 3300009098 Bacteria 1097
264 Ga0105247_10654734 3300009101 Unclassified 785
265 Ga0105247_10999342 3300009101 Unclassified 653
266 Ga0105247_11159070 3300009101 Unclassified 613
267 Ga0114129_10002512 3300009147 Bacteria 25458
268 Ga0114129_10006480 3300009147 Bacteria 16606
269 Ga0114129_10020166 3300009147 Bacteria 9488
270 Ga0114129_10058280 3300009147 Bacteria 5402
271 Ga0114129_10081552 3300009147 Bacteria 4496
272 Ga0114129_10513828 3300009147 Bacteria 1563
273 Ga0114129_10602392 3300009147 Bacteria 1423
274 Ga0114129_11311444 3300009147 Bacteria 897
275 Ga0114129_11435045 3300009147 Bacteria 850
276 Ga0105243_10019452 3300009148 Bacteria 5149
277 Ga0105243_10306392 3300009148 Bacteria 1441
278 Ga0105243_10321770 3300009148 Bacteria 1410
279 Ga0105243_11868995 3300009148 Unclassified 633
280 Ga0105241_10763259 3300009174 Bacteria 888
281 Ga0105242_10030024 3300009176 Bacteria 4339
282 Ga0105242_10314064 3300009176 Bacteria 1435
283 Ga0105242_11509897 3300009176 Unclassified 703
284 Ga0105248_10042363 3300009177 Bacteria 5106
285 Ga0105248_10202348 3300009177 Bacteria 2237
286 Ga0105248_10791025 3300009177 Bacteria 1070
287 Ga0105238_10088527 3300009551 Bacteria 3082
288 Ga0105238_11898322 3300009551 Unclassified 628
289 Ga0105249_10075681 3300009553 Bacteria 3118
290 Ga0105249_10294424 3300009553 Bacteria 1626
291 Ga0105249_11411517 3300009553 Unclassified 768
292 Ga0105249_12245646 3300009553 Unclassified 618
293 Ga0105246_10117410 3300011119 Bacteria 1965
294 Ga0105246_10488632 3300011119 Bacteria 1043
295 Ga0157374_10115157 3300013296 Unclassified 2589
296 Ga0157374_10689506 3300013296 Bacteria 1034
297 Ga0157378_10183642 3300013297 Bacteria 1969
298 Ga0157378_11826712 3300013297 Unclassified 656
299 Ga0157378_11899019 3300013297 Bacteria 644
300 Ga0163162_10566760 3300013306 Bacteria 1263
301 Ga0163162_10781136 3300013306 Bacteria 1073
302 Ga0157375_10001140 3300013308 Bacteria 23009
303 Ga0157375_10016504 3300013308 Bacteria 6637
304 Ga0157375_10141363 3300013308 Bacteria 2534
305 Ga0157375_10477989 3300013308 Bacteria 1411
306 Ga0157375_10498893 3300013308 Bacteria 1381
307 Ga0157375_11623558 3300013308 Unclassified 765
308 Ga0163163_10049091 3300014325 Bacteria 4152
309 Ga0163163_10064132 3300014325 Bacteria 3645
310 Ga0163163_10763121 3300014325 Unclassified 1030
311 Ga0163163_11405773 3300014325 Bacteria 759
312 Ga0163163_12337359 3300014325 Unclassified 593
313 Ga0157380_10162042 3300014326 Bacteria 1945
314 Ga0157380_10255773 3300014326 Bacteria 1588
315 Ga0157380_10311654 3300014326 Unclassified 1455
316 Ga0157380_10379793 3300014326 Unclassified 1333
317 Ga0157380_10403723 3300014326 Bacteria 1297
318 Ga0157380_10414134 3300014326 Bacteria 1283
319 Ga0157380_10743691 3300014326 Bacteria 991
320 Ga0157380_10878301 3300014326 Unclassified 921
321 Ga0157380_11046985 3300014326 Bacteria 852
322 Ga0157377_10019480 3300014745 Bacteria 3546
323 Ga0157377_10030696 3300014745 Bacteria 2913
324 Ga0157377_10161386 3300014745 Bacteria 1394
325 Ga0157377_10565726 3300014745 Bacteria 805
326 Ga0157377_10825256 3300014745 Unclassified 686
327 Ga0157379_10086776 3300014968 Bacteria 2806
328 Ga0157379_10193032 3300014968 Bacteria 1840
329 Ga0157379_10757221 3300014968 Bacteria 915
330 Ga0157379_11010118 3300014968 Unclassified 793
331 Ga0157376_10131979 3300014969 Bacteria 2230
332 Ga0157376_10396491 3300014969 Bacteria 1333
333 Ga0163161_10293999 3300017792 Bacteria 1277
334 Ga0163161_10327674 3300017792 Unclassified 1212
335 Ga0207666_1039808 3300025271 Unclassified 734
336 Ga0207653_10215511 3300025885 Bacteria 728
337 Ga0207682_10015369 3300025893 Unclassified 2979
338 Ga0207682_10057484 3300025893 Bacteria 1622
339 Ga0207642_10005777 3300025899 Bacteria 4067
340 Ga0207642_10244520 3300025899 Bacteria 1015
341 Ga0207688_10088323 3300025901 Unclassified 1778
342 Ga0207680_10068799 3300025903 Bacteria 2185
343 Ga0207680_10240501 3300025903 Bacteria 1247
344 Ga0207680_10294889 3300025903 Bacteria 1129
345 Ga0207680_10720175 3300025903 Unclassified 715
346 Ga0207645_10022058 3300025907 Bacteria 4148
347 Ga0207645_10035883 3300025907 Bacteria 3183
348 Ga0207645_10104508 3300025907 Bacteria 1829
349 Ga0207645_10136347 3300025907 Unclassified 1598
350 Ga0207645_10327414 3300025907 Unclassified 1023
351 Ga0207643_10006771 3300025908 Bacteria 6147
352 Ga0207643_10039970 3300025908 Bacteria 2639
353 Ga0207643_10146853 3300025908 Bacteria 1411
354 Ga0207643_10151041 3300025908 Unclassified 1392
355 Ga0207643_10229929 3300025908 Unclassified 1137
356 Ga0207643_10250859 3300025908 Bacteria 1090
357 Ga0207705_10172502 3300025909 Bacteria 1629
358 Ga0207654_10601568 3300025911 Bacteria 784
359 Ga0207707_10645978 3300025912 Unclassified 892
360 Ga0207693_10245428 3300025915 Bacteria 1405
361 Ga0207660_10316151 3300025917 Bacteria 1246
362 Ga0207660_10769976 3300025917 Bacteria 785
363 Ga0207662_10025161 3300025918 Bacteria 3427
364 Ga0207662_10047922 3300025918 Unclassified 2531
365 Ga0207662_10061724 3300025918 Unclassified 2251
366 Ga0207662_10074696 3300025918 Bacteria 2058
367 Ga0207662_10251737 3300025918 Bacteria 1160
368 Ga0207657_10583476 3300025919 Bacteria 873
369 Ga0207649_10011260 3300025920 Unclassified 4927
370 Ga0207649_10804355 3300025920 Unclassified 734
371 Ga0207681_10000808 3300025923 Bacteria 20616
372 Ga0207681_10008481 3300025923 Bacteria 6280
373 Ga0207681_10017086 3300025923 Bacteria 4552
374 Ga0207681_10021640 3300025923 Bacteria 4091
375 Ga0207694_10076958 3300025924 Bacteria 2613
376 Ga0207694_10435434 3300025924 Bacteria 1093
377 Ga0207650_10003205 3300025925 Bacteria 11284
378 Ga0207650_10704450 3300025925 Unclassified 853
379 Ga0207650_11793782 3300025925 Unclassified 519
380 Ga0207659_10002812 3300025926 Bacteria 10376
381 Ga0207659_10004134 3300025926 Bacteria 8761
382 Ga0207659_10010099 3300025926 Bacteria 5917
383 Ga0207659_10033856 3300025926 Bacteria 3520
384 Ga0207659_10064871 3300025926 Bacteria 2645
385 Ga0207659_10393879 3300025926 Unclassified 1157
386 Ga0207659_10699552 3300025926 Bacteria 868
387 Ga0207687_10096335 3300025927 Bacteria 2168
388 Ga0207700_10002261 3300025928 Bacteria 11058
389 Ga0207644_10031474 3300025931 Bacteria 3696
390 Ga0207644_10033567 3300025931 Unclassified 3587
391 Ga0207644_10051175 3300025931 Bacteria 2964
392 Ga0207690_10654580 3300025932 Unclassified 861
393 Ga0207706_10011236 3300025933 Bacteria 8165
394 Ga0207706_10170550 3300025933 Bacteria 1912
395 Ga0207686_10004699 3300025934 Bacteria 7322
396 Ga0207709_10010088 3300025935 Bacteria 5202
397 Ga0207709_10195264 3300025935 Bacteria 1441
398 Ga0207709_10721056 3300025935 Unclassified 799
399 Ga0207670_10001732 3300025936 Bacteria 11390
400 Ga0207670_10078783 3300025936 Bacteria 2299
401 Ga0207670_10147587 3300025936 Bacteria 1741
402 Ga0207670_10160614 3300025936 Bacteria 1677
403 Ga0207670_10696855 3300025936 Bacteria 840
404 Ga0207669_10525805 3300025937 Unclassified 951
405 Ga0207704_10002597 3300025938 Bacteria 8149
406 Ga0207704_10190073 3300025938 Unclassified 1493
407 Ga0207704_10429905 3300025938 Unclassified 1049
408 Ga0207691_10016385 3300025940 Bacteria 7035
409 Ga0207691_10103381 3300025940 Bacteria 2540
410 Ga0207691_10134452 3300025940 Bacteria 2183
411 Ga0207691_10186689 3300025940 Unclassified 1809
412 Ga0207691_10198837 3300025940 Bacteria 1745
413 Ga0207691_10291137 3300025940 Unclassified 1404
414 Ga0207691_10302261 3300025940 Bacteria 1375
415 Ga0207691_10357699 3300025940 Bacteria 1248
416 Ga0207691_10408049 3300025940 Bacteria 1158
417 Ga0207691_10571195 3300025940 Bacteria 958
