F473094

General Info

Members Datasets Scaffolds Average Seq Length
657 328 1314 160

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_11186275|Ga0157380_111862752
Length 193
Sequence VNEERLWAPWRLQYVTGGESSAEKAPQPKRWLAGADESCFLCRAAADFADTGNADKQLLVVERGKAALVVLNRYPYNNGHLLIAPRRHVGDLSGMTREEHVECMEFLAQLTNVYRKCLNADGFNVGLNLGRVAGAGLPGHLHWHLVPRWAGDNNFMPVLAGTRVIPQSLDELWQMLTDAMRDSNCGGGASTNG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
226 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
236 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
242 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
248 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
291 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 2.13
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.59
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_11186275 3300014326 Unclassified 806
2 JGI24752J21851_1022861 3300001976 Bacteria 818
3 JGI24737J22298_10027537 3300001990 Bacteria 1791
4 JGI24750J21931_1003838 3300002070 Bacteria 1809
5 JGI24749J21850_1002136 3300002076 Bacteria 2792
6 JGI24742J22300_10053947 3300002244 Bacteria 731
7 rootH1_10221425 3300003323 Unclassified 2049
8 JGI25404J52841_10002039 3300003659 Bacteria 3738
9 JGI25404J52841_10069771 3300003659 Bacteria 734
10 Ga0058860_10663497 3300004801 Unclassified 1673
11 Ga0065704_10082627 3300005289 Bacteria 3574
12 Ga0065712_10109316 3300005290 Bacteria 1857
13 Ga0065715_10133942 3300005293 Bacteria 1963
14 Ga0070658_10000383 3300005327 Bacteria 38683
15 Ga0070676_10000325 3300005328 Bacteria 21619
16 Ga0070683_100074351 3300005329 Bacteria 3174
17 Ga0070683_100093019 3300005329 Bacteria 2832
18 Ga0070683_100458296 3300005329 Bacteria 1217
19 Ga0070683_101076066 3300005329 Bacteria 772
20 Ga0070690_100000248 3300005330 Bacteria 27944
21 Ga0070670_100001244 3300005331 Bacteria 20273
22 Ga0070670_100611737 3300005331 Bacteria 976
23 Ga0070670_100673622 3300005331 Unclassified 929
24 Ga0070677_10007700 3300005333 Bacteria 3605
25 Ga0070677_10317877 3300005333 Bacteria 796
26 Ga0068869_100000333 3300005334 Bacteria 25133
27 Ga0068869_100356822 3300005334 Bacteria 1193
28 Ga0070666_10000167 3300005335 Bacteria 45197
29 Ga0070680_100011775 3300005336 Bacteria 6784
30 Ga0070680_100556974 3300005336 Bacteria 983
31 Ga0070680_100644428 3300005336 Bacteria 910
32 Ga0068868_100002657 3300005338 Bacteria 12402
33 Ga0068868_100141529 3300005338 Bacteria 1975
34 Ga0070660_100001099 3300005339 Bacteria 18182
35 Ga0070689_100000120 3300005340 Bacteria 45009
36 Ga0070689_100229229 3300005340 Bacteria 1526
37 Ga0070689_100293564 3300005340 Bacteria 1351
38 Ga0070691_10037317 3300005341 Bacteria 2292
39 Ga0070687_100000258 3300005343 Bacteria 18025
40 Ga0070661_100000105 3300005344 Bacteria 69414
41 Ga0070661_100015055 3300005344 Bacteria 5456
42 Ga0070692_10000685 3300005345 Bacteria 10872
43 Ga0070668_100000174 3300005347 Bacteria 41157
44 Ga0070668_100977849 3300005347 Bacteria 760
45 Ga0070668_101020589 3300005347 Unclassified 744
46 Ga0070669_100000253 3300005353 Bacteria 44029
47 Ga0070669_100224110 3300005353 Bacteria 1487
48 Ga0070669_100381283 3300005353 Bacteria 1150
49 Ga0070669_101212050 3300005353 Bacteria 652
50 Ga0070675_100001059 3300005354 Bacteria 19820
51 Ga0070675_100163146 3300005354 Bacteria 1918
52 Ga0070675_100272511 3300005354 Bacteria 1485
53 Ga0070675_100611071 3300005354 Bacteria 989
54 Ga0070671_100000508 3300005355 Bacteria 27202
55 Ga0070671_100396167 3300005355 Bacteria 1181
56 Ga0070674_100000080 3300005356 Bacteria 44571
57 Ga0070673_100000357 3300005364 Bacteria 23968
58 Ga0070673_100455359 3300005364 Bacteria 1151
59 Ga0070688_100000754 3300005365 Bacteria 15958
60 Ga0070688_100076787 3300005365 Bacteria 2150
61 Ga0070659_100000193 3300005366 Bacteria 46868
62 Ga0070667_100003456 3300005367 Bacteria 13456
63 Ga0070714_100089511 3300005435 Bacteria 2694
64 Ga0070714_100478920 3300005435 Bacteria 1185
65 Ga0070713_101287208 3300005436 Bacteria 708
66 Ga0070701_10036337 3300005438 Bacteria 2481
67 Ga0070701_10506237 3300005438 Bacteria 785
68 Ga0070711_100040136 3300005439 Bacteria 3155
69 Ga0070705_100001045 3300005440 Bacteria 15428
70 Ga0070705_100508858 3300005440 Unclassified 916
71 Ga0070700_100032155 3300005441 Bacteria 3151
72 Ga0070700_101224006 3300005441 Bacteria 628
73 Ga0070694_100844336 3300005444 Bacteria 753
74 Ga0070708_100001945 3300005445 Bacteria 15948
75 Ga0070708_100002876 3300005445 Bacteria 13361
76 Ga0070708_100009410 3300005445 Bacteria 7879
77 Ga0070708_100016856 3300005445 Bacteria 6074
78 Ga0070708_100201819 3300005445 Bacteria 1862
79 Ga0070708_100259559 3300005445 Bacteria 1633
80 Ga0070708_100343643 3300005445 Bacteria 1406
81 Ga0070708_100613954 3300005445 Bacteria 1025
82 Ga0070663_100004905 3300005455 Bacteria 7898
83 Ga0070678_100000042 3300005456 Bacteria 43046
84 Ga0070678_100756832 3300005456 Bacteria 879
85 Ga0070662_100000445 3300005457 Bacteria 24422
86 Ga0070662_100391864 3300005457 Bacteria 1145
87 Ga0070681_10148202 3300005458 Bacteria 2274
88 Ga0070681_10656275 3300005458 Bacteria 964
89 Ga0068867_100003990 3300005459 Bacteria 10384
90 Ga0068867_100712388 3300005459 Bacteria 887
91 Ga0068867_100772054 3300005459 Bacteria 855
92 Ga0068867_100915529 3300005459 Bacteria 790
93 Ga0070685_10000294 3300005466 Bacteria 31544
94 Ga0070706_100002680 3300005467 Bacteria 17836
95 Ga0070706_100011110 3300005467 Bacteria 8363
96 Ga0070706_100012048 3300005467 Archaea 8023
97 Ga0070706_100016319 3300005467 Bacteria 6860
98 Ga0070706_100025617 3300005467 Bacteria 5429
99 Ga0070706_100041605 3300005467 Bacteria 4242
100 Ga0070706_100274184 3300005467 Bacteria 1574
101 Ga0070706_100989523 3300005467 Bacteria 776
102 Ga0070706_101676694 3300005467 Bacteria 579
103 Ga0070707_100000267 3300005468 Bacteria 51869
104 Ga0070707_100001441 3300005468 Bacteria 23286
105 Ga0070707_100001570 3300005468 Bacteria 22135
106 Ga0070707_100019424 3300005468 Bacteria 6402
107 Ga0070707_100038517 3300005468 Bacteria 4566
108 Ga0070707_100048540 3300005468 Unclassified 4066
109 Ga0070707_100109712 3300005468 Bacteria 2676
110 Ga0070707_100468110 3300005468 Bacteria 1221
111 Ga0070707_100503039 3300005468 Unclassified 1173
