F473057

General Info

Members Datasets Scaffolds Average Seq Length
656 428 1312 225

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0020815|Ga0500559_0020815_660_1445
Length 261
Sequence LRTFDREILRNELGAMEAWRNWRPRREQTGCRQGLCLMLGGPQRALLFDIDGTLADTDALHLEAFNHVFEPRGHVFDRARAATELQGFSNASISARFLPHEPPERQAAIMGEKEAVFRKLVAGKIQPVPGLMALLAIADDADIPMVAVTNAPRLNAEMLLAGLGIMDRFQAVVIGDELPHAKPHPLPYLEGLRAVNAAANRSVAFEDSRSGIKSASDAGIATVGMRTSLSHADLVEAGALLTAPAYDDRDLMTWLAATMDW

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
66 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
67 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
91 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
92 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
93 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
134 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
277 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
282 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
286 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
287 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
292 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
296 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
297 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
300 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
301 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
302 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
303 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
304 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
305 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
306 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
307 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
308 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
309 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
310 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
311 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
312 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
313 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
314 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
315 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
316 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
317 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
318 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
319 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
320 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
321 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
322 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
323 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
324 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
325 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
326 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
327 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
328 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
329 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
330 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
331 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
332 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
333 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
334 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
335 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
336 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
337 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
338 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
339 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
340 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
341 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
342 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
343 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
344 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
345 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
346 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
347 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
348 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
349 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
350 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
351 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
352 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
353 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
354 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
355 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
356 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
357 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
358 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
359 2922368715
360 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
361 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
362 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
363 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
364 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
365 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
366 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
367 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
368 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
369 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
370 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