418 Ga0207691_10760361 3300025940 Bacteria 815
419 Ga0207711_10008451 3300025941 Bacteria 8611
420 Ga0207711_10164948 3300025941 Bacteria 2007
421 Ga0207711_10541099 3300025941 Bacteria 1086
422 Ga0207711_10944810 3300025941 Unclassified 801
423 Ga0207689_10001675 3300025942 Bacteria 21042
424 Ga0207689_10121175 3300025942 Bacteria 2152
425 Ga0207689_10148087 3300025942 Bacteria 1934
426 Ga0207689_10399909 3300025942 Bacteria 1145
427 Ga0207689_10496726 3300025942 Unclassified 1022
428 Ga0207661_10155084 3300025944 Bacteria 1983
429 Ga0207661_10469120 3300025944 Unclassified 1148
430 Ga0207679_10006393 3300025945 Bacteria 7442
431 Ga0207679_10463364 3300025945 Bacteria 1126
432 Ga0207679_10520742 3300025945 Unclassified 1063
433 Ga0207679_10941234 3300025945 Unclassified 791
434 Ga0207651_10016361 3300025960 Bacteria 4342
435 Ga0207651_10099002 3300025960 Bacteria 2158
436 Ga0207651_10119701 3300025960 Unclassified 1994
437 Ga0207651_10499219 3300025960 Bacteria 1051
438 Ga0207651_10823315 3300025960 Unclassified 824
439 Ga0207712_10063609 3300025961 Bacteria 2627
440 Ga0207712_10436408 3300025961 Unclassified 1108
441 Ga0207668_10008478 3300025972 Bacteria 6131
442 Ga0207668_10081904 3300025972 Bacteria 2343
443 Ga0207640_10004703 3300025981 Bacteria 7414
444 Ga0207640_10617982 3300025981 Unclassified 919
445 Ga0207658_10010096 3300025986 Bacteria 6413
446 Ga0207658_10077668 3300025986 Bacteria 2534
447 Ga0207658_10348445 3300025986 Bacteria 1289
448 Ga0207677_10010336 3300026023 Bacteria 5278
449 Ga0207677_10230418 3300026023 Bacteria 1492
450 Ga0207677_10507675 3300026023 Unclassified 1044
451 Ga0207677_11897131 3300026023 Unclassified 553
452 Ga0207703_10038461 3300026035 Unclassified 3818
453 Ga0207703_10044024 3300026035 Bacteria 3585
454 Ga0207703_10101827 3300026035 Bacteria 2436
455 Ga0207703_10125576 3300026035 Unclassified 2208
456 Ga0207703_10630835 3300026035 Bacteria 1015
457 Ga0207639_10417381 3300026041 Bacteria 1212
458 Ga0207678_10506344 3300026067 Unclassified 1053
459 Ga0207708_10005103 3300026075 Bacteria 9688
460 Ga0207708_10010273 3300026075 Bacteria 6949
461 Ga0207708_10045986 3300026075 Bacteria 3325
462 Ga0207708_10149826 3300026075 Bacteria 1835
463 Ga0207708_10573270 3300026075 Bacteria 954
464 Ga0207708_10619497 3300026075 Bacteria 918
465 Ga0207708_11267140 3300026075 Unclassified 645
466 Ga0207708_11529075 3300026075 Unclassified 586
467 Ga0207641_10074623 3300026088 Unclassified 2926
468 Ga0207641_10117729 3300026088 Bacteria 2366
469 Ga0207641_10140425 3300026088 Bacteria 2179
470 Ga0207641_10626082 3300026088 Bacteria 1055
471 Ga0207641_10867943 3300026088 Unclassified 895
472 Ga0207648_10000821 3300026089 Bacteria 35108
473 Ga0207648_10013935 3300026089 Bacteria 7455
474 Ga0207648_10039419 3300026089 Bacteria 4155
475 Ga0207648_10512129 3300026089 Bacteria 1099
476 Ga0207648_10555160 3300026089 Bacteria 1055
477 Ga0207676_10025460 3300026095 Bacteria 4390
478 Ga0207676_10041108 3300026095 Unclassified 3546
479 Ga0207676_10184142 3300026095 Bacteria 1831
480 Ga0207676_10453428 3300026095 Bacteria 1209
481 Ga0207676_10606196 3300026095 Unclassified 1052
482 Ga0207674_10122112 3300026116 Bacteria 2571
483 Ga0207674_10131607 3300026116 Bacteria 2464
484 Ga0207675_100004831 3300026118 Bacteria 12978
485 Ga0207675_100013814 3300026118 Bacteria 7530
486 Ga0207675_100052920 3300026118 Bacteria 3788
487 Ga0207675_100114431 3300026118 Bacteria 2548
488 Ga0207675_100214993 3300026118 Unclassified 1850
489 Ga0207675_100692887 3300026118 Unclassified 1027
490 Ga0207675_101160980 3300026118 Unclassified 792
491 Ga0207683_10082995 3300026121 Bacteria 2848
492 Ga0207683_10117126 3300026121 Unclassified 2389
493 Ga0207683_10459318 3300026121 Unclassified 1174
494 Ga0207683_10824177 3300026121 Bacteria 861
495 Ga0207698_10349860 3300026142 Unclassified 1395
496 Ga0209968_1045523 3300027526 Bacteria 755
497 Ga0207428_10000481 3300027907 Bacteria 48194
498 Ga0207428_10000970 3300027907 Bacteria 31814
499 Ga0207428_10056353 3300027907 Bacteria 3123
500 Ga0207428_10170966 3300027907 Unclassified 1646
501 Ga0268266_10542432 3300028379 Unclassified 1114
502 Ga0268265_10001312 3300028380 Bacteria 21329
503 Ga0268265_10075093 3300028380 Bacteria 2647
504 Ga0268265_10100289 3300028380 Bacteria 2337
505 Ga0268265_10829355 3300028380 Bacteria 903
506 Ga0268265_10962645 3300028380 Unclassified 841
507 Ga0268265_11147408 3300028380 Bacteria 773
508 Ga0268265_11625439 3300028380 Unclassified 651
509 Ga0268264_10006226 3300028381 Bacteria 10069
510 Ga0268264_10103656 3300028381 Bacteria 2478
511 Ga0268264_10295955 3300028381 Unclassified 1522
512 Ga0307405_10000373 3300031731 Bacteria 16766
513 Ga0307413_10005717 3300031824 Bacteria 5588
514 Ga0307407_10017230 3300031903 Bacteria 3618
515 Ga0307412_10599294 3300031911 Bacteria 933
516 Ga0307409_100001999 3300031995 Bacteria 10458
517 Ga0307416_100004987 3300032002 Bacteria 8096
518 Ga0307416_100301358 3300032002 Bacteria 1593
519 Ga0307416_102768685 3300032002 Unclassified 586
520 Ga0307416_103712252 3300032002 Bacteria 511
521 Ga0307414_10303691 3300032004 Bacteria 1351
522 Ga0307414_11052975 3300032004 Unclassified 750
523 Ga0307411_10000802 3300032005 Bacteria 11716
524 Ga0307411_11247972 3300032005 Unclassified 675
525 Ga0307415_100004066 3300032126 Bacteria 7545
526 Ga0307415_101553850 3300032126 Unclassified 634
527 Ga0373959_0015313 3300034820 Unclassified 1407
528 Ga0373932_0163765 3300035112 Unclassified 771
529 Ga0373939_0059451 3300035114 Bacteria 1212
530 Ga0373941_0164965 3300035115 Bacteria 822
531 Ga0373961_0107096 3300035241 Bacteria 912
532 Ga0451807_0921254 3300041486 Bacteria 959
533 Ga0439433_0026136 3300041999 Bacteria 1321
534 Ga0450920_076491 3300042122 Unclassified 683
535 Ga0439446_0227042 3300042156 Bacteria 638
536 Ga0439434_0114643 3300042435 Unclassified 875
537 Ga0439435_0113912 3300042436 Unclassified 842
538 Ga0451576_0025664 3300045051 Bacteria 6348
539 Ga0451576_1033293 3300045051 Unclassified 861
540 Ga0495603_0031048 3300046455 Bacteria 3216
541 Ga0495603_0069347 3300046455 Bacteria 2074
542 Ga0495629_0006203 3300046459 Bacteria 8872
543 Ga0495629_0091396 3300046459 Bacteria 2124
544 Ga0495580_0204194 3300046472 Unclassified 1361
545 Ga0495582_0132244 3300046473 Bacteria 1410
546 Ga0495639_0014203 3300046475 Unclassified 3447
547 Ga0495662_0076730 3300046476 Bacteria 1623
548 Ga0495630_0957077 3300046517 Unclassified 651
549 Ga0495643_0005513 3300046522 Bacteria 8540
550 Ga0495598_0009727 3300046537 Bacteria 2283
551 Ga0495598_0103795 3300046537 Bacteria 944
552 Ga0495621_0013691 3300046539 Bacteria 2553
553 Ga0495621_0122556 3300046539 Bacteria 1006
554 Ga0495622_0141061 3300046557 Bacteria 1094
555 Ga0495633_0290060 3300046558 Unclassified 744
556 Ga0495656_0124054 3300046615 Bacteria 1222
557 Ga0495635_1015473 3300046663 Unclassified 527
558 Ga0495659_0297277 3300046664 Unclassified 681
559 Ga0495658_0031816 3300046683 Bacteria 2876
560 Ga0495669_0011491 3300046684 Bacteria 3759
561 Ga0495670_0156981 3300046691 Bacteria 1194
562 Ga0495670_0569153 3300046691 Unclassified 617
563 Ga0495636_0138170 3300047318 Unclassified 1087
564 Ga0495677_0023572 3300047445 Bacteria 2234
565 Ga0495677_0223705 3300047445 Unclassified 733
566 Ga0496107_0971959 3300048910 Unclassified 617
567 Ga0496110_1516892 3300048913 Unclassified 580
568 Ga0501290_059565 3300049513 Unclassified 612
569 Ga0501033_0130249 3300049570 Bacteria 1823
570 Ga0501036_0073556 3300049572 Bacteria 2889
571 Ga0501036_0230382 3300049572 Bacteria 1555
572 Ga0501037_0122483 3300049573 Bacteria 1869