112 Ga0070707_100787137 3300005468 Bacteria 915
113 Ga0070707_100968489 3300005468 Unclassified 816
114 Ga0070707_101090283 3300005468 Bacteria 764
115 Ga0070698_100000619 3300005471 Bacteria 38232
116 Ga0070698_100000908 3300005471 Bacteria 32511
117 Ga0070698_100025724 3300005471 Bacteria 6131
118 Ga0070698_100137330 3300005471 Bacteria 2398
119 Ga0070698_100210525 3300005471 Bacteria 1879
120 Ga0070698_100324756 3300005471 Bacteria 1470
121 Ga0070698_100362210 3300005471 Unclassified 1382
122 Ga0070698_100465346 3300005471 Bacteria 1200
123 Ga0070698_100807767 3300005471 Bacteria 882
124 Ga0070699_100000282 3300005518 Bacteria 48573
125 Ga0070699_100070121 3300005518 Bacteria 3047
126 Ga0070699_100239984 3300005518 Bacteria 1617
127 Ga0070699_100286506 3300005518 Bacteria 1476
128 Ga0070699_100793170 3300005518 Unclassified 867
129 Ga0070699_100925622 3300005518 Bacteria 799
130 Ga0070699_101529438 3300005518 Bacteria 612
131 Ga0070679_100023777 3300005530 Bacteria 6003
132 Ga0070679_101008057 3300005530 Bacteria 777
133 Ga0070679_101359685 3300005530 Unclassified 656
134 Ga0070684_100010789 3300005535 Bacteria 7255
135 Ga0070684_100039181 3300005535 Bacteria 4075
136 Ga0070684_100373103 3300005535 Bacteria 1314
137 Ga0070684_100373567 3300005535 Bacteria 1313
138 Ga0070697_100000094 3300005536 Bacteria 74936
139 Ga0070697_100000120 3300005536 Bacteria 61983
140 Ga0070697_100001660 3300005536 Bacteria 16967
141 Ga0070697_100013022 3300005536 Bacteria 6520
142 Ga0070697_100024671 3300005536 Bacteria 4789
143 Ga0070697_100126797 3300005536 Bacteria 2138
144 Ga0070697_100208783 3300005536 Bacteria 1662
145 Ga0070697_101493838 3300005536 Bacteria 604
146 Ga0068853_100005351 3300005539 Bacteria 10052
147 Ga0068853_100029355 3300005539 Bacteria 4635
148 Ga0070672_100000203 3300005543 Bacteria 32969
149 Ga0070672_100373437 3300005543 Bacteria 1219
150 Ga0070672_100945881 3300005543 Unclassified 762
151 Ga0070686_100000529 3300005544 Bacteria 22812
152 Ga0070686_100529056 3300005544 Bacteria 919
153 Ga0070686_101683435 3300005544 Unclassified 538
154 Ga0070695_100007568 3300005545 Bacteria 6435
155 Ga0070696_100024690 3300005546 Bacteria 4086
156 Ga0070693_100092388 3300005547 Bacteria 1827
157 Ga0070665_100003033 3300005548 Bacteria 18094
158 Ga0070665_100199396 3300005548 Bacteria 2002
159 Ga0068855_100001142 3300005563 Bacteria 32901
160 Ga0068855_100297465 3300005563 Bacteria 1788
161 Ga0070664_100000784 3300005564 Bacteria 24485
162 Ga0070664_100005167 3300005564 Bacteria 10477
163 Ga0070664_101837070 3300005564 Bacteria 575
164 Ga0068857_100000030 3300005577 Bacteria 76781
165 Ga0068857_100008452 3300005577 Bacteria 8898
166 Ga0068857_100258120 3300005577 Bacteria 1599
167 Ga0068854_100000163 3300005578 Bacteria 45832
168 Ga0068856_100000467 3300005614 Bacteria 44679
169 Ga0068856_100345833 3300005614 Bacteria 1506
170 Ga0070702_100061406 3300005615 Bacteria 2188
171 Ga0068852_100000141 3300005616 Bacteria 48354
172 Ga0068859_100000568 3300005617 Bacteria 36755
173 Ga0068859_100265227 3300005617 Bacteria 1809
174 Ga0068859_100284693 3300005617 Bacteria 1746
175 Ga0068859_100441837 3300005617 Bacteria 1397
176 Ga0068864_100000372 3300005618 Bacteria 39027
177 Ga0068866_10000363 3300005718 Bacteria 21358
178 Ga0068866_10748860 3300005718 Bacteria 675
179 Ga0068861_100000395 3300005719 Bacteria 25164
180 Ga0068861_101348627 3300005719 Bacteria 695
181 Ga0068851_10000085 3300005834 Bacteria 51798
182 Ga0068870_10000044 3300005840 Bacteria 38135
183 Ga0068870_10231197 3300005840 Unclassified 1137
184 Ga0068863_100001310 3300005841 Bacteria 24822
185 Ga0068858_100005163 3300005842 Bacteria 12787
186 Ga0068858_100006586 3300005842 Bacteria 11299
187 Ga0068858_100079237 3300005842 Bacteria 3053
188 Ga0068858_100090037 3300005842 Bacteria 2855
189 Ga0068858_100445293 3300005842 Bacteria 1248
190 Ga0068858_100638510 3300005842 Bacteria 1034
191 Ga0068860_100001227 3300005843 Bacteria 27950
192 Ga0068860_100302564 3300005843 Unclassified 1567
193 Ga0068860_101039050 3300005843 Bacteria 838
194 Ga0068860_101580699 3300005843 Bacteria 678
195 Ga0068862_100001443 3300005844 Bacteria 21912
196 Ga0068862_100788407 3300005844 Bacteria 927
197 Ga0081455_10042450 3300005937 Unclassified 3988
198 Ga0081540_1000146 3300005983 Bacteria 72830
199 Ga0081540_1001220 3300005983 Bacteria 22449
200 Ga0081540_1001293 3300005983 Bacteria 21848
201 Ga0081539_10075488 3300005985 Unclassified 1790
202 Ga0070717_10005942 3300006028 Bacteria 8937
203 Ga0070717_10026540 3300006028 Bacteria 4620
204 Ga0070717_10121341 3300006028 Unclassified 2239
205 Ga0070717_10298978 3300006028 Bacteria 1431
206 Ga0070716_100118299 3300006173 Unclassified 1654
207 Ga0070712_100083480 3300006175 Unclassified 2320
208 Ga0070712_101151693 3300006175 Bacteria 674
209 Ga0097621_100000123 3300006237 Bacteria 44466
210 Ga0097621_100918150 3300006237 Bacteria 816
211 Ga0097621_101210253 3300006237 Bacteria 712
212 Ga0068871_100007148 3300006358 Bacteria 7964
213 Ga0068871_100404813 3300006358 Bacteria 1216
214 Ga0075428_100019832 3300006844 Bacteria 7441
215 Ga0075428_100023582 3300006844 Bacteria 6812
216 Ga0075428_100041379 3300006844 Bacteria 5068
217 Ga0075428_100518430 3300006844 Bacteria 1275
218 Ga0075428_100908788 3300006844 Bacteria 934
219 Ga0075430_100257099 3300006846 Bacteria 1446
220 Ga0075430_100468388 3300006846 Unclassified 1040
221 Ga0075431_100023358 3300006847 Bacteria 6326
222 Ga0075433_10014128 3300006852 Bacteria 6513
223 Ga0075433_10019240 3300006852 Bacteria 5686
224 Ga0075433_10043164 3300006852 Bacteria 3914
225 Ga0075433_10402347 3300006852 Bacteria 1208
226 Ga0075433_10434298 3300006852 Bacteria 1158
227 Ga0075434_100004129 3300006871 Bacteria 13023
228 Ga0075434_100368739 3300006871 Bacteria 1457
229 Ga0075434_100422056 3300006871 Bacteria 1355
230 Ga0075434_101904799 3300006871 Unclassified 600
231 Ga0075429_100217051 3300006880 Bacteria 1676
232 Ga0075429_100313078 3300006880 Bacteria 1374
233 Ga0075429_100649975 3300006880 Bacteria 924
234 Ga0068865_100000083 3300006881 Bacteria 50777
235 Ga0097620_100000568 3300006931 Bacteria 36755
236 Ga0097620_100265218 3300006931 Bacteria 1809
237 Ga0097620_100284704 3300006931 Bacteria 1746