371 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
372 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
373 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
374 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
375 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
376 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
377 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
378 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
379 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
380 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
381 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
382 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
383 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
384 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
385 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
386 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
387 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
388 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
389 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
390 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
391 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
392 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
393 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
394 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
395 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
396 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
397 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
398 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
399 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
400 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
401 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
402 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
403 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
404 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
405 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
406 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
407 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
408 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
409 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
410 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
411 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
412 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
413 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
414 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
415 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
416 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
417 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
418 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
419 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
420 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
421 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
422 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
423 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
424 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
425 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
426 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
427 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
428 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.22
Metatranscriptomes 0
Isolates 18.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.21
Nodule 14.48
Rhizoplane 6.71
Rhizosphere 45.43
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0020815 3300053136 Bacteria 2776
2 JGI24739J22299_10023399 3300001989 Bacteria 2185
3 JGI25406J46586_10110595 3300003203 Bacteria 813
4 JGI25153J46596_10002708 3300003215 Bacteria 10099
5 JGI25153J46596_10003233 3300003215 Bacteria 9162
6 JGI25153J46596_10018636 3300003215 Bacteria 2688
7 rootH2_10105818 3300003320 Bacteria 1390
8 rootL2_10012892 3300003322 Bacteria 1187
9 JGI25160J50197_1003677 3300003354 Bacteria 6791
10 JGI25160J50197_1013118 3300003354 Bacteria 2840
11 JGI25160J50197_1014007 3300003354 Bacteria 2703
12 JGI25404J52841_10003710 3300003659 Bacteria 3039
13 Ga0055531_10003250 3300003794 Bacteria 10436
14 Ga0055543_1002127 3300004625 Bacteria 6859
15 Ga0065165_1002451 3300005262 Bacteria 15679
16 Ga0065165_1018596 3300005262 Bacteria 2509
17 Ga0070676_10317297 3300005328 Bacteria 1062
18 Ga0068869_100200462 3300005334 Bacteria 1573
19 Ga0070661_100940264 3300005344 Bacteria 715
20 Ga0070668_100074414 3300005347 Bacteria 2650
21 Ga0070669_100247433 3300005353 Bacteria 1418
22 Ga0070671_100393572 3300005355 Bacteria 1185
23 Ga0070674_100234133 3300005356 Bacteria 1435
24 Ga0070659_100312742 3300005366 Bacteria 1312
25 Ga0070667_100055593 3300005367 Bacteria 3342
26 Ga0070714_100075094 3300005435 Bacteria 2932
27 Ga0070710_10000456 3300005437 Bacteria 19122
28 Ga0070701_10333970 3300005438 Bacteria 942
29 Ga0070711_100009171 3300005439 Bacteria 6081
30 Ga0070700_100259562 3300005441 Bacteria 1250
31 Ga0070678_100036434 3300005456 Bacteria 3444
32 Ga0070662_100273064 3300005457 Bacteria 1365
33 Ga0070706_100164216 3300005467 Bacteria 2073
34 Ga0070698_100367565 3300005471 Bacteria 1370
35 Ga0070697_100028518 3300005536 Bacteria 4470
36 Ga0068853_100481580 3300005539 Bacteria 1170
37 Ga0068853_100772606 3300005539 Bacteria 919
38 Ga0070665_100013957 3300005548 Bacteria 8079