573 Ga0501038_0100938 3300049574 Bacteria 2403
574 Ga0501039_0023930 3300049575 Bacteria 4689
575 Ga0501039_0068292 3300049575 Bacteria 2760
576 Ga0501040_0019567 3300049576 Bacteria 4505
577 Ga0501041_0070777 3300049577 Bacteria 2141
578 Ga0501041_0084100 3300049577 Bacteria 1961
579 Ga0501042_0018062 3300049578 Bacteria 4878
580 Ga0501042_0020239 3300049578 Bacteria 4630
581 Ga0501046_0041837 3300049580 Bacteria 3655
582 Ga0501046_0814032 3300049580 Unclassified 654
583 Ga0501068_0145437 3300049584 Bacteria 1488
584 Ga0501071_0049305 3300049587 Bacteria 3031
585 Ga0501071_0098767 3300049587 Bacteria 2151
586 Ga0501072_0008960 3300049588 Bacteria 7607
587 Ga0501072_0168500 3300049588 Unclassified 1748
588 Ga0501073_0369955 3300049589 Bacteria 990
589 Ga0501074_0036836 3300049590 Bacteria 3544
590 Ga0501075_0097748 3300049591 Bacteria 2228
591 Ga0501075_0108498 3300049591 Bacteria 2110
592 Ga0501075_0412269 3300049591 Bacteria 1030
593 Ga0501076_0232413 3300049592 Bacteria 1507
594 Ga0501077_0783528 3300049593 Unclassified 613
595 Ga0501202_115559 3300049652 Bacteria 669
596 Ga0501208_024244 3300049655 Bacteria 1022
597 Ga0501233_030548 3300049668 Bacteria 1215
598 Ga0501247_053533 3300049677 Bacteria 604
599 Ga0501249_030948 3300049679 Bacteria 1193
600 Ga0501079_0013615 3300049741 Bacteria 6204
601 Ga0501080_0156096 3300049742 Bacteria 2108
602 Ga0501081_0009011 3300049743 Bacteria 6486
603 Ga0501262_095629 3300049759 Bacteria 507
604 Ga0501283_042187 3300049779 Bacteria 792
605 Ga0501035_1042651 3300049822 Unclassified 641
606 Ga0501204_090005 3300049850 Unclassified 534
607 nmdc:mga05p37_1033_c1 3300050507 Bacteria 31719
608 nmdc:mga05p37_132646_c1 3300050507 Bacteria 3056
609 nmdc:mga05p37_1358601_c1 3300050507 Unclassified 719
610 nmdc:mga05p37_21351_c1 3300050507 Bacteria 7841
611 nmdc:mga05p37_27001_c1 3300050507 Bacteria 6987
612 nmdc:mga05p37_38368_c1 3300050507 Bacteria 5875
613 nmdc:mga05p37_397353_c1 3300050507 Bacteria 1610
614 nmdc:mga05p37_468125_c1 3300050507 Bacteria 1455
615 nmdc:mga05p37_496087_c1 3300050507 Bacteria 1403
616 nmdc:mga05p37_636104_c1 3300050507 Bacteria 1198
617 nmdc:mga09592_11525_c1 3300050508 Bacteria 7193
618 nmdc:mga09592_131667_c1 3300050508 Bacteria 2152
619 nmdc:mga09592_153835_c1 3300050508 Bacteria 1985
620 nmdc:mga09592_185942_c1 3300050508 Bacteria 1798
621 nmdc:mga09592_48273_c1 3300050508 Bacteria 3589
622 nmdc:mga09592_48348_c1 3300050508 Bacteria 3586
623 nmdc:mga0qj67_115828_c1 3300050509 Bacteria 2166
624 nmdc:mga0qj67_116314_c1 3300050509 Bacteria 2161
625 nmdc:mga06r32_1619788_c1 3300050510 Unclassified 586
626 nmdc:mga06r32_413294_c1 3300050510 Unclassified 1331
627 nmdc:mga06r32_45223_c1 3300050510 Bacteria 4196
628 nmdc:mga06r32_65525_c1 3300050510 Bacteria 3504
629 nmdc:mga08y16_1215_c1 3300050511 Bacteria 25486
630 nmdc:mga08y16_13461_c1 3300050511 Bacteria 8607
631 nmdc:mga08y16_14693_c1 3300050511 Bacteria 8231
632 nmdc:mga08y16_1646_c1 3300050511 Bacteria 22621
633 nmdc:mga08y16_5683_c1 3300050511 Bacteria 13067
634 nmdc:mga08y16_573188_c1 3300050511 Unclassified 1140
635 nmdc:mga08y16_821661_c1 3300050511 Bacteria 921
636 nmdc:mga08y16_98651_c1 3300050511 Bacteria 3042
637 nmdc:mga0n895_1316_c1 3300050512 Bacteria 18393
638 nmdc:mga0rr50_70205_c1 3300050513 Bacteria 2669
639 nmdc:mga08x19_710466_c1 3300050514 Unclassified 713
640 nmdc:mga0a205_1529_c1 3300050515 Bacteria 19766
641 nmdc:mga0a205_1881_c1 3300050515 Bacteria 18198
642 nmdc:mga0a205_308785_c1 3300050515 Bacteria 1454
643 nmdc:mga0a205_818119_c1 3300050515 Unclassified 779
644 nmdc:mga0a205_863929_c1 3300050515 Bacteria 752
645 nmdc:mga0a205_95165_c1 3300050515 Bacteria 2877
646 nmdc:mga0a205_971242_c1 3300050515 Unclassified 696
647 Ga0501084_0106447 3300054114 Bacteria 2356
648 Ga0501084_0547156 3300054114 Bacteria 978
649 Ga0590071_000286 3300059421 Bacteria 14746
650 Ga0590074_005354 3300059423 Bacteria 2124
651 Ga0590075_003143 3300059424 Bacteria 3927
652 Ga0590077_000879 3300059426 Bacteria 7697
653 Ga0501082_0141124 3300060353 Bacteria 2091
654 Ga0501082_0264201 3300060353 Bacteria 1497
655 Ga0501082_1339368 3300060353 Unclassified 625
656 Ga0530510_0002864 3300061734 Bacteria 11858
657 Ga0530510_0215550 3300061734 Bacteria 1426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0141124 Ga0501082_0141124_1687_2073 128
2 3300025961 Ga0207712_10436408 Ga0207712_104364082 142
3 3300005334 Ga0068869_100503169 Ga0068869_1005031691 145
4 3300005356 Ga0070674_101242124 Ga0070674_1012421241 145
5 3300005440 Ga0070705_100541298 Ga0070705_1005412982 145
6 3300005444 Ga0070694_100446125 Ga0070694_1004461251 145
7 3300005545 Ga0070695_100668311 Ga0070695_1006683111 145
8 3300005546 Ga0070696_100572694 Ga0070696_1005726942 145
9 3300005577 Ga0068857_100479370 Ga0068857_1004793701 145
10 3300006880 Ga0075429_100213654 Ga0075429_1002136543 145
11 3300025908 Ga0207643_10039970 Ga0207643_100399704 145
12 3300025926 Ga0207659_10033856 Ga0207659_100338563 145
13 3300025942 Ga0207689_10121175 Ga0207689_101211752 145
14 3300005290 Ga0065712_10438045 Ga0065712_104380452 146
15 3300005329 Ga0070683_101427232 Ga0070683_1014272322 146
16 3300005331 Ga0070670_100000967 Ga0070670_1000009677 146
17 3300005338 Ga0068868_100001154 Ga0068868_10000115415 146
18 3300005340 Ga0070689_100106783 Ga0070689_1001067832 146
19 3300005343 Ga0070687_100234228 Ga0070687_1002342282 146
20 3300005344 Ga0070661_100028198 Ga0070661_1000281983 146
21 3300005355 Ga0070671_100036209 Ga0070671_1000362095 146
22 3300005364 Ga0070673_100020949 Ga0070673_1000209492 146
23 3300005365 Ga0070688_100194221 Ga0070688_1001942212 146
24 3300005367 Ga0070667_100000874 Ga0070667_10000087419 146
25 3300005456 Ga0070678_100328039 Ga0070678_1003280392 146
26 3300005466 Ga0070685_10164467 Ga0070685_101644672 146
27 3300005543 Ga0070672_100002338 Ga0070672_10000233812 146
28 3300005544 Ga0070686_100082173 Ga0070686_1000821732 146
29 3300005564 Ga0070664_100001791 Ga0070664_1000017918 146
30 3300005616 Ga0068852_100886016 Ga0068852_1008860162 146
31 3300005617 Ga0068859_100422996 Ga0068859_1004229962 146
32 3300005842 Ga0068858_100065645 Ga0068858_1000656454 146
33 3300005844 Ga0068862_101090584 Ga0068862_1010905841 146
34 3300006163 Ga0070715_10140008 Ga0070715_101400082 146
35 3300006237 Ga0097621_100060282 Ga0097621_1000602822 146
36 3300006931 Ga0097620_100422988 Ga0097620_1004229882 146
37 3300007788 Ga0099795_10244254 Ga0099795_102442542 146
38 3300009101 Ga0105247_11159070 Ga0105247_111590701 146
39 3300009147 Ga0114129_10513828 Ga0114129_105138282 146
40 3300009176 Ga0105242_11509897 Ga0105242_115098971 146
41 3300009177 Ga0105248_10042363 Ga0105248_100423631 146
42 3300013296 Ga0157374_10115157 Ga0157374_101151573 146
43 3300013297 Ga0157378_11826712 Ga0157378_118267121 146
44 3300013308 Ga0157375_10001140 Ga0157375_1000114017 146
45 3300014745 Ga0157377_10161386 Ga0157377_101613862 146
46 3300014969 Ga0157376_10396491 Ga0157376_103964912 146
47 3300017792 Ga0163161_10327674 Ga0163161_103276741 146
48 3300025903 Ga0207680_10720175 Ga0207680_107201752 146
49 3300025918 Ga0207662_10251737 Ga0207662_102517372 146
50 3300025920 Ga0207649_10011260 Ga0207649_100112606 146
51 3300025925 Ga0207650_10003205 Ga0207650_100032055 146
52 3300025931 Ga0207644_10033567 Ga0207644_100335675 146
53 3300025936 Ga0207670_10078783 Ga0207670_100787832 146
54 3300025940 Ga0207691_10016385 Ga0207691_100163853 146
55 3300025940 Ga0207691_10760361 Ga0207691_107603612 146
56 3300025941 Ga0207711_10008451 Ga0207711_100084517 146
57 3300025945 Ga0207679_10006393 Ga0207679_100063935 146