238 Ga0097620_100441882 3300006931 Bacteria 1397
239 Ga0075435_100105347 3300007076 Bacteria 2341
240 Ga0105251_10232567 3300009011 Bacteria 830
241 Ga0105250_10070038 3300009092 Bacteria 1416
242 Ga0105240_10004652 3300009093 Bacteria 20780
243 Ga0105240_10256947 3300009093 Bacteria 2017
244 Ga0111539_10002301 3300009094 Bacteria 25380
245 Ga0111539_10004853 3300009094 Bacteria 17520
246 Ga0111539_10666302 3300009094 Unclassified 1212
247 Ga0111539_10954658 3300009094 Unclassified 997
248 Ga0105245_10003337 3300009098 Bacteria 14400
249 Ga0105245_10240617 3300009098 Bacteria 1754
250 Ga0105245_10648204 3300009098 Bacteria 1086
251 Ga0105247_10000362 3300009101 Bacteria 38746
252 Ga0105247_10006004 3300009101 Bacteria 7564
253 Ga0114129_10008249 3300009147 Bacteria 14856
254 Ga0114129_10021845 3300009147 Bacteria 9084
255 Ga0114129_10021897 3300009147 Bacteria 9072
256 Ga0114129_10044462 3300009147 Bacteria 6248
257 Ga0114129_10125057 3300009147 Bacteria 3536
258 Ga0114129_10337879 3300009147 Bacteria 1998
259 Ga0114129_12110867 3300009147 Bacteria 679
260 Ga0114129_12925125 3300009147 Bacteria 564
261 Ga0105243_10004616 3300009148 Bacteria 10861
262 Ga0105243_10565548 3300009148 Bacteria 1089
263 Ga0105241_10001541 3300009174 Bacteria 17672
264 Ga0105242_10006111 3300009176 Bacteria 9285
265 Ga0105242_10757321 3300009176 Bacteria 957
266 Ga0105242_11719771 3300009176 Bacteria 664
267 Ga0105248_10001954 3300009177 Bacteria 22910
268 Ga0105248_10190653 3300009177 Bacteria 2310
269 Ga0105248_10808698 3300009177 Bacteria 1058
270 Ga0105248_11085208 3300009177 Bacteria 905
271 Ga0105248_11355044 3300009177 Bacteria 805
272 Ga0105238_10161991 3300009551 Bacteria 2213
273 Ga0105249_10000314 3300009553 Bacteria 48917
274 Ga0105249_10331333 3300009553 Bacteria 1536
275 Ga0105249_11159096 3300009553 Bacteria 844
276 Ga0105239_10004805 3300010375 Bacteria 16038
277 Ga0105239_10226175 3300010375 Bacteria 2099
278 Ga0105239_10274058 3300010375 Bacteria 1898
279 Ga0105239_11379176 3300010375 Unclassified 814
280 Ga0105246_10003678 3300011119 Bacteria 9283
281 Ga0157373_10003295 3300013100 Bacteria 12198
282 Ga0157371_10000469 3300013102 Bacteria 49213
283 Ga0157371_10467480 3300013102 Bacteria 929
284 Ga0157369_10000283 3300013105 Bacteria 67918
285 Ga0157374_10000543 3300013296 Bacteria 33654
286 Ga0157378_10001087 3300013297 Bacteria 24850
287 Ga0157378_12053285 3300013297 Bacteria 622
288 Ga0163162_10004349 3300013306 Bacteria 13636
289 Ga0163162_10346668 3300013306 Bacteria 1618
290 Ga0157372_10144029 3300013307 Bacteria 2748
291 Ga0157375_10000432 3300013308 Bacteria 37799
292 Ga0163163_10038558 3300014325 Bacteria 4658
293 Ga0163163_10418435 3300014325 Bacteria 1399
294 Ga0163163_10580656 3300014325 Unclassified 1184
295 Ga0163163_10752861 3300014325 Bacteria 1038
296 Ga0163163_11760632 3300014325 Bacteria 680
297 Ga0157380_10131810 3300014326 Bacteria 2134
298 Ga0157380_10248585 3300014326 Bacteria 1608
299 Ga0157380_10369588 3300014326 Bacteria 1349
300 Ga0157380_11047796 3300014326 Bacteria 852
301 Ga0157380_11091116 3300014326 Bacteria 837
302 Ga0157377_10000225 3300014745 Bacteria 29632
303 Ga0157379_10000134 3300014968 Bacteria 52837
304 Ga0157379_10021018 3300014968 Bacteria 5777
305 Ga0157379_10783743 3300014968 Unclassified 899
306 Ga0157376_10001015 3300014969 Bacteria 18320
307 Ga0163161_10004329 3300017792 Bacteria 9895
308 Ga0197907_10153404 3300020069 Bacteria 2230
309 Ga0197907_11337912 3300020069 Bacteria 1042
310 Ga0206356_10120151 3300020070 Bacteria 1891
311 Ga0206355_1283185 3300020076 Bacteria 1264
312 Ga0206351_10454161 3300020077 Bacteria 1659
313 Ga0206352_10620901 3300020078 Unclassified 2287
314 Ga0206350_10069905 3300020080 Bacteria 1031
315 Ga0206350_10686549 3300020080 Bacteria 1667
316 Ga0154015_1323244 3300020610 Bacteria 1243
317 Ga0213874_10007554 3300021377 Bacteria 2613
318 Ga0213875_10000026 3300021388 Bacteria 196301
319 Ga0213875_10002736 3300021388 Bacteria 10407
320 Ga0224712_10006078 3300022467 Bacteria 3415
321 Ga0224712_10017682 3300022467 Bacteria 2369
322 Ga0224712_10162172 3300022467 Bacteria 998
323 Ga0207656_10003259 3300025321 Bacteria 5555
324 Ga0207682_10000599 3300025893 Bacteria 16723
325 Ga0207682_10109469 3300025893 Bacteria 1215
326 Ga0207642_10000429 3300025899 Bacteria 12666
327 Ga0207710_10003119 3300025900 Bacteria 7426
328 Ga0207688_10000178 3300025901 Bacteria 28121
329 Ga0207680_10000343 3300025903 Bacteria 22221
330 Ga0207647_10001951 3300025904 Bacteria 15753
331 Ga0207699_10082065 3300025906 Unclassified 2002
332 Ga0207699_10492468 3300025906 Bacteria 884
333 Ga0207645_10000200 3300025907 Bacteria 48892
334 Ga0207643_10000141 3300025908 Bacteria 48956
335 Ga0207705_10015550 3300025909 Bacteria 5461
336 Ga0207684_10000206 3300025910 Bacteria 91347
337 Ga0207684_10001368 3300025910 Bacteria 26629
338 Ga0207684_10001386 3300025910 Bacteria 26364
339 Ga0207684_10001766 3300025910 Archaea 22836
340 Ga0207684_10022914 3300025910 Bacteria 5333
341 Ga0207684_10023815 3300025910 Bacteria 5225
342 Ga0207684_10136442 3300025910 Bacteria 2107
343 Ga0207684_10194084 3300025910 Bacteria 1751
344 Ga0207684_10684288 3300025910 Bacteria 872
345 Ga0207684_11191327 3300025910 Bacteria 631
346 Ga0207654_10004241 3300025911 Bacteria 7230
347 Ga0207695_10098408 3300025913 Bacteria 2924
348 Ga0207695_10146606 3300025913 Bacteria 2304
349 Ga0207695_10529293 3300025913 Bacteria 1060
350 Ga0207671_10001428 3300025914 Bacteria 27690
351 Ga0207693_10115693 3300025915 Bacteria 2105
352 Ga0207662_10000043 3300025918 Bacteria 56727
353 Ga0207657_10000349 3300025919 Bacteria 49009
354 Ga0207657_10195273 3300025919 Bacteria 1631
355 Ga0207649_10002013 3300025920 Bacteria 11568
356 Ga0207649_10022447 3300025920 Bacteria 3646
357 Ga0207652_10036919 3300025921 Bacteria 4133
358 Ga0207652_10763731 3300025921 Bacteria 860
359 Ga0207646_10000558 3300025922 Bacteria 49003
360 Ga0207646_10001813 3300025922 Bacteria 25853
361 Ga0207646_10002187 3300025922 Bacteria 23311
362 Ga0207646_10003091 3300025922 Bacteria 19142
363 Ga0207646_10005669 3300025922 Bacteria 13093
364 Ga0207646_10015367 3300025922 Bacteria 7232
365 Ga0207646_10052802 3300025922 Bacteria 3637
366 Ga0207646_10053481 3300025922 Bacteria 3612