58 3300025960 Ga0207651_10119701 Ga0207651_101197012 146
59 3300025986 Ga0207658_10010096 Ga0207658_100100962 146
60 3300026023 Ga0207677_10010336 Ga0207677_100103362 146
61 3300026035 Ga0207703_10038461 Ga0207703_100384614 146
62 3300026035 Ga0207703_10630835 Ga0207703_106308352 146
63 3300026088 Ga0207641_10074623 Ga0207641_100746231 146
64 3300026095 Ga0207676_10041108 Ga0207676_100411081 146
65 3300026121 Ga0207683_10459318 Ga0207683_104593182 146
66 3300027526 Ga0209968_1045523 Ga0209968_10455232 146
67 3300028380 Ga0268265_11147408 Ga0268265_111474082 146
68 3300041486 Ga0451807_0921254 Ga0451807_0921254_353_793 146
69 3300046455 Ga0495603_0069347 Ga0495603_0069347_433_873 146
70 3300046459 Ga0495629_0091396 Ga0495629_0091396_408_848 146
71 3300046472 Ga0495580_0204194 Ga0495580_0204194_145_585 146
72 3300046473 Ga0495582_0132244 Ga0495582_0132244_433_873 146
73 3300046475 Ga0495639_0014203 Ga0495639_0014203_2401_2841 146
74 3300046476 Ga0495662_0076730 Ga0495662_0076730_901_1341 146
75 3300046517 Ga0495630_0957077 Ga0495630_0957077_142_582 146
76 3300046558 Ga0495633_0290060 Ga0495633_0290060_93_533 146
77 3300046663 Ga0495635_1015473 Ga0495635_1015473_28_468 146
78 3300050507 nmdc:mga05p37_21351_c1 nmdc:mga05p37_21351_c1_4201_4641 146
79 3300049570 Ga0501033_0130249 Ga0501033_0130249_1340_1789 149
80 3300049572 Ga0501036_0230382 Ga0501036_0230382_840_1289 149
81 3300049575 Ga0501039_0068292 Ga0501039_0068292_1076_1525 149
82 3300049577 Ga0501041_0084100 Ga0501041_0084100_422_871 149
83 3300049578 Ga0501042_0018062 Ga0501042_0018062_1334_1783 149
84 3300049580 Ga0501046_0041837 Ga0501046_0041837_69_518 149
85 3300049587 Ga0501071_0049305 Ga0501071_0049305_99_548 149
86 3300049588 Ga0501072_0168500 Ga0501072_0168500_189_638 149
87 3300049590 Ga0501074_0036836 Ga0501074_0036836_2997_3446 149
88 3300049591 Ga0501075_0097748 Ga0501075_0097748_352_801 149
89 3300049593 Ga0501077_0783528 Ga0501077_0783528_55_504 149
90 3300049741 Ga0501079_0013615 Ga0501079_0013615_5599_6048 149
91 3300049742 Ga0501080_0156096 Ga0501080_0156096_198_647 149
92 3300049743 Ga0501081_0009011 Ga0501081_0009011_3682_4131 149
93 3300061734 Ga0530510_0215550 Ga0530510_0215550_203_652 149
94 3300002076 JGI24749J21850_1025236 JGI24749J21850_10252361 150
95 3300002155 JGI24033J26618_1050848 JGI24033J26618_10508481 150
96 3300003203 JGI25406J46586_10015124 JGI25406J46586_100151244 150
97 3300003203 JGI25406J46586_10234660 JGI25406J46586_102346601 150
98 3300004798 Ga0058859_11306900 Ga0058859_113069001 150
99 3300005288 Ga0065714_10281948 Ga0065714_102819482 150
100 3300005289 Ga0065704_10071765 Ga0065704_1007176511 150
101 3300005289 Ga0065704_10111622 Ga0065704_101116222 150
102 3300005295 Ga0065707_10097643 Ga0065707_100976433 150
103 3300005295 Ga0065707_10193097 Ga0065707_101930972 150
104 3300005327 Ga0070658_10182282 Ga0070658_101822822 150
105 3300005328 Ga0070676_10071004 Ga0070676_100710042 150
106 3300005328 Ga0070676_10218500 Ga0070676_102185002 150
107 3300005329 Ga0070683_100072532 Ga0070683_1000725324 150
108 3300005330 Ga0070690_100008259 Ga0070690_1000082591 150
109 3300005330 Ga0070690_100227143 Ga0070690_1002271432 150
110 3300005331 Ga0070670_100053755 Ga0070670_1000537551 150
111 3300005331 Ga0070670_100259182 Ga0070670_1002591822 150
112 3300005331 Ga0070670_100734171 Ga0070670_1007341711 150
113 3300005333 Ga0070677_10616156 Ga0070677_106161561 150
114 3300005334 Ga0068869_100097370 Ga0068869_1000973702 150
115 3300005334 Ga0068869_100353969 Ga0068869_1003539691 150
116 3300005334 Ga0068869_100559492 Ga0068869_1005594922 150
117 3300005335 Ga0070666_10042068 Ga0070666_100420682 150
118 3300005335 Ga0070666_10442315 Ga0070666_104423152 150
119 3300005336 Ga0070680_100118021 Ga0070680_1001180213 150
120 3300005336 Ga0070680_100672144 Ga0070680_1006721441 150
121 3300005336 Ga0070680_101396549 Ga0070680_1013965491 150
122 3300005338 Ga0068868_100078536 Ga0068868_1000785364 150
123 3300005338 Ga0068868_100628832 Ga0068868_1006288322 150
124 3300005339 Ga0070660_100902978 Ga0070660_1009029781 150
125 3300005340 Ga0070689_100239248 Ga0070689_1002392481 150
126 3300005340 Ga0070689_100308549 Ga0070689_1003085492 150
127 3300005340 Ga0070689_100822912 Ga0070689_1008229121 150
128 3300005341 Ga0070691_10063693 Ga0070691_100636932 150
129 3300005343 Ga0070687_100018003 Ga0070687_1000180033 150
130 3300005343 Ga0070687_100053631 Ga0070687_1000536312 150
131 3300005343 Ga0070687_100079117 Ga0070687_1000791172 150
132 3300005345 Ga0070692_10001948 Ga0070692_100019486 150
133 3300005345 Ga0070692_10434890 Ga0070692_104348901 150
134 3300005345 Ga0070692_10493889 Ga0070692_104938892 150
135 3300005345 Ga0070692_10633164 Ga0070692_106331642 150
136 3300005347 Ga0070668_100011612 Ga0070668_1000116122 150
137 3300005347 Ga0070668_100401704 Ga0070668_1004017041 150
138 3300005353 Ga0070669_100001131 Ga0070669_10000113116 150
139 3300005353 Ga0070669_100005292 Ga0070669_1000052925 150
140 3300005353 Ga0070669_100107569 Ga0070669_1001075692 150
141 3300005354 Ga0070675_100003599 Ga0070675_1000035998 150
142 3300005354 Ga0070675_100005236 Ga0070675_1000052364 150
143 3300005354 Ga0070675_100028566 Ga0070675_1000285664 150
144 3300005354 Ga0070675_100067630 Ga0070675_1000676303 150
145 3300005354 Ga0070675_100435123 Ga0070675_1004351232 150
146 3300005354 Ga0070675_101136520 Ga0070675_1011365201 150
147 3300005355 Ga0070671_100002291 Ga0070671_1000022919 150
148 3300005355 Ga0070671_100037221 Ga0070671_1000372214 150
149 3300005355 Ga0070671_100331103 Ga0070671_1003311031 150
150 3300005356 Ga0070674_100294936 Ga0070674_1002949362 150
151 3300005364 Ga0070673_100035259 Ga0070673_1000352593 150
152 3300005364 Ga0070673_100053714 Ga0070673_1000537142 150
153 3300005364 Ga0070673_100065578 Ga0070673_1000655782 150
154 3300005364 Ga0070673_100094163 Ga0070673_1000941632 150
155 3300005364 Ga0070673_100169052 Ga0070673_1001690522 150
156 3300005364 Ga0070673_100338553 Ga0070673_1003385531 150
157 3300005364 Ga0070673_100606518 Ga0070673_1006065181 150
158 3300005365 Ga0070688_100071472 Ga0070688_1000714722 150
159 3300005365 Ga0070688_100110602 Ga0070688_1001106022 150
160 3300005367 Ga0070667_100074661 Ga0070667_1000746613 150
161 3300005367 Ga0070667_100573043 Ga0070667_1005730432 150
162 3300005438 Ga0070701_10286981 Ga0070701_102869812 150
163 3300005438 Ga0070701_10399295 Ga0070701_103992951 150
164 3300005438 Ga0070701_10408458 Ga0070701_104084582 150
165 3300005438 Ga0070701_10848108 Ga0070701_108481081 150
166 3300005440 Ga0070705_100089964 Ga0070705_1000899643 150
167 3300005440 Ga0070705_100196300 Ga0070705_1001963002 150
168 3300005440 Ga0070705_101014975 Ga0070705_1010149751 150
169 3300005441 Ga0070700_100005817 Ga0070700_1000058174 150
170 3300005441 Ga0070700_100006394 Ga0070700_1000063945 150
171 3300005441 Ga0070700_100139348 Ga0070700_1001393481 150
172 3300005441 Ga0070700_100982322 Ga0070700_1009823221 150
173 3300005441 Ga0070700_101535284 Ga0070700_1015352841 150
174 3300005444 Ga0070694_100239688 Ga0070694_1002396882 150
175 3300005444 Ga0070694_100420703 Ga0070694_1004207031 150
176 3300005444 Ga0070694_100551291 Ga0070694_1005512911 150
177 3300005445 Ga0070708_100758943 Ga0070708_1007589431 150
178 3300005455 Ga0070663_100481366 Ga0070663_1004813662 150
179 3300005456 Ga0070678_100164490 Ga0070678_1001644902 150
180 3300005456 Ga0070678_100581720 Ga0070678_1005817202 150
181 3300005456 Ga0070678_100674316 Ga0070678_1006743162 150
182 3300005457 Ga0070662_100018620 Ga0070662_1000186205 150
183 3300005458 Ga0070681_10342959 Ga0070681_103429592 150
184 3300005459 Ga0068867_100005370 Ga0068867_1000053704 150
185 3300005459 Ga0068867_100007082 Ga0068867_1000070827 150
186 3300005459 Ga0068867_100374395 Ga0068867_1003743951 150
187 3300005459 Ga0068867_100663146 Ga0068867_1006631461 150
188 3300005466 Ga0070685_11255541 Ga0070685_112555411 150
189 3300005471 Ga0070698_100002994 Ga0070698_10000299413 150
190 3300005471 Ga0070698_100053416 Ga0070698_1000534164 150
191 3300005471 Ga0070698_100220017 Ga0070698_1002200172 150
192 3300005471 Ga0070698_100452259 Ga0070698_1004522592 150
193 3300005471 Ga0070698_100602832 Ga0070698_1006028322 150
194 3300005471 Ga0070698_100660529 Ga0070698_1006605291 150
195 3300005518 Ga0070699_100000346 Ga0070699_10000034625 150
196 3300005518 Ga0070699_100244644 Ga0070699_1002446442 150
197 3300005518 Ga0070699_100598982 Ga0070699_1005989822 150
198 3300005535 Ga0070684_100090606 Ga0070684_1000906062 150
199 3300005536 Ga0070697_101581467 Ga0070697_1015814671 150
200 3300005539 Ga0068853_100174434 Ga0068853_1001744342 150
201 3300005543 Ga0070672_100180198 Ga0070672_1001801982 150
202 3300005543 Ga0070672_100260120 Ga0070672_1002601202 150
203 3300005543 Ga0070672_100316468 Ga0070672_1003164682 150
204 3300005543 Ga0070672_100347769 Ga0070672_1003477692 150
205 3300005543 Ga0070672_100724746 Ga0070672_1007247462 150
206 3300005544 Ga0070686_100044130 Ga0070686_1000441302 150
207 3300005544 Ga0070686_100053261 Ga0070686_1000532612 150
208 3300005544 Ga0070686_100180485 Ga0070686_1001804852 150
209 3300005544 Ga0070686_100422260 Ga0070686_1004222601 150
210 3300005545 Ga0070695_100215408 Ga0070695_1002154082 150
211 3300005545 Ga0070695_100633621 Ga0070695_1006336211 150
212 3300005545 Ga0070695_100783514 Ga0070695_1007835141 150
213 3300005546 Ga0070696_100184000 Ga0070696_1001840002 150
214 3300005546 Ga0070696_100277895 Ga0070696_1002778952 150
215 3300005546 Ga0070696_100620226 Ga0070696_1006202261 150
216 3300005547 Ga0070693_100823941 Ga0070693_1008239411 150
217 3300005548 Ga0070665_101600533 Ga0070665_1016005332 150
218 3300005549 Ga0070704_100005803 Ga0070704_1000058036 150
219 3300005549 Ga0070704_100026651 Ga0070704_1000266514 150
220 3300005549 Ga0070704_100033903 Ga0070704_1000339032 150
221 3300005549 Ga0070704_100114877 Ga0070704_1001148772 150
222 3300005549 Ga0070704_100627339 Ga0070704_1006273392 150
223 3300005564 Ga0070664_100139899 Ga0070664_1001398992 150
224 3300005564 Ga0070664_100881471 Ga0070664_1008814711 150
225 3300005564 Ga0070664_101049440 Ga0070664_1010494401 150
226 3300005577 Ga0068857_100113644 Ga0068857_1001136443 150
227 3300005577 Ga0068857_100480729 Ga0068857_1004807292 150
228 3300005577 Ga0068857_101393393 Ga0068857_1013933931 150
229 3300005578 Ga0068854_100017307 Ga0068854_1000173072 150
230 3300005578 Ga0068854_100243881 Ga0068854_1002438812 150
231 3300005578 Ga0068854_101192893 Ga0068854_1011928932 150
232 3300005615 Ga0070702_100020154 Ga0070702_1000201544 150
233 3300005615 Ga0070702_100148063 Ga0070702_1001480632 150
234 3300005616 Ga0068852_101246374 Ga0068852_1012463741 150
235 3300005617 Ga0068859_100014194 Ga0068859_1000141948 150
236 3300005617 Ga0068859_100021478 Ga0068859_1000214787 150
237 3300005617 Ga0068859_100167880 Ga0068859_1001678803 150
238 3300005617 Ga0068859_101330284 Ga0068859_1013302841 150
239 3300005618 Ga0068864_100028492 Ga0068864_1000284925 150
240 3300005618 Ga0068864_100043301 Ga0068864_1000433012 150
241 3300005618 Ga0068864_100065825 Ga0068864_1000658252 150
242 3300005618 Ga0068864_100098916 Ga0068864_1000989162 150
243 3300005618 Ga0068864_100749269 Ga0068864_1007492692 150
244 3300005618 Ga0068864_100882202 Ga0068864_1008822021 150
245 3300005718 Ga0068866_10029003 Ga0068866_100290033 150
246 3300005718 Ga0068866_10422990 Ga0068866_104229902 150
247 3300005719 Ga0068861_100004154 Ga0068861_1000041547 150
248 3300005719 Ga0068861_100278164 Ga0068861_1002781642 150
249 3300005719 Ga0068861_100316935 Ga0068861_1003169352 150
250 3300005719 Ga0068861_100580627 Ga0068861_1005806272 150
251 3300005719 Ga0068861_100613608 Ga0068861_1006136082 150
252 3300005719 Ga0068861_100771817 Ga0068861_1007718172 150
253 3300005719 Ga0068861_101049252 Ga0068861_1010492522 150
254 3300005840 Ga0068870_10004036 Ga0068870_100040362 150
255 3300005840 Ga0068870_10006336 Ga0068870_100063365 150
256 3300005840 Ga0068870_10282046 Ga0068870_102820462 150
257 3300005840 Ga0068870_10886978 Ga0068870_108869781 150
258 3300005841 Ga0068863_100105627 Ga0068863_1001056272 150
259 3300005841 Ga0068863_100284192 Ga0068863_1002841922 150
260 3300005841 Ga0068863_100291983 Ga0068863_1002919832 150
261 3300005841 Ga0068863_100985061 Ga0068863_1009850612 150
262 3300005842 Ga0068858_100042400 Ga0068858_1000424005 150
263 3300005842 Ga0068858_100105796 Ga0068858_1001057964 150
264 3300005843 Ga0068860_100098111 Ga0068860_1000981113 150
265 3300005843 Ga0068860_100468790 Ga0068860_1004687901 150
266 3300005844 Ga0068862_100004806 Ga0068862_1000048063 150
267 3300005844 Ga0068862_100382538 Ga0068862_1003825382 150
268 3300005844 Ga0068862_100571302 Ga0068862_1005713022 150
269 3300005844 Ga0068862_100757471 Ga0068862_1007574712 150
270 3300005844 Ga0068862_100934596 Ga0068862_1009345961 150
271 3300005937 Ga0081455_10313517 Ga0081455_103135171 150
272 3300005985 Ga0081539_10000093 Ga0081539_10000093177 150
273 3300005985 Ga0081539_10003103 Ga0081539_1000310316 150
274 3300005985 Ga0081539_10009296 Ga0081539_100092963 150
275 3300006058 Ga0075432_10054913 Ga0075432_100549131 150
276 3300006237 Ga0097621_100008611 Ga0097621_1000086116 150
277 3300006358 Ga0068871_100349562 Ga0068871_1003495622 150
278 3300006844 Ga0075428_100005450 Ga0075428_1000054507 150
279 3300006844 Ga0075428_100009991 Ga0075428_1000099913 150
280 3300006844 Ga0075428_100017801 Ga0075428_1000178016 150
281 3300006844 Ga0075428_100021606 Ga0075428_1000216066 150
282 3300006844 Ga0075428_100248242 Ga0075428_1002482421 150
283 3300006844 Ga0075428_100298251 Ga0075428_1002982512 150
284 3300006844 Ga0075428_100302059 Ga0075428_1003020592 150
285 3300006844 Ga0075428_101289245 Ga0075428_1012892451 150
286 3300006844 Ga0075428_101448636 Ga0075428_1014486362 150
287 3300006846 Ga0075430_100003023 Ga0075430_1000030237 150
288 3300006846 Ga0075430_100013797 Ga0075430_1000137973 150
289 3300006846 Ga0075430_100028644 Ga0075430_1000286444 150
290 3300006847 Ga0075431_100209217 Ga0075431_1002092172 150
291 3300006847 Ga0075431_100303935 Ga0075431_1003039352 150
292 3300006852 Ga0075433_10002985 Ga0075433_100029853 150
293 3300006852 Ga0075433_10004390 Ga0075433_100043908 150
294 3300006852 Ga0075433_10185718 Ga0075433_101857181 150
295 3300006852 Ga0075433_10207798 Ga0075433_102077981 150
296 3300006852 Ga0075433_10571732 Ga0075433_105717322 150
297 3300006852 Ga0075433_10932579 Ga0075433_109325791 150
298 3300006852 Ga0075433_11257827 Ga0075433_112578271 150
299 3300006871 Ga0075434_100008333 Ga0075434_10000833311 150
300 3300006871 Ga0075434_100015195 Ga0075434_1000151954 150
301 3300006871 Ga0075434_100054690 Ga0075434_1000546904 150
302 3300006871 Ga0075434_100223055 Ga0075434_1002230551 150
303 3300006880 Ga0075429_100008167 Ga0075429_1000081673 150
304 3300006880 Ga0075429_100011555 Ga0075429_1000115557 150
305 3300006880 Ga0075429_100020196 Ga0075429_1000201962 150
306 3300006880 Ga0075429_100041572 Ga0075429_1000415724 150
307 3300006880 Ga0075429_100121183 Ga0075429_1001211833 150
308 3300006881 Ga0068865_100014141 Ga0068865_1000141412 150
309 3300006881 Ga0068865_100146426 Ga0068865_1001464261 150
310 3300006881 Ga0068865_100286264 Ga0068865_1002862641 150