367 Ga0207646_10384862 3300025922 Bacteria 1267
368 Ga0207681_10000922 3300025923 Bacteria 19189
369 Ga0207681_10370822 3300025923 Bacteria 1150
370 Ga0207694_10112590 3300025924 Bacteria 2166
371 Ga0207650_10000190 3300025925 Bacteria 71269
372 Ga0207650_10253806 3300025925 Bacteria 1424
373 Ga0207659_10000158 3300025926 Bacteria 40431
374 Ga0207659_10107092 3300025926 Bacteria 2118
375 Ga0207659_10166929 3300025926 Bacteria 1733
376 Ga0207659_10865372 3300025926 Bacteria 777
377 Ga0207687_10002474 3300025927 Bacteria 12545
378 Ga0207700_10187994 3300025928 Bacteria 1734
379 Ga0207700_10505651 3300025928 Unclassified 1070
380 Ga0207700_11083504 3300025928 Bacteria 716
381 Ga0207664_10133014 3300025929 Bacteria 2096
382 Ga0207664_10248192 3300025929 Bacteria 1552
383 Ga0207664_10877143 3300025929 Unclassified 806
384 Ga0207690_10000549 3300025932 Bacteria 24503
385 Ga0207706_10000162 3300025933 Bacteria 74975
386 Ga0207686_10008383 3300025934 Bacteria 5578
387 Ga0207670_10000118 3300025936 Bacteria 53265
388 Ga0207670_10164897 3300025936 Bacteria 1657
389 Ga0207669_10000375 3300025937 Bacteria 20090
390 Ga0207704_10000098 3300025938 Bacteria 48978
391 Ga0207704_10554758 3300025938 Archaea 934
392 Ga0207665_10036697 3300025939 Bacteria 3261
393 Ga0207691_10000201 3300025940 Bacteria 57550
394 Ga0207711_10000410 3300025941 Bacteria 45491
395 Ga0207711_10454425 3300025941 Bacteria 1192
396 Ga0207689_10000290 3300025942 Bacteria 45671
397 Ga0207689_10054848 3300025942 Bacteria 3281
398 Ga0207661_10055875 3300025944 Bacteria 3168
399 Ga0207661_10417137 3300025944 Bacteria 1219
400 Ga0207661_11624245 3300025944 Unclassified 591
401 Ga0207679_10000133 3300025945 Bacteria 60697
402 Ga0207679_10012004 3300025945 Bacteria 5631
403 Ga0207679_10370872 3300025945 Bacteria 1253
404 Ga0207679_10583815 3300025945 Bacteria 1005
405 Ga0207679_10673618 3300025945 Bacteria 937
406 Ga0207667_10002353 3300025949 Bacteria 23689
407 Ga0207651_10000220 3300025960 Bacteria 24597
408 Ga0207651_10376790 3300025960 Unclassified 1202
409 Ga0207651_10445703 3300025960 Bacteria 1110
410 Ga0207712_10001969 3300025961 Bacteria 13470
411 Ga0207712_11050196 3300025961 Unclassified 724
412 Ga0207668_10000988 3300025972 Bacteria 17098
413 Ga0207640_10001213 3300025981 Bacteria 14071
414 Ga0207658_10001594 3300025986 Bacteria 17495
415 Ga0207658_10600575 3300025986 Bacteria 989
416 Ga0207677_10000189 3300026023 Bacteria 49672
417 Ga0207677_10169521 3300026023 Bacteria 1705
418 Ga0207703_10000059 3300026035 Bacteria 134931
419 Ga0207703_10181975 3300026035 Bacteria 1855
420 Ga0207703_10433025 3300026035 Unclassified 1226
421 Ga0207703_11369588 3300026035 Bacteria 680
422 Ga0207639_10001086 3300026041 Bacteria 18466
423 Ga0207639_10035843 3300026041 Bacteria 3673
424 Ga0207678_10002662 3300026067 Bacteria 16226
425 Ga0207678_10443476 3300026067 Bacteria 1128
426 Ga0207708_10044734 3300026075 Bacteria 3374
427 Ga0207708_10140829 3300026075 Bacteria 1892
428 Ga0207702_10769572 3300026078 Bacteria 951
429 Ga0207648_10000379 3300026089 Bacteria 48991
430 Ga0207648_10113918 3300026089 Bacteria 2375
431 Ga0207648_10274256 3300026089 Bacteria 1507
432 Ga0207676_10001728 3300026095 Bacteria 16097
433 Ga0207674_10006912 3300026116 Bacteria 13292
434 Ga0207674_11016835 3300026116 Bacteria 798
435 Ga0207675_100000274 3300026118 Bacteria 49009
436 Ga0207675_101406983 3300026118 Bacteria 718
437 Ga0207683_10000433 3300026121 Bacteria 38824
438 Ga0207683_11490596 3300026121 Unclassified 625
439 Ga0207698_10000142 3300026142 Bacteria 45401
440 Ga0207428_10003114 3300027907 Bacteria 16286
441 Ga0207428_10063999 3300027907 Bacteria 2904
442 Ga0207428_10201501 3300027907 Bacteria 1497
443 Ga0268266_10000543 3300028379 Bacteria 52638
444 Ga0268265_10000450 3300028380 Bacteria 43583
445 Ga0268264_10000321 3300028381 Bacteria 75918
446 Ga0265319_1065550 3300028563 Bacteria 1171
447 Ga0265338_10008623 3300028800 Bacteria 12331
448 Ga0265338_10081337 3300028800 Bacteria 2717
449 Ga0265338_10170164 3300028800 Archaea 1672
450 Ga0265338_10222500 3300028800 Bacteria 1409
451 Ga0265338_10315803 3300028800 Bacteria 1132
452 Ga0265332_10050045 3300031238 Bacteria 1796
453 Ga0265325_10000531 3300031241 Bacteria 27602
454 Ga0265339_10000234 3300031249 Bacteria 44984
455 Ga0265331_10000243 3300031250 Bacteria 65279
456 Ga0265316_10005753 3300031344 Bacteria 11969
457 Ga0307408_100010361 3300031548 Bacteria 6147
458 Ga0307408_100019396 3300031548 Bacteria 4579
459 Ga0265313_10000428 3300031595 Bacteria 44917
460 Ga0265314_10000470 3300031711 Bacteria 53501
461 Ga0265342_10010560 3300031712 Bacteria 6390
462 Ga0316576_10000028 3300031727 Bacteria 42682
463 Ga0316576_10586728 3300031727 Bacteria 814
464 Ga0316578_10175698 3300031728 Bacteria 1291
465 Ga0307405_10359786 3300031731 Bacteria 1125
466 Ga0316577_10284562 3300031733 Bacteria 936
467 Ga0316577_10448080 3300031733 Archaea 733
468 Ga0307413_10005050 3300031824 Bacteria 5832
469 Ga0307413_10588581 3300031824 Bacteria 909
470 Ga0307410_10005918 3300031852 Bacteria 6538
471 Ga0307410_10513175 3300031852 Unclassified 988
472 Ga0307406_10024370 3300031901 Bacteria 3614
473 Ga0307406_10124027 3300031901 Bacteria 1801
474 Ga0307407_10092755 3300031903 Bacteria 1855
475 Ga0307412_10026560 3300031911 Bacteria 3600
476 Ga0307409_100015868 3300031995 Bacteria 4962
477 Ga0307409_100063557 3300031995 Bacteria 2895
478 Ga0307409_100981389 3300031995 Bacteria 862
479 Ga0307416_100019917 3300032002 Bacteria 4770
480 Ga0307414_10010434 3300032004 Bacteria 5389
481 Ga0307414_11051474 3300032004 Bacteria 751
482 Ga0307411_10011811 3300032005 Bacteria 4733
483 Ga0307411_10495511 3300032005 Unclassified 1032
484 Ga0307411_10557444 3300032005 Unclassified 979
485 Ga0307415_100429742 3300032126 Archaea 1136
486 Ga0307415_100557319 3300032126 Bacteria 1012
487 Ga0316583_10000685 3300032133 Bacteria 10418
488 Ga0316593_10147191 3300032168 Bacteria 856
489 Ga0373956_0366290 3300035119 Bacteria 687
490 Ga0373943_0906772 3300035170 Bacteria 527
491 Ga0373937_0231823 3300036401 Bacteria 1739
492 Ga0373937_0778153 3300036401 Bacteria 905
493 Ga0316582_0083059 3300036647 Bacteria 2095
494 Ga0316582_0815897 3300036647 Bacteria 639