311 3300006881 Ga0068865_100835350 Ga0068865_1008353502 150
312 3300006931 Ga0097620_100014195 Ga0097620_1000141952 150
313 3300006931 Ga0097620_100021477 Ga0097620_1000214777 150
314 3300006931 Ga0097620_100167876 Ga0097620_1001678763 150
315 3300006931 Ga0097620_101330232 Ga0097620_1013302321 150
316 3300007076 Ga0075435_100649884 Ga0075435_1006498841 150
317 3300009094 Ga0111539_10002949 Ga0111539_100029495 150
318 3300009094 Ga0111539_10008296 Ga0111539_100082966 150
319 3300009094 Ga0111539_10055282 Ga0111539_100552824 150
320 3300009094 Ga0111539_10144509 Ga0111539_101445094 150
321 3300009094 Ga0111539_10151718 Ga0111539_101517182 150
322 3300009094 Ga0111539_11825405 Ga0111539_118254051 150
323 3300009098 Ga0105245_10425107 Ga0105245_104251072 150
324 3300009098 Ga0105245_10635105 Ga0105245_106351052 150
325 3300009101 Ga0105247_10654734 Ga0105247_106547342 150
326 3300009101 Ga0105247_10999342 Ga0105247_109993421 150
327 3300009147 Ga0114129_10002512 Ga0114129_100025127 150
328 3300009147 Ga0114129_10006480 Ga0114129_100064803 150
329 3300009147 Ga0114129_10020166 Ga0114129_100201666 150
330 3300009147 Ga0114129_10058280 Ga0114129_100582805 150
331 3300009147 Ga0114129_10081552 Ga0114129_100815522 150
332 3300009147 Ga0114129_10602392 Ga0114129_106023922 150
333 3300009147 Ga0114129_11311444 Ga0114129_113114441 150
334 3300009147 Ga0114129_11435045 Ga0114129_114350451 150
335 3300009148 Ga0105243_10019452 Ga0105243_100194522 150
336 3300009148 Ga0105243_10306392 Ga0105243_103063922 150
337 3300009148 Ga0105243_10321770 Ga0105243_103217702 150
338 3300009148 Ga0105243_11868995 Ga0105243_118689951 150
339 3300009174 Ga0105241_10763259 Ga0105241_107632592 150
340 3300009176 Ga0105242_10030024 Ga0105242_100300242 150
341 3300009176 Ga0105242_10314064 Ga0105242_103140642 150
342 3300009177 Ga0105248_10202348 Ga0105248_102023482 150
343 3300009177 Ga0105248_10791025 Ga0105248_107910252 150
344 3300009551 Ga0105238_10088527 Ga0105238_100885273 150
345 3300009551 Ga0105238_11898322 Ga0105238_118983221 150
346 3300009553 Ga0105249_10075681 Ga0105249_100756812 150
347 3300009553 Ga0105249_10294424 Ga0105249_102944241 150
348 3300009553 Ga0105249_11411517 Ga0105249_114115171 150
349 3300009553 Ga0105249_12245646 Ga0105249_122456462 150
350 3300011119 Ga0105246_10117410 Ga0105246_101174101 150
351 3300011119 Ga0105246_10488632 Ga0105246_104886322 150
352 3300013296 Ga0157374_10689506 Ga0157374_106895062 150
353 3300013297 Ga0157378_10183642 Ga0157378_101836422 150
354 3300013297 Ga0157378_11899019 Ga0157378_118990191 150
355 3300013306 Ga0163162_10566760 Ga0163162_105667602 150
356 3300013306 Ga0163162_10781136 Ga0163162_107811361 150
357 3300013308 Ga0157375_10016504 Ga0157375_100165047 150
358 3300013308 Ga0157375_10141363 Ga0157375_101413633 150
359 3300013308 Ga0157375_10477989 Ga0157375_104779892 150
360 3300013308 Ga0157375_10498893 Ga0157375_104988932 150
361 3300013308 Ga0157375_11623558 Ga0157375_116235581 150
362 3300014325 Ga0163163_10049091 Ga0163163_100490914 150
363 3300014325 Ga0163163_10064132 Ga0163163_100641324 150
364 3300014325 Ga0163163_10763121 Ga0163163_107631212 150
365 3300014325 Ga0163163_11405773 Ga0163163_114057731 150
366 3300014325 Ga0163163_12337359 Ga0163163_123373591 150
367 3300014326 Ga0157380_10162042 Ga0157380_101620422 150
368 3300014326 Ga0157380_10255773 Ga0157380_102557732 150
369 3300014326 Ga0157380_10311654 Ga0157380_103116542 150
370 3300014326 Ga0157380_10379793 Ga0157380_103797932 150
371 3300014326 Ga0157380_10403723 Ga0157380_104037232 150
372 3300014326 Ga0157380_10414134 Ga0157380_104141342 150
373 3300014326 Ga0157380_10743691 Ga0157380_107436912 150
374 3300014326 Ga0157380_10878301 Ga0157380_108783012 150
375 3300014326 Ga0157380_11046985 Ga0157380_110469851 150
376 3300014745 Ga0157377_10019480 Ga0157377_100194803 150
377 3300014745 Ga0157377_10030696 Ga0157377_100306964 150
378 3300014745 Ga0157377_10565726 Ga0157377_105657261 150
379 3300014745 Ga0157377_10825256 Ga0157377_108252561 150
380 3300014968 Ga0157379_10086776 Ga0157379_100867762 150
381 3300014968 Ga0157379_10193032 Ga0157379_101930322 150
382 3300014968 Ga0157379_10757221 Ga0157379_107572212 150
383 3300014968 Ga0157379_11010118 Ga0157379_110101181 150
384 3300014969 Ga0157376_10131979 Ga0157376_101319792 150
385 3300017792 Ga0163161_10293999 Ga0163161_102939992 150
386 3300025271 Ga0207666_1039808 Ga0207666_10398081 150
387 3300025885 Ga0207653_10215511 Ga0207653_102155111 150
388 3300025893 Ga0207682_10015369 Ga0207682_100153692 150
389 3300025893 Ga0207682_10057484 Ga0207682_100574842 150
390 3300025899 Ga0207642_10005777 Ga0207642_100057775 150
391 3300025899 Ga0207642_10244520 Ga0207642_102445201 150
392 3300025901 Ga0207688_10088323 Ga0207688_100883232 150
393 3300025903 Ga0207680_10068799 Ga0207680_100687991 150
394 3300025903 Ga0207680_10240501 Ga0207680_102405012 150
395 3300025903 Ga0207680_10294889 Ga0207680_102948892 150
396 3300025907 Ga0207645_10022058 Ga0207645_100220583 150
397 3300025907 Ga0207645_10035883 Ga0207645_100358834 150
398 3300025907 Ga0207645_10104508 Ga0207645_101045083 150
399 3300025907 Ga0207645_10136347 Ga0207645_101363472 150
400 3300025907 Ga0207645_10327414 Ga0207645_103274142 150
401 3300025908 Ga0207643_10006771 Ga0207643_100067713 150
402 3300025908 Ga0207643_10146853 Ga0207643_101468532 150
403 3300025908 Ga0207643_10151041 Ga0207643_101510412 150
404 3300025908 Ga0207643_10229929 Ga0207643_102299291 150
405 3300025908 Ga0207643_10250859 Ga0207643_102508592 150
406 3300025909 Ga0207705_10172502 Ga0207705_101725022 150
407 3300025911 Ga0207654_10601568 Ga0207654_106015681 150
408 3300025912 Ga0207707_10645978 Ga0207707_106459782 150
409 3300025915 Ga0207693_10245428 Ga0207693_102454283 150
410 3300025917 Ga0207660_10316151 Ga0207660_103161512 150
411 3300025917 Ga0207660_10769976 Ga0207660_107699761 150
412 3300025918 Ga0207662_10025161 Ga0207662_100251613 150
413 3300025918 Ga0207662_10047922 Ga0207662_100479224 150
414 3300025918 Ga0207662_10061724 Ga0207662_100617242 150
415 3300025918 Ga0207662_10074696 Ga0207662_100746964 150
416 3300025919 Ga0207657_10583476 Ga0207657_105834761 150
417 3300025920 Ga0207649_10804355 Ga0207649_108043551 150
418 3300025923 Ga0207681_10000808 Ga0207681_1000080815 150
419 3300025923 Ga0207681_10008481 Ga0207681_100084812 150
420 3300025923 Ga0207681_10017086 Ga0207681_100170865 150
421 3300025923 Ga0207681_10021640 Ga0207681_100216404 150
422 3300025924 Ga0207694_10076958 Ga0207694_100769583 150
423 3300025924 Ga0207694_10435434 Ga0207694_104354341 150
424 3300025925 Ga0207650_10704450 Ga0207650_107044502 150
425 3300025925 Ga0207650_11793782 Ga0207650_117937821 150
426 3300025926 Ga0207659_10002812 Ga0207659_1000281210 150
427 3300025926 Ga0207659_10004134 Ga0207659_100041344 150
428 3300025926 Ga0207659_10010099 Ga0207659_100100992 150
429 3300025926 Ga0207659_10064871 Ga0207659_100648712 150
430 3300025926 Ga0207659_10393879 Ga0207659_103938791 150
431 3300025926 Ga0207659_10699552 Ga0207659_106995522 150
432 3300025927 Ga0207687_10096335 Ga0207687_100963353 150
433 3300025928 Ga0207700_10002261 Ga0207700_100022612 150
434 3300025931 Ga0207644_10031474 Ga0207644_100314743 150
435 3300025931 Ga0207644_10051175 Ga0207644_100511752 150
436 3300025932 Ga0207690_10654580 Ga0207690_106545801 150
437 3300025933 Ga0207706_10011236 Ga0207706_100112369 150
438 3300025933 Ga0207706_10170550 Ga0207706_101705502 150
439 3300025934 Ga0207686_10004699 Ga0207686_100046995 150
440 3300025935 Ga0207709_10010088 Ga0207709_100100886 150
441 3300025935 Ga0207709_10195264 Ga0207709_101952642 150
442 3300025935 Ga0207709_10721056 Ga0207709_107210561 150
443 3300025936 Ga0207670_10001732 Ga0207670_100017326 150
444 3300025936 Ga0207670_10147587 Ga0207670_101475872 150
445 3300025936 Ga0207670_10160614 Ga0207670_101606141 150
446 3300025936 Ga0207670_10696855 Ga0207670_106968552 150
447 3300025937 Ga0207669_10525805 Ga0207669_105258051 150
448 3300025938 Ga0207704_10002597 Ga0207704_100025975 150
449 3300025938 Ga0207704_10190073 Ga0207704_101900732 150
450 3300025938 Ga0207704_10429905 Ga0207704_104299052 150
451 3300025940 Ga0207691_10103381 Ga0207691_101033813 150
452 3300025940 Ga0207691_10134452 Ga0207691_101344522 150
453 3300025940 Ga0207691_10186689 Ga0207691_101866892 150
454 3300025940 Ga0207691_10198837 Ga0207691_101988372 150
455 3300025940 Ga0207691_10291137 Ga0207691_102911372 150
456 3300025940 Ga0207691_10302261 Ga0207691_103022612 150
457 3300025940 Ga0207691_10357699 Ga0207691_103576992 150
458 3300025940 Ga0207691_10408049 Ga0207691_104080492 150
459 3300025940 Ga0207691_10571195 Ga0207691_105711951 150
460 3300025941 Ga0207711_10164948 Ga0207711_101649482 150
461 3300025941 Ga0207711_10541099 Ga0207711_105410992 150
462 3300025941 Ga0207711_10944810 Ga0207711_109448101 150
463 3300025942 Ga0207689_10001675 Ga0207689_100016756 150
464 3300025942 Ga0207689_10148087 Ga0207689_101480872 150
465 3300025942 Ga0207689_10399909 Ga0207689_103999091 150
466 3300025942 Ga0207689_10496726 Ga0207689_104967262 150
467 3300025944 Ga0207661_10155084 Ga0207661_101550843 150
468 3300025944 Ga0207661_10469120 Ga0207661_104691202 150
469 3300025945 Ga0207679_10463364 Ga0207679_104633642 150
470 3300025945 Ga0207679_10520742 Ga0207679_105207421 150
471 3300025945 Ga0207679_10941234 Ga0207679_109412341 150
472 3300025960 Ga0207651_10016361 Ga0207651_100163614 150
473 3300025960 Ga0207651_10099002 Ga0207651_100990022 150
474 3300025960 Ga0207651_10499219 Ga0207651_104992191 150
475 3300025960 Ga0207651_10823315 Ga0207651_108233151 150
476 3300025961 Ga0207712_10063609 Ga0207712_100636092 150
477 3300025972 Ga0207668_10008478 Ga0207668_100084782 150
478 3300025972 Ga0207668_10081904 Ga0207668_100819042 150
479 3300025981 Ga0207640_10004703 Ga0207640_100047035 150
480 3300025981 Ga0207640_10617982 Ga0207640_106179823 150
481 3300025986 Ga0207658_10077668 Ga0207658_100776683 150
482 3300025986 Ga0207658_10348445 Ga0207658_103484452 150
483 3300026023 Ga0207677_10230418 Ga0207677_102304182 150
484 3300026023 Ga0207677_10507675 Ga0207677_105076751 150
485 3300026023 Ga0207677_11897131 Ga0207677_118971311 150
486 3300026035 Ga0207703_10044024 Ga0207703_100440242 150
487 3300026035 Ga0207703_10101827 Ga0207703_101018274 150
488 3300026035 Ga0207703_10125576 Ga0207703_101255762 150
489 3300026041 Ga0207639_10417381 Ga0207639_104173812 150
490 3300026067 Ga0207678_10506344 Ga0207678_105063441 150
491 3300026075 Ga0207708_10005103 Ga0207708_100051034 150
492 3300026075 Ga0207708_10010273 Ga0207708_100102734 150
493 3300026075 Ga0207708_10045986 Ga0207708_100459864 150
494 3300026075 Ga0207708_10149826 Ga0207708_101498262 150
495 3300026075 Ga0207708_10573270 Ga0207708_105732702 150
496 3300026075 Ga0207708_10619497 Ga0207708_106194972 150
497 3300026075 Ga0207708_11267140 Ga0207708_112671402 150
498 3300026075 Ga0207708_11529075 Ga0207708_115290751 150
499 3300026088 Ga0207641_10117729 Ga0207641_101177292 150
500 3300026088 Ga0207641_10140425 Ga0207641_101404253 150
501 3300026088 Ga0207641_10626082 Ga0207641_106260821 150
502 3300026088 Ga0207641_10867943 Ga0207641_108679432 150
503 3300026089 Ga0207648_10000821 Ga0207648_1000082117 150
504 3300026089 Ga0207648_10013935 Ga0207648_100139356 150
505 3300026089 Ga0207648_10039419 Ga0207648_100394193 150
506 3300026089 Ga0207648_10512129 Ga0207648_105121291 150
507 3300026089 Ga0207648_10555160 Ga0207648_105551602 150
508 3300026095 Ga0207676_10025460 Ga0207676_100254603 150
509 3300026095 Ga0207676_10184142 Ga0207676_101841422 150
510 3300026095 Ga0207676_10453428 Ga0207676_104534282 150
511 3300026095 Ga0207676_10606196 Ga0207676_106061962 150
512 3300026116 Ga0207674_10122112 Ga0207674_101221122 150
513 3300026116 Ga0207674_10131607 Ga0207674_101316073 150
514 3300026118 Ga0207675_100004831 Ga0207675_1000048318 150
515 3300026118 Ga0207675_100013814 Ga0207675_1000138146 150
516 3300026118 Ga0207675_100052920 Ga0207675_1000529204 150
517 3300026118 Ga0207675_100114431 Ga0207675_1001144314 150
518 3300026118 Ga0207675_100214993 Ga0207675_1002149932 150
519 3300026118 Ga0207675_100692887 Ga0207675_1006928871 150
520 3300026118 Ga0207675_101160980 Ga0207675_1011609802 150
521 3300026121 Ga0207683_10082995 Ga0207683_100829954 150
522 3300026121 Ga0207683_10117126 Ga0207683_101171263 150
523 3300026121 Ga0207683_10824177 Ga0207683_108241771 150
524 3300026142 Ga0207698_10349860 Ga0207698_103498602 150
525 3300027907 Ga0207428_10000481 Ga0207428_1000048130 150
526 3300027907 Ga0207428_10000970 Ga0207428_100009708 150
527 3300027907 Ga0207428_10056353 Ga0207428_100563533 150
528 3300027907 Ga0207428_10170966 Ga0207428_101709662 150
529 3300028379 Ga0268266_10542432 Ga0268266_105424322 150
530 3300028380 Ga0268265_10001312 Ga0268265_1000131212 150
531 3300028380 Ga0268265_10075093 Ga0268265_100750933 150
532 3300028380 Ga0268265_10100289 Ga0268265_101002892 150
533 3300028380 Ga0268265_10829355 Ga0268265_108293552 150
534 3300028380 Ga0268265_10962645 Ga0268265_109626451 150
535 3300028380 Ga0268265_11625439 Ga0268265_116254391 150
536 3300028381 Ga0268264_10006226 Ga0268264_1000622610 150
537 3300028381 Ga0268264_10103656 Ga0268264_101036562 150
538 3300028381 Ga0268264_10295955 Ga0268264_102959552 150
539 3300031731 Ga0307405_10000373 Ga0307405_1000037315 150
540 3300031824 Ga0307413_10005717 Ga0307413_100057173 150
541 3300031903 Ga0307407_10017230 Ga0307407_100172304 150
542 3300031911 Ga0307412_10599294 Ga0307412_105992941 150
543 3300031995 Ga0307409_100001999 Ga0307409_1000019994 150
544 3300032002 Ga0307416_100004987 Ga0307416_1000049874 150
545 3300032002 Ga0307416_100301358 Ga0307416_1003013582 150
546 3300032002 Ga0307416_102768685 Ga0307416_1027686851 150
547 3300032002 Ga0307416_103712252 Ga0307416_1037122521 150
548 3300032004 Ga0307414_10303691 Ga0307414_103036912 150
549 3300032004 Ga0307414_11052975 Ga0307414_110529751 150
550 3300032005 Ga0307411_10000802 Ga0307411_100008026 150
551 3300032005 Ga0307411_11247972 Ga0307411_112479722 150
552 3300032126 Ga0307415_100004066 Ga0307415_1000040666 150
553 3300032126 Ga0307415_101553850 Ga0307415_1015538502 150
554 3300034820 Ga0373959_0015313 Ga0373959_0015313_142_594 150
555 3300035112 Ga0373932_0163765 Ga0373932_0163765_225_677 150
556 3300035114 Ga0373939_0059451 Ga0373939_0059451_711_1163 150
557 3300035115 Ga0373941_0164965 Ga0373941_0164965_227_679 150
558 3300035241 Ga0373961_0107096 Ga0373961_0107096_132_584 150
559 3300041999 Ga0439433_0026136 Ga0439433_0026136_101_553 150
560 3300042122 Ga0450920_076491 Ga0450920_076491_49_513 150
561 3300042156 Ga0439446_0227042 Ga0439446_0227042_63_515 150
562 3300042435 Ga0439434_0114643 Ga0439434_0114643_284_736 150
563 3300042436 Ga0439435_0113912 Ga0439435_0113912_174_626 150
564 3300045051 Ga0451576_0025664 Ga0451576_0025664_3994_4446 150
565 3300045051 Ga0451576_1033293 Ga0451576_1033293_332_784 150
566 3300046455 Ga0495603_0031048 Ga0495603_0031048_509_961 150
567 3300046459 Ga0495629_0006203 Ga0495629_0006203_3321_3773 150
568 3300046522 Ga0495643_0005513 Ga0495643_0005513_39_491 150
569 3300046537 Ga0495598_0009727 Ga0495598_0009727_234_698 150