495 Ga0316584_0064668 3300036712 Bacteria 2739
496 Ga0395898_0143600 3300037466 Bacteria 2285
497 Ga0395905_0733950 3300037471 Bacteria 890
498 Ga0436364_0465931 3300037853 Bacteria 10501
499 Ga0436364_0470594 3300037853 Bacteria 838
500 Ga0436364_0785008 3300037853 Bacteria 174976
501 Ga0436364_1368148 3300037853 Bacteria 1368
502 Ga0400483_034058 3300039062 Bacteria 3577
503 Ga0400489_26591 3300039093 Bacteria 3232
504 Ga0436365_0276322 3300039437 Archaea 669
505 Ga0436365_0465498 3300039437 Bacteria 4592
506 Ga0436361_0133921 3300039447 Bacteria 568
507 Ga0436363_0589356 3300039450 Bacteria 3745
508 Ga0436363_0659898 3300039450 Bacteria 4760
509 Ga0436363_0776937 3300039450 Bacteria 10219
510 Ga0436362_0333090 3300039453 Archaea 658
511 Ga0436362_0903825 3300039453 Bacteria 9937
512 Ga0439439_0044660 3300041406 Bacteria 1154
513 Ga0439461_0154806 3300041410 Bacteria 594
514 Ga0439431_0059935 3300041997 Unclassified 1000
515 Ga0439445_0016173 3300042004 Bacteria 1833
516 Ga0439448_0016226 3300042005 Bacteria 2265
517 Ga0439455_0009376 3300042012 Bacteria 2122
518 Ga0450896_032774 3300042133 Bacteria 791
519 Ga0450898_038545 3300042134 Unclassified 898
520 Ga0439446_0328555 3300042156 Bacteria 541
521 Ga0439458_0128182 3300042157 Bacteria 671
522 Ga0439434_0156533 3300042435 Bacteria 756
523 Ga0439435_0033822 3300042436 Bacteria 1402
524 Ga0439459_0038283 3300042438 Bacteria 1008
525 Ga0439460_0036120 3300042461 Bacteria 1432
526 Ga0439460_0114881 3300042461 Bacteria 876
527 Ga0439460_0370500 3300042461 Bacteria 506
528 Ga0451577_0067078 3300042876 Bacteria 3200
529 Ga0451577_1002260 3300042876 Bacteria 750
530 Ga0466969_0000290 3300044656 Bacteria 27417
531 Ga0466969_0018899 3300044656 Bacteria 3587
532 Ga0466965_0158816 3300044683 Bacteria 1185
533 Ga0466966_0001447 3300044684 Bacteria 15250
534 Ga0466966_0009668 3300044684 Bacteria 6384
535 Ga0466966_0324715 3300044684 Unclassified 925
536 Ga0466961_0094622 3300044693 Bacteria 1885
537 Ga0466963_0630525 3300044694 Bacteria 757
538 Ga0466964_0010566 3300044706 Bacteria 3482
539 Ga0453684_0000291 3300044712 Bacteria 215046
540 Ga0453684_0006785 3300044712 Bacteria 21538
541 Ga0453684_0147016 3300044712 Bacteria 2805
542 Ga0453684_0310098 3300044712 Bacteria 1791
543 Ga0466971_0015684 3300044719 Bacteria 3337
544 Ga0466971_0274964 3300044719 Bacteria 805
545 Ga0466968_0000119 3300044735 Bacteria 23238
546 Ga0466970_0000155 3300044765 Bacteria 32363
547 Ga0466970_0035327 3300044765 Bacteria 2648
548 Ga0466957_0016133 3300044842 Bacteria 4366
549 Ga0466957_0202169 3300044842 Bacteria 1305
550 Ga0466957_0235327 3300044842 Bacteria 1214
551 Ga0466957_0683758 3300044842 Bacteria 723
552 Ga0466959_0035521 3300045049 Bacteria 3685
553 Ga0466959_0099348 3300045049 Unclassified 2084
554 Ga0466959_0159828 3300045049 Bacteria 1584
555 Ga0466959_0353345 3300045049 Bacteria 1002
556 Ga0466959_0406701 3300045049 Bacteria 925
557 Ga0466959_0603138 3300045049 Bacteria 738
558 Ga0451576_0014677 3300045051 Bacteria 8709
559 Ga0451576_0390900 3300045051 Bacteria 1458
560 Ga0451576_1508889 3300045051 Bacteria 698
561 Ga0466958_0101348 3300045836 Bacteria 1790
562 Ga0466967_0142838 3300045976 Bacteria 2231
563 Ga0495603_0020259 3300046455 Bacteria 4031
564 Ga0495603_0381417 3300046455 Bacteria 808
565 Ga0495652_0387495 3300046529 Bacteria 993
566 Ga0495652_0431526 3300046529 Unclassified 926
567 Ga0495665_0147571 3300046531 Bacteria 1228
568 Ga0495667_0817339 3300046559 Bacteria 574
569 Ga0495646_0229805 3300046680 Bacteria 1000
570 Ga0495658_0042618 3300046683 Unclassified 2535
571 Ga0495684_0057438 3300047471 Bacteria 2966
572 Ga0496101_1458415 3300048904 Bacteria 533
573 Ga0496102_0000775 3300048905 Bacteria 31129
574 Ga0496103_0053792 3300048906 Bacteria 2495
575 Ga0496105_0393390 3300048908 Unclassified 1101
576 Ga0496106_0005115 3300048909 Bacteria 9718
577 Ga0496106_0064640 3300048909 Bacteria 2784
578 Ga0496107_0057475 3300048910 Bacteria 2812
579 Ga0496108_0042841 3300048911 Bacteria 3780
580 Ga0496108_0149119 3300048911 Unclassified 2018
581 Ga0496109_0000947 3300048912 Bacteria 24003
582 Ga0496109_0749784 3300048912 Unclassified 914
583 Ga0496110_0683359 3300048913 Bacteria 927
584 Ga0496112_0000238 3300048915 Bacteria 35377
585 Ga0496112_0172250 3300048915 Bacteria 2130
586 Ga0496113_0005602 3300048916 Bacteria 7856
587 Ga0496114_0249776 3300048917 Bacteria 1561
588 Ga0496114_0572259 3300048917 Unclassified 997
589 Ga0501298_014821 3300049521 Bacteria 1397
590 Ga0501299_064844 3300049522 Bacteria 781
591 Ga0501031_0361973 3300049568 Bacteria 939
592 Ga0501034_0009677 3300049571 Bacteria 10081
593 Ga0501034_0125807 3300049571 Unclassified 2549
594 Ga0501036_0812491 3300049572 Unclassified 770
595 Ga0501037_0046036 3300049573 Bacteria 3200
596 Ga0501038_0302150 3300049574 Bacteria 1256
597 Ga0501040_0495928 3300049576 Bacteria 880
598 Ga0501042_0210688 3300049578 Bacteria 1402
599 Ga0501042_0810819 3300049578 Bacteria 681
600 Ga0501047_0334060 3300049581 Bacteria 1354
601 Ga0501048_0272101 3300049582 Bacteria 1204
602 Ga0501067_0049182 3300049583 Bacteria 2337
603 Ga0501070_1014874 3300049586 Bacteria 643
604 Ga0501072_0495506 3300049588 Bacteria 966
605 Ga0501072_0778355 3300049588 Unclassified 750
606 Ga0501074_0403757 3300049590 Bacteria 969
607 Ga0501075_0448872 3300049591 Bacteria 983
608 Ga0501076_0375907 3300049592 Bacteria 1168
609 Ga0501076_0392592 3300049592 Bacteria 1141
610 Ga0501077_0596146 3300049593 Unclassified 710
611 Ga0501079_0043920 3300049741 Bacteria 3450
612 Ga0501079_0129251 3300049741 Bacteria 1966
613 Ga0501079_0935660 3300049741 Unclassified 682
614 Ga0501079_1126808 3300049741 Unclassified 618
615 Ga0501080_0259230 3300049742 Bacteria 1585
616 Ga0501080_0274813 3300049742 Bacteria 1533
617 Ga0501081_0156832 3300049743 Bacteria 1638
618 Ga0501081_0797294 3300049743 Unclassified 711
619 Ga0501044_0185583 3300049823 Bacteria 2045
620 nmdc:mga05p37_1795782_c1 3300050507 Bacteria 592
621 nmdc:mga05p37_27717_c1 3300050507 Bacteria 6901
622 nmdc:mga05p37_298838_c1 3300050507 Bacteria 1914
623 nmdc:mga05p37_39132_c1 3300050507 Bacteria 5819
624 nmdc:mga05p37_45587_c1 3300050507 Bacteria 5391
625 nmdc:mga05p37_74329_c1 3300050507 Bacteria 4183
626 nmdc:mga05p37_8524_c1 3300050507 Bacteria 12118
627 nmdc:mga09592_212538_c1 3300050508 Bacteria 1676
628 nmdc:mga09592_214446_c1 3300050508 Bacteria 1668
629 nmdc:mga0qj67_417144_c1 3300050509 Unclassified 1082
630 nmdc:mga0qj67_76689_c1 3300050509 Bacteria 2674
631 nmdc:mga06r32_103651_c1 3300050510 Bacteria 2793
632 nmdc:mga06r32_136678_c1 3300050510 Bacteria 2425
633 nmdc:mga06r32_355779_c1 3300050510 Bacteria 1449
634 nmdc:mga08y16_140417_c1 3300050511 Bacteria 2511
635 nmdc:mga08y16_1827_c1 3300050511 Bacteria 21588
636 nmdc:mga08y16_40003_c1 3300050511 Bacteria 4917
637 nmdc:mga08y16_67273_c1 3300050511 Bacteria 3737
638 nmdc:mga08y16_84190_c1 3300050511 Bacteria 3315
639 nmdc:mga0n895_193414_c1 3300050512 Bacteria 2065
640 nmdc:mga0n895_335241_c1 3300050512 Bacteria 1532
641 nmdc:mga0n895_360161_c1 3300050512 Bacteria 1473
642 nmdc:mga0n895_711_c1 3300050512 Bacteria 23413
643 nmdc:mga0rr50_530244_c1 3300050513 Bacteria 1002
644 nmdc:mga0a205_23528_c1 3300050515 Bacteria 5843
645 nmdc:mga0a205_421811_c1 3300050515 Bacteria 1196
646 nmdc:mga0a205_53080_c1 3300050515 Bacteria 3912
647 nmdc:mga0a205_54544_c1 3300050515 Bacteria 3860
648 nmdc:mga0a205_751056_c1 3300050515 Bacteria 824
649 Ga0495601_0306688 3300053077 Bacteria 1034
650 Ga0495612_0035059 3300053078 Bacteria 2033
651 Ga0495595_0080858 3300053084 Bacteria 1548
652 Ga0495619_0530088 3300053085 Bacteria 809
653 Ga0500637_0185364 3300053178 Bacteria 1191
654 Ga0501084_0263563 3300054114 Bacteria 1455
655 Ga0501082_0539709 3300060353 Bacteria 1020
656 Ga0466962_0025230 3300061719 Bacteria 2854
657 2673167524 2671180531 Bacteria 9045424
658 Ga0157380_11186275
659 JGI24752J21851_1022861
660 JGI24737J22298_10027537
661 JGI24750J21931_1003838
662 JGI24749J21850_1002136
663 JGI24742J22300_10053947
664 rootH1_10221425
665 JGI25404J52841_10002039
666 JGI25404J52841_10069771
667 Ga0058860_10663497
668 Ga0065704_10082627
669 Ga0065712_10109316
670 Ga0065715_10133942
671 Ga0070658_10000383
672 Ga0070676_10000325
673 Ga0070683_100074351
674 Ga0070683_100093019
675 Ga0070683_100458296
676 Ga0070683_101076066
677 Ga0070690_100000248
678 Ga0070670_100001244
679 Ga0070670_100611737
680 Ga0070670_100673622
681 Ga0070677_10007700
682 Ga0070677_10317877
683 Ga0068869_100000333
684 Ga0068869_100356822
685 Ga0070666_10000167
686 Ga0070680_100011775
687 Ga0070680_100556974
688 Ga0070680_100644428
689 Ga0068868_100002657
690 Ga0068868_100141529
691 Ga0070660_100001099
692 Ga0070689_100000120
693 Ga0070689_100229229
694 Ga0070689_100293564
695 Ga0070691_10037317
696 Ga0070687_100000258
697 Ga0070661_100000105
698 Ga0070661_100015055
699 Ga0070692_10000685
700 Ga0070668_100000174
701 Ga0070668_100977849
702 Ga0070668_101020589
703 Ga0070669_100000253
704 Ga0070669_100224110
705 Ga0070669_100381283
706 Ga0070669_101212050
707 Ga0070675_100001059
708 Ga0070675_100163146
709 Ga0070675_100272511
710 Ga0070675_100611071
711 Ga0070671_100000508
712 Ga0070671_100396167
713 Ga0070674_100000080
714 Ga0070673_100000357
715 Ga0070673_100455359
716 Ga0070688_100000754
717 Ga0070688_100076787
718 Ga0070659_100000193
719 Ga0070667_100003456
720 Ga0070714_100089511
721 Ga0070714_100478920
722 Ga0070713_101287208
723 Ga0070701_10036337
724 Ga0070701_10506237
725 Ga0070711_100040136
726 Ga0070705_100001045
727 Ga0070705_100508858
728 Ga0070700_100032155
729 Ga0070700_101224006
730 Ga0070694_100844336
731 Ga0070708_100001945
732 Ga0070708_100002876
733 Ga0070708_100009410
734 Ga0070708_100016856
735 Ga0070708_100201819
736 Ga0070708_100259559
737 Ga0070708_100343643
738 Ga0070708_100613954
739 Ga0070663_100004905
740 Ga0070678_100000042
741 Ga0070678_100756832
742 Ga0070662_100000445
743 Ga0070662_100391864
744 Ga0070681_10148202
745 Ga0070681_10656275
746 Ga0068867_100003990
747 Ga0068867_100712388
748 Ga0068867_100772054
749 Ga0068867_100915529
750 Ga0070685_10000294
751 Ga0070706_100002680
752 Ga0070706_100011110
753 Ga0070706_100012048
754 Ga0070706_100016319
755 Ga0070706_100025617
756 Ga0070706_100041605
757 Ga0070706_100274184
758 Ga0070706_100989523
759 Ga0070706_101676694
760 Ga0070707_100000267
761 Ga0070707_100001441
762 Ga0070707_100001570
763 Ga0070707_100019424
764 Ga0070707_100038517
765 Ga0070707_100048540
766 Ga0070707_100109712
767 Ga0070707_100468110
768 Ga0070707_100503039
769 Ga0070707_100787137
770 Ga0070707_100968489
771 Ga0070707_101090283
772 Ga0070698_100000619
773 Ga0070698_100000908
774 Ga0070698_100025724
775 Ga0070698_100137330
776 Ga0070698_100210525
777 Ga0070698_100324756
778 Ga0070698_100362210
779 Ga0070698_100465346
780 Ga0070698_100807767
781 Ga0070699_100000282
782 Ga0070699_100070121
783 Ga0070699_100239984
784 Ga0070699_100286506
785 Ga0070699_100793170
786 Ga0070699_100925622
787 Ga0070699_101529438
788 Ga0070679_100023777
789 Ga0070679_101008057
790 Ga0070679_101359685
791 Ga0070684_100010789
792 Ga0070684_100039181
793 Ga0070684_100373103
794 Ga0070684_100373567
795 Ga0070697_100000094
796 Ga0070697_100000120
797 Ga0070697_100001660
798 Ga0070697_100013022
799 Ga0070697_100024671
800 Ga0070697_100126797
801 Ga0070697_100208783
802 Ga0070697_101493838
803 Ga0068853_100005351
804 Ga0068853_100029355
805 Ga0070672_100000203
806 Ga0070672_100373437
807 Ga0070672_100945881
808 Ga0070686_100000529
809 Ga0070686_100529056
810 Ga0070686_101683435
811 Ga0070695_100007568
812 Ga0070696_100024690
813 Ga0070693_100092388
814 Ga0070665_100003033
815 Ga0070665_100199396
816 Ga0068855_100001142
817 Ga0068855_100297465
818 Ga0070664_100000784
819 Ga0070664_100005167
820 Ga0070664_101837070
821 Ga0068857_100000030
822 Ga0068857_100008452
823 Ga0068857_100258120
824 Ga0068854_100000163
825 Ga0068856_100000467
826 Ga0068856_100345833
827 Ga0070702_100061406
828 Ga0068852_100000141
829 Ga0068859_100000568
830 Ga0068859_100265227
831 Ga0068859_100284693
832 Ga0068859_100441837
833 Ga0068864_100000372
834 Ga0068866_10000363
835 Ga0068866_10748860
836 Ga0068861_100000395
837 Ga0068861_101348627
838 Ga0068851_10000085
839 Ga0068870_10000044
840 Ga0068870_10231197
841 Ga0068863_100001310
842 Ga0068858_100005163
843 Ga0068858_100006586
844 Ga0068858_100079237
845 Ga0068858_100090037
846 Ga0068858_100445293
847 Ga0068858_100638510
848 Ga0068860_100001227
849 Ga0068860_100302564