570 3300046537 Ga0495598_0103795 Ga0495598_0103795_75_539 150
571 3300046539 Ga0495621_0013691 Ga0495621_0013691_1693_2145 150
572 3300046539 Ga0495621_0122556 Ga0495621_0122556_185_652 150
573 3300046557 Ga0495622_0141061 Ga0495622_0141061_64_516 150
574 3300046615 Ga0495656_0124054 Ga0495656_0124054_414_866 150
575 3300046664 Ga0495659_0297277 Ga0495659_0297277_83_535 150
576 3300046683 Ga0495658_0031816 Ga0495658_0031816_738_1190 150
577 3300046684 Ga0495669_0011491 Ga0495669_0011491_2281_2745 150
578 3300046691 Ga0495670_0156981 Ga0495670_0156981_28_480 150
579 3300046691 Ga0495670_0569153 Ga0495670_0569153_68_520 150
580 3300047318 Ga0495636_0138170 Ga0495636_0138170_466_987 150
581 3300047445 Ga0495677_0023572 Ga0495677_0023572_89_541 150
582 3300047445 Ga0495677_0223705 Ga0495677_0223705_125_577 150
583 3300048910 Ga0496107_0971959 Ga0496107_0971959_120_572 150
584 3300048913 Ga0496110_1516892 Ga0496110_1516892_77_529 150
585 3300049513 Ga0501290_059565 Ga0501290_059565_124_576 150
586 3300049572 Ga0501036_0073556 Ga0501036_0073556_256_708 150
587 3300049573 Ga0501037_0122483 Ga0501037_0122483_1394_1846 150
588 3300049574 Ga0501038_0100938 Ga0501038_0100938_1225_1677 150
589 3300049575 Ga0501039_0023930 Ga0501039_0023930_3555_4007 150
590 3300049576 Ga0501040_0019567 Ga0501040_0019567_287_739 150
591 3300049577 Ga0501041_0070777 Ga0501041_0070777_222_674 150
592 3300049578 Ga0501042_0020239 Ga0501042_0020239_1991_2443 150
593 3300049580 Ga0501046_0814032 Ga0501046_0814032_169_621 150
594 3300049584 Ga0501068_0145437 Ga0501068_0145437_758_1264 150
595 3300049587 Ga0501071_0098767 Ga0501071_0098767_1106_1558 150
596 3300049588 Ga0501072_0008960 Ga0501072_0008960_5660_6112 150
597 3300049589 Ga0501073_0369955 Ga0501073_0369955_291_743 150
598 3300049591 Ga0501075_0108498 Ga0501075_0108498_1280_1732 150
599 3300049591 Ga0501075_0412269 Ga0501075_0412269_64_516 150
600 3300049592 Ga0501076_0232413 Ga0501076_0232413_139_591 150
601 3300049652 Ga0501202_115559 Ga0501202_115559_55_507 150
602 3300049655 Ga0501208_024244 Ga0501208_024244_31_483 150
603 3300049668 Ga0501233_030548 Ga0501233_030548_229_681 150
604 3300049677 Ga0501247_053533 Ga0501247_053533_103_555 150
605 3300049679 Ga0501249_030948 Ga0501249_030948_558_1010 150
606 3300049759 Ga0501262_095629 Ga0501262_095629_43_495 150
607 3300049779 Ga0501283_042187 Ga0501283_042187_296_748 150
608 3300049822 Ga0501035_1042651 Ga0501035_1042651_63_515 150
609 3300049850 Ga0501204_090005 Ga0501204_090005_53_505 150
610 3300050507 nmdc:mga05p37_1033_c1 nmdc:mga05p37_1033_c1_29420_29938 150
611 3300050507 nmdc:mga05p37_132646_c1 nmdc:mga05p37_132646_c1_2226_2678 150
612 3300050507 nmdc:mga05p37_1358601_c1 nmdc:mga05p37_1358601_c1_166_618 150
613 3300050507 nmdc:mga05p37_27001_c1 nmdc:mga05p37_27001_c1_5260_5712 150
614 3300050507 nmdc:mga05p37_38368_c1 nmdc:mga05p37_38368_c1_1304_1768 150
615 3300050507 nmdc:mga05p37_397353_c1 nmdc:mga05p37_397353_c1_641_1093 150
616 3300050507 nmdc:mga05p37_468125_c1 nmdc:mga05p37_468125_c1_37_543 150
617 3300050507 nmdc:mga05p37_496087_c1 nmdc:mga05p37_496087_c1_926_1378 150
618 3300050507 nmdc:mga05p37_636104_c1 nmdc:mga05p37_636104_c1_58_522 150
619 3300050508 nmdc:mga09592_11525_c1 nmdc:mga09592_11525_c1_1429_1881 150
620 3300050508 nmdc:mga09592_131667_c1 nmdc:mga09592_131667_c1_274_792 150
621 3300050508 nmdc:mga09592_153835_c1 nmdc:mga09592_153835_c1_617_1069 150
622 3300050508 nmdc:mga09592_185942_c1 nmdc:mga09592_185942_c1_723_1262 150
623 3300050508 nmdc:mga09592_48273_c1 nmdc:mga09592_48273_c1_1233_1685 150
624 3300050508 nmdc:mga09592_48348_c1 nmdc:mga09592_48348_c1_2823_3287 150
625 3300050509 nmdc:mga0qj67_115828_c1 nmdc:mga0qj67_115828_c1_1019_1525 150
626 3300050509 nmdc:mga0qj67_116314_c1 nmdc:mga0qj67_116314_c1_1348_1800 150
627 3300050510 nmdc:mga06r32_1619788_c1 nmdc:mga06r32_1619788_c1_30_569 150
628 3300050510 nmdc:mga06r32_413294_c1 nmdc:mga06r32_413294_c1_229_681 150
629 3300050510 nmdc:mga06r32_45223_c1 nmdc:mga06r32_45223_c1_947_1453 150
630 3300050510 nmdc:mga06r32_65525_c1 nmdc:mga06r32_65525_c1_2784_3248 150
631 3300050511 nmdc:mga08y16_1215_c1 nmdc:mga08y16_1215_c1_23588_24040 150
632 3300050511 nmdc:mga08y16_13461_c1 nmdc:mga08y16_13461_c1_711_1163 150
633 3300050511 nmdc:mga08y16_14693_c1 nmdc:mga08y16_14693_c1_2076_2528 150
634 3300050511 nmdc:mga08y16_1646_c1 nmdc:mga08y16_1646_c1_19658_20197 150
635 3300050511 nmdc:mga08y16_5683_c1 nmdc:mga08y16_5683_c1_4639_5091 150
636 3300050511 nmdc:mga08y16_573188_c1 nmdc:mga08y16_573188_c1_107_559 150
637 3300050511 nmdc:mga08y16_821661_c1 nmdc:mga08y16_821661_c1_355_819 150
638 3300050511 nmdc:mga08y16_98651_c1 nmdc:mga08y16_98651_c1_2484_2936 150
639 3300050512 nmdc:mga0n895_1316_c1 nmdc:mga0n895_1316_c1_7097_7561 150
640 3300050513 nmdc:mga0rr50_70205_c1 nmdc:mga0rr50_70205_c1_349_813 150
641 3300050514 nmdc:mga08x19_710466_c1 nmdc:mga08x19_710466_c1_119_583 150
642 3300050515 nmdc:mga0a205_1529_c1 nmdc:mga0a205_1529_c1_2475_2927 150
643 3300050515 nmdc:mga0a205_1881_c1 nmdc:mga0a205_1881_c1_7613_8077 150
644 3300050515 nmdc:mga0a205_308785_c1 nmdc:mga0a205_308785_c1_854_1306 150
645 3300050515 nmdc:mga0a205_818119_c1 nmdc:mga0a205_818119_c1_105_611 150
646 3300050515 nmdc:mga0a205_863929_c1 nmdc:mga0a205_863929_c1_255_707 150
647 3300050515 nmdc:mga0a205_95165_c1 nmdc:mga0a205_95165_c1_1472_1990 150
648 3300050515 nmdc:mga0a205_971242_c1 nmdc:mga0a205_971242_c1_84_551 150
649 3300054114 Ga0501084_0106447 Ga0501084_0106447_1286_1738 150
650 3300054114 Ga0501084_0547156 Ga0501084_0547156_422_874 150
651 3300059421 Ga0590071_000286 Ga0590071_000286_6595_7047 150
652 3300059423 Ga0590074_005354 Ga0590074_005354_1415_1867 150
653 3300059424 Ga0590075_003143 Ga0590075_003143_2743_3195 150
654 3300059426 Ga0590077_000879 Ga0590077_000879_3842_4294 150
655 3300060353 Ga0501082_0264201 Ga0501082_0264201_70_522 150
656 3300060353 Ga0501082_1339368 Ga0501082_1339368_49_501 150
657 3300061734 Ga0530510_0002864 Ga0530510_0002864_6182_6634 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02381

MraZ

MraZ protein, putative antitoxin-like

83

141

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.9009 5 144
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.8655 5 144
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.5517 4 122
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.4949 4 122
6zqh-assembly2.cif.gz_C yeast uba1 in complex with ubiquitin 0.4555 9 123
ID Description Score Start End Superfamily
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.891 6 133 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.881 3 144 3.40.1550.20
af_P22186_1_143_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8732 6 135 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8523 6 148 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8207 3 144 3.40.1550.20
ID Description Score Start End GO Terms
AF-A0A2V8HQF4-F1-model_v4 Transcriptional regulator MraZ 0.9625 1 150 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2V8YFG5-F1-model_v4 Transcriptional regulator MraZ 0.9565 5 125 GO:0000976
GO:0003700
GO:0005737
GO:2000143
AF-A0A2V8HQF4-F1-model_v4 Transcriptional regulator MraZ 0.9562 1 150 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A1Q7JWI9-F1-model_v4 Transcriptional regulator MraZ 0.9533 6 150 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A7W1PAG8-F1-model_v4 Transcriptional regulator MraZ 0.9515 6 126 GO:0000976
GO:0003700
GO:0005737
GO:2000143

Feature Viewer

pLDDT pTM Quality
93.79 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map