850 Ga0068860_101039050
851 Ga0068860_101580699
852 Ga0068862_100001443
853 Ga0068862_100788407
854 Ga0081455_10042450
855 Ga0081540_1000146
856 Ga0081540_1001220
857 Ga0081540_1001293
858 Ga0081539_10075488
859 Ga0070717_10005942
860 Ga0070717_10026540
861 Ga0070717_10121341
862 Ga0070717_10298978
863 Ga0070716_100118299
864 Ga0070712_100083480
865 Ga0070712_101151693
866 Ga0097621_100000123
867 Ga0097621_100918150
868 Ga0097621_101210253
869 Ga0068871_100007148
870 Ga0068871_100404813
871 Ga0075428_100019832
872 Ga0075428_100023582
873 Ga0075428_100041379
874 Ga0075428_100518430
875 Ga0075428_100908788
876 Ga0075430_100257099
877 Ga0075430_100468388
878 Ga0075431_100023358
879 Ga0075433_10014128
880 Ga0075433_10019240
881 Ga0075433_10043164
882 Ga0075433_10402347
883 Ga0075433_10434298
884 Ga0075434_100004129
885 Ga0075434_100368739
886 Ga0075434_100422056
887 Ga0075434_101904799
888 Ga0075429_100217051
889 Ga0075429_100313078
890 Ga0075429_100649975
891 Ga0068865_100000083
892 Ga0097620_100000568
893 Ga0097620_100265218
894 Ga0097620_100284704
895 Ga0097620_100441882
896 Ga0075435_100105347
897 Ga0105251_10232567
898 Ga0105250_10070038
899 Ga0105240_10004652
900 Ga0105240_10256947
901 Ga0111539_10002301
902 Ga0111539_10004853
903 Ga0111539_10666302
904 Ga0111539_10954658
905 Ga0105245_10003337
906 Ga0105245_10240617
907 Ga0105245_10648204
908 Ga0105247_10000362
909 Ga0105247_10006004
910 Ga0114129_10008249
911 Ga0114129_10021845
912 Ga0114129_10021897
913 Ga0114129_10044462
914 Ga0114129_10125057
915 Ga0114129_10337879
916 Ga0114129_12110867
917 Ga0114129_12925125
918 Ga0105243_10004616
919 Ga0105243_10565548
920 Ga0105241_10001541
921 Ga0105242_10006111
922 Ga0105242_10757321
923 Ga0105242_11719771
924 Ga0105248_10001954
925 Ga0105248_10190653
926 Ga0105248_10808698
927 Ga0105248_11085208
928 Ga0105248_11355044
929 Ga0105238_10161991
930 Ga0105249_10000314
931 Ga0105249_10331333
932 Ga0105249_11159096
933 Ga0105239_10004805
934 Ga0105239_10226175
935 Ga0105239_10274058
936 Ga0105239_11379176
937 Ga0105246_10003678
938 Ga0157373_10003295
939 Ga0157371_10000469
940 Ga0157371_10467480
941 Ga0157369_10000283
942 Ga0157374_10000543
943 Ga0157378_10001087
944 Ga0157378_12053285
945 Ga0163162_10004349
946 Ga0163162_10346668
947 Ga0157372_10144029
948 Ga0157375_10000432
949 Ga0163163_10038558
950 Ga0163163_10418435
951 Ga0163163_10580656
952 Ga0163163_10752861
953 Ga0163163_11760632
954 Ga0157380_10131810
955 Ga0157380_10248585
956 Ga0157380_10369588
957 Ga0157380_11047796
958 Ga0157380_11091116
959 Ga0157377_10000225
960 Ga0157379_10000134
961 Ga0157379_10021018
962 Ga0157379_10783743
963 Ga0157376_10001015
964 Ga0163161_10004329
965 Ga0197907_10153404
966 Ga0197907_11337912
967 Ga0206356_10120151
968 Ga0206355_1283185
969 Ga0206351_10454161
970 Ga0206352_10620901
971 Ga0206350_10069905
972 Ga0206350_10686549
973 Ga0154015_1323244
974 Ga0213874_10007554
975 Ga0213875_10000026
976 Ga0213875_10002736
977 Ga0224712_10006078
978 Ga0224712_10017682
979 Ga0224712_10162172
980 Ga0207656_10003259
981 Ga0207682_10000599
982 Ga0207682_10109469
983 Ga0207642_10000429
984 Ga0207710_10003119
985 Ga0207688_10000178
986 Ga0207680_10000343
987 Ga0207647_10001951
988 Ga0207699_10082065
989 Ga0207699_10492468
990 Ga0207645_10000200
991 Ga0207643_10000141
992 Ga0207705_10015550
993 Ga0207684_10000206
994 Ga0207684_10001368
995 Ga0207684_10001386
996 Ga0207684_10001766
997 Ga0207684_10022914
998 Ga0207684_10023815
999 Ga0207684_10136442
1000 Ga0207684_10194084
1001 Ga0207684_10684288
1002 Ga0207684_11191327
1003 Ga0207654_10004241
1004 Ga0207695_10098408
1005 Ga0207695_10146606
1006 Ga0207695_10529293
1007 Ga0207671_10001428
1008 Ga0207693_10115693
1009 Ga0207662_10000043
1010 Ga0207657_10000349
1011 Ga0207657_10195273
1012 Ga0207649_10002013
1013 Ga0207649_10022447
1014 Ga0207652_10036919
1015 Ga0207652_10763731
1016 Ga0207646_10000558
1017 Ga0207646_10001813
1018 Ga0207646_10002187
1019 Ga0207646_10003091
1020 Ga0207646_10005669
1021 Ga0207646_10015367
1022 Ga0207646_10052802
1023 Ga0207646_10053481
1024 Ga0207646_10384862
1025 Ga0207681_10000922
1026 Ga0207681_10370822
1027 Ga0207694_10112590
1028 Ga0207650_10000190
1029 Ga0207650_10253806
1030 Ga0207659_10000158
1031 Ga0207659_10107092
1032 Ga0207659_10166929
1033 Ga0207659_10865372
1034 Ga0207687_10002474
1035 Ga0207700_10187994
1036 Ga0207700_10505651
1037 Ga0207700_11083504
1038 Ga0207664_10133014
1039 Ga0207664_10248192
1040 Ga0207664_10877143
1041 Ga0207690_10000549
1042 Ga0207706_10000162
1043 Ga0207686_10008383
1044 Ga0207670_10000118
1045 Ga0207670_10164897
1046 Ga0207669_10000375
1047 Ga0207704_10000098
1048 Ga0207704_10554758
1049 Ga0207665_10036697
1050 Ga0207691_10000201
1051 Ga0207711_10000410
1052 Ga0207711_10454425
1053 Ga0207689_10000290
1054 Ga0207689_10054848
1055 Ga0207661_10055875
1056 Ga0207661_10417137
1057 Ga0207661_11624245
1058 Ga0207679_10000133
1059 Ga0207679_10012004
1060 Ga0207679_10370872
1061 Ga0207679_10583815
1062 Ga0207679_10673618
1063 Ga0207667_10002353
1064 Ga0207651_10000220
1065 Ga0207651_10376790
1066 Ga0207651_10445703
1067 Ga0207712_10001969
1068 Ga0207712_11050196
1069 Ga0207668_10000988
1070 Ga0207640_10001213
1071 Ga0207658_10001594
1072 Ga0207658_10600575
1073 Ga0207677_10000189
1074 Ga0207677_10169521
1075 Ga0207703_10000059
1076 Ga0207703_10181975
1077 Ga0207703_10433025
1078 Ga0207703_11369588
1079 Ga0207639_10001086
1080 Ga0207639_10035843
1081 Ga0207678_10002662
1082 Ga0207678_10443476
1083 Ga0207708_10044734
1084 Ga0207708_10140829
1085 Ga0207702_10769572
1086 Ga0207648_10000379
1087 Ga0207648_10113918
1088 Ga0207648_10274256
1089 Ga0207676_10001728
1090 Ga0207674_10006912
1091 Ga0207674_11016835
1092 Ga0207675_100000274
1093 Ga0207675_101406983
1094 Ga0207683_10000433
1095 Ga0207683_11490596
1096 Ga0207698_10000142
1097 Ga0207428_10003114
1098 Ga0207428_10063999
1099 Ga0207428_10201501
1100 Ga0268266_10000543
1101 Ga0268265_10000450
1102 Ga0268264_10000321
1103 Ga0265319_1065550
1104 Ga0265338_10008623
1105 Ga0265338_10081337
1106 Ga0265338_10170164
1107 Ga0265338_10222500
1108 Ga0265338_10315803
1109 Ga0265332_10050045
1110 Ga0265325_10000531
1111 Ga0265339_10000234
1112 Ga0265331_10000243
1113 Ga0265316_10005753
1114 Ga0307408_100010361
1115 Ga0307408_100019396
1116 Ga0265313_10000428
1117 Ga0265314_10000470
1118 Ga0265342_10010560
1119 Ga0316576_10000028
1120 Ga0316576_10586728
1121 Ga0316578_10175698
1122 Ga0307405_10359786
1123 Ga0316577_10284562
1124 Ga0316577_10448080
1125 Ga0307413_10005050
1126 Ga0307413_10588581
1127 Ga0307410_10005918
1128 Ga0307410_10513175
1129 Ga0307406_10024370
1130 Ga0307406_10124027
1131 Ga0307407_10092755
1132 Ga0307412_10026560
1133 Ga0307409_100015868
1134 Ga0307409_100063557
1135 Ga0307409_100981389
1136 Ga0307416_100019917
1137 Ga0307414_10010434
1138 Ga0307414_11051474
1139 Ga0307411_10011811
1140 Ga0307411_10495511
1141 Ga0307411_10557444
1142 Ga0307415_100429742
1143 Ga0307415_100557319
1144 Ga0316583_10000685
1145 Ga0316593_10147191
1146 Ga0373956_0366290
1147 Ga0373943_0906772
1148 Ga0373937_0231823
1149 Ga0373937_0778153
1150 Ga0316582_0083059
1151 Ga0316582_0815897
1152 Ga0316584_0064668
1153 Ga0395898_0143600
1154 Ga0395905_0733950
1155 Ga0436364_0465931
1156 Ga0436364_0470594
1157 Ga0436364_0785008
1158 Ga0436364_1368148
1159 Ga0400483_034058
1160 Ga0400489_26591
1161 Ga0436365_0276322
1162 Ga0436365_0465498
1163 Ga0436361_0133921
1164 Ga0436363_0589356
1165 Ga0436363_0659898
1166 Ga0436363_0776937
1167 Ga0436362_0333090
1168 Ga0436362_0903825
1169 Ga0439439_0044660
1170 Ga0439461_0154806
1171 Ga0439431_0059935
1172 Ga0439445_0016173
1173 Ga0439448_0016226
1174 Ga0439455_0009376
1175 Ga0450896_032774
1176 Ga0450898_038545
1177 Ga0439446_0328555
1178 Ga0439458_0128182
1179 Ga0439434_0156533
1180 Ga0439435_0033822
1181 Ga0439459_0038283
1182 Ga0439460_0036120
1183 Ga0439460_0114881
1184 Ga0439460_0370500
1185 Ga0451577_0067078
1186 Ga0451577_1002260
1187 Ga0466969_0000290
1188 Ga0466969_0018899
1189 Ga0466965_0158816
1190 Ga0466966_0001447
1191 Ga0466966_0009668
1192 Ga0466966_0324715
1193 Ga0466961_0094622
1194 Ga0466963_0630525
1195 Ga0466964_0010566
1196 Ga0453684_0000291
1197 Ga0453684_0006785
1198 Ga0453684_0147016
1199 Ga0453684_0310098
1200 Ga0466971_0015684
1201 Ga0466971_0274964
1202 Ga0466968_0000119
1203 Ga0466970_0000155
1204 Ga0466970_0035327
1205 Ga0466957_0016133
1206 Ga0466957_0202169
1207 Ga0466957_0235327
1208 Ga0466957_0683758
1209 Ga0466959_0035521
1210 Ga0466959_0099348
1211 Ga0466959_0159828
1212 Ga0466959_0353345
1213 Ga0466959_0406701
1214 Ga0466959_0603138
1215 Ga0451576_0014677
1216 Ga0451576_0390900
1217 Ga0451576_1508889
1218 Ga0466958_0101348
1219 Ga0466967_0142838
1220 Ga0495603_0020259
1221 Ga0495603_0381417
1222 Ga0495652_0387495
1223 Ga0495652_0431526
1224 Ga0495665_0147571
1225 Ga0495667_0817339
1226 Ga0495646_0229805
1227 Ga0495658_0042618
1228 Ga0495684_0057438
1229 Ga0496101_1458415
1230 Ga0496102_0000775
1231 Ga0496103_0053792
1232 Ga0496105_0393390
1233 Ga0496106_0005115
1234 Ga0496106_0064640
1235 Ga0496107_0057475
1236 Ga0496108_0042841
1237 Ga0496108_0149119
1238 Ga0496109_0000947
1239 Ga0496109_0749784
1240 Ga0496110_0683359
1241 Ga0496112_0000238
1242 Ga0496112_0172250
1243 Ga0496113_0005602
1244 Ga0496114_0249776
1245 Ga0496114_0572259
1246 Ga0501298_014821
1247 Ga0501299_064844
1248 Ga0501031_0361973
1249 Ga0501034_0009677
1250 Ga0501034_0125807
1251 Ga0501036_0812491
1252 Ga0501037_0046036
1253 Ga0501038_0302150
1254 Ga0501040_0495928
1255 Ga0501042_0210688
1256 Ga0501042_0810819
1257 Ga0501047_0334060
1258 Ga0501048_0272101
1259 Ga0501067_0049182
1260 Ga0501070_1014874
1261 Ga0501072_0495506
1262 Ga0501072_0778355
1263 Ga0501074_0403757
1264 Ga0501075_0448872
1265 Ga0501076_0375907
1266 Ga0501076_0392592
1267 Ga0501077_0596146
1268 Ga0501079_0043920
1269 Ga0501079_0129251
1270 Ga0501079_0935660
1271 Ga0501079_1126808
1272 Ga0501080_0259230
1273 Ga0501080_0274813
1274 Ga0501081_0156832
1275 Ga0501081_0797294
1276 Ga0501044_0185583
1277 nmdc:mga05p37_1795782_c1
1278 nmdc:mga05p37_27717_c1
1279 nmdc:mga05p37_298838_c1
1280 nmdc:mga05p37_39132_c1
1281 nmdc:mga05p37_45587_c1
1282 nmdc:mga05p37_74329_c1
1283 nmdc:mga05p37_8524_c1
1284 nmdc:mga09592_212538_c1
1285 nmdc:mga09592_214446_c1
1286 nmdc:mga0qj67_417144_c1
1287 nmdc:mga0qj67_76689_c1
1288 nmdc:mga06r32_103651_c1
1289 nmdc:mga06r32_136678_c1
1290 nmdc:mga06r32_355779_c1
1291 nmdc:mga08y16_140417_c1
1292 nmdc:mga08y16_1827_c1
1293 nmdc:mga08y16_40003_c1
1294 nmdc:mga08y16_67273_c1
1295 nmdc:mga08y16_84190_c1
1296 nmdc:mga0n895_193414_c1
1297 nmdc:mga0n895_335241_c1
1298 nmdc:mga0n895_360161_c1
1299 nmdc:mga0n895_711_c1
1300 nmdc:mga0rr50_530244_c1
1301 nmdc:mga0a205_23528_c1
1302 nmdc:mga0a205_421811_c1
1303 nmdc:mga0a205_53080_c1
1304 nmdc:mga0a205_54544_c1
1305 nmdc:mga0a205_751056_c1
1306 Ga0495601_0306688
1307 Ga0495612_0035059
1308 Ga0495595_0080858
1309 Ga0495619_0530088
1310 Ga0500637_0185364
1311 Ga0501084_0263563
1312 Ga0501082_0539709
1313 Ga0466962_0025230
1314 2673167524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

53

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9014 40 104
7p8p-assembly2.cif.gz_B crystal structure of fhit covalently bound to a nucleotide 0.8944 39 102
1z84-assembly1.cif.gz_B x-ray structure of galt-like protein from arabidopsis thaliana at5g18200 0.8921 39 96
2fit-assembly1.cif.gz_A-2 fhit (fragile histidine triad protein) 0.8912 39 102
2h39-assembly1.cif.gz_A crystal structure of an adp-glucose phosphorylase from arabidopsis thaliana with bound adp-glucose 0.8897 39 96
ID Description Score Start End Superfamily
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9045 39 104 3.30.428.10
af_P49776_4_176_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9038 39 104 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9017 39 104 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8973 34 104 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.896 37 102 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A3M7IEJ5-F1-model_v4 HIT domain-containing protein 0.9129 39 104 GO:0000166
GO:0003824
AF-A0A6B3EIR9-F1-model_v4 HIT domain-containing protein 0.9107 41 107 GO:0003824
AF-A0A2H9NAM7-F1-model_v4 HIT family protein 0.9069 39 107 GO:0006790
GO:0009150
GO:0047627
AF-A0A4Q6CTY7-F1-model_v4 deleted 0.9066 40 99
AF-U4LVQ0-F1-model_v4 Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) 0.9054 37 107 GO:0000166
GO:0047710

Map