39 Ga0070665_100051966 3300005548 Bacteria 4110
40 Ga0070665_100163742 3300005548 Bacteria 2226
41 Ga0070665_100579680 3300005548 Bacteria 1135
42 Ga0070704_100279894 3300005549 Bacteria 1382
43 Ga0070664_100169042 3300005564 Bacteria 1939
44 Ga0070664_100432982 3300005564 Bacteria 1206
45 Ga0068856_101071145 3300005614 Bacteria 824
46 Ga0070702_100144355 3300005615 Bacteria 1520
47 Ga0068852_100021760 3300005616 Bacteria 5129
48 Ga0068859_100059292 3300005617 Bacteria 3856
49 Ga0068859_100262160 3300005617 Bacteria 1820
50 Ga0068864_100091445 3300005618 Bacteria 2684
51 Ga0068864_100425088 3300005618 Bacteria 1266
52 Ga0068866_10312206 3300005718 Bacteria 986
53 Ga0068861_100095251 3300005719 Bacteria 2357
54 Ga0068861_100147388 3300005719 Bacteria 1927
55 Ga0068861_100542983 3300005719 Bacteria 1058
56 Ga0068851_10049286 3300005834 Bacteria 2136
57 Ga0068870_10352609 3300005840 Bacteria 945
58 Ga0068858_100174510 3300005842 Bacteria 2028
59 Ga0068858_100471027 3300005842 Bacteria 1212
60 Ga0068858_100880814 3300005842 Bacteria 875
61 Ga0068860_100000375 3300005843 Bacteria 58502
62 Ga0068860_100270696 3300005843 Bacteria 1658
63 Ga0068860_100622847 3300005843 Bacteria 1086
64 Ga0081455_10011331 3300005937 Bacteria 8965
65 Ga0081455_10203051 3300005937 Bacteria 1483
66 Ga0081540_1001325 3300005983 Bacteria 21608
67 Ga0081540_1005168 3300005983 Bacteria 9767
68 Ga0081540_1006128 3300005983 Bacteria 8831
69 Ga0081540_1010129 3300005983 Bacteria 6417
70 Ga0081539_10047729 3300005985 Bacteria 2442
71 Ga0070717_10464725 3300006028 Bacteria 1141
72 Ga0075365_10024563 3300006038 Bacteria 3803
73 Ga0075365_10028975 3300006038 Bacteria 3534
74 Ga0075365_10053489 3300006038 Bacteria 2674
75 Ga0075365_10131729 3300006038 Bacteria 1730
76 Ga0075365_10295109 3300006038 Bacteria 1140
77 Ga0075368_10084119 3300006042 Bacteria 1297
78 Ga0075368_10086009 3300006042 Bacteria 1283
79 Ga0075368_10230584 3300006042 Bacteria 788
80 Ga0075363_100005540 3300006048 Bacteria 5629
81 Ga0075363_100007334 3300006048 Bacteria 5060
82 Ga0075363_100304115 3300006048 Bacteria 926
83 Ga0075363_100347738 3300006048 Bacteria 865
84 Ga0075364_10044763 3300006051 Bacteria 2879
85 Ga0075364_10171987 3300006051 Bacteria 1464
86 Ga0070712_100137085 3300006175 Bacteria 1862
87 Ga0075362_10204218 3300006177 Bacteria 963
88 Ga0075367_10001088 3300006178 Bacteria 11216
89 Ga0075367_10036817 3300006178 Bacteria 2839
90 Ga0075367_10037730 3300006178 Bacteria 2809
91 Ga0075367_10135147 3300006178 Bacteria 1525
92 Ga0075369_10015328 3300006186 Bacteria 3074
93 Ga0075369_10061784 3300006186 Bacteria 1636
94 Ga0075369_10108914 3300006186 Bacteria 1248
95 Ga0075369_10155588 3300006186 Bacteria 1046
96 Ga0075366_10046167 3300006195 Bacteria 2581
97 Ga0075366_10267695 3300006195 Bacteria 1043
98 Ga0075366_10273948 3300006195 Bacteria 1031
99 Ga0097621_100184134 3300006237 Bacteria 1806
100 Ga0097621_100212333 3300006237 Bacteria 1684
101 Ga0075370_10023334 3300006353 Bacteria 3406
102 Ga0068871_100043550 3300006358 Bacteria 3605
103 Ga0068871_100567927 3300006358 Bacteria 1029
104 Ga0068871_100715702 3300006358 Bacteria 918
105 Ga0075429_100177237 3300006880 Bacteria 1868
106 Ga0068865_100134322 3300006881 Bacteria 1857
107 Ga0097620_100059293 3300006931 Bacteria 3856
108 Ga0097620_100262165 3300006931 Bacteria 1820
109 Ga0099825_1038128 3300006941 Bacteria 1548
110 Ga0099824_1028508 3300006942 Bacteria 2520
111 Ga0099823_1009877 3300006944 Bacteria 9694
112 Ga0099794_10039023 3300007265 Bacteria 2252
113 Ga0099794_10102531 3300007265 Bacteria 1429
114 Ga0111539_10338761 3300009094 Bacteria 1751
115 Ga0105245_10009439 3300009098 Bacteria 8508
116 Ga0105245_10424269 3300009098 Bacteria 1334
117 Ga0105245_10637428 3300009098 Bacteria 1095
118 Ga0105247_10075334 3300009101 Bacteria 2118
119 Ga0105247_10094791 3300009101 Bacteria 1900
120 Ga0105247_10288324 3300009101 Bacteria 1135
121 Ga0105247_10664498 3300009101 Bacteria 780
122 Ga0114129_10196368 3300009147 Bacteria 2736
123 Ga0105243_10066405 3300009148 Bacteria 2901
124 Ga0105243_10378803 3300009148 Bacteria 1308
125 Ga0105241_10011623 3300009174 Bacteria 6456
126 Ga0105241_10026653 3300009174 Bacteria 4301
127 Ga0105241_10160952 3300009174 Bacteria 1845
128 Ga0105241_10286118 3300009174 Bacteria 1410
129 Ga0105248_10514044 3300009177 Bacteria 1350
130 Ga0105237_10260496 3300009545 Bacteria 1737
131 Ga0105237_10395736 3300009545 Bacteria 1386
132 Ga0105249_10072125 3300009553 Bacteria 3192
133 Ga0105239_10028656 3300010375 Bacteria 6122
134 Ga0105239_10132924 3300010375 Bacteria 2769
135 Ga0105239_10554377 3300010375 Bacteria 1309
136 Ga0105246_10020383 3300011119 Bacteria 4251
137 Ga0157374_10015011 3300013296 Bacteria 6790
138 Ga0157378_10509911 3300013297 Bacteria 1203
139 Ga0163162_10140908 3300013306 Bacteria 2524
140 Ga0163162_10282085 3300013306 Bacteria 1793
141 Ga0163162_10727476 3300013306 Bacteria 1113
142 Ga0157375_10070304 3300013308 Bacteria 3510
143 Ga0157375_10104941 3300013308 Bacteria 2915
144 Ga0163163_10054061 3300014325 Bacteria 3966
145 Ga0163163_10253148 3300014325 Bacteria 1812
146 Ga0163163_10255063 3300014325 Bacteria 1805
147 Ga0163163_10290686 3300014325 Bacteria 1686
148 Ga0157380_10659476 3300014326 Bacteria 1045
149 Ga0157377_10149932 3300014745 Bacteria 1441
150 Ga0157377_10204831 3300014745 Bacteria 1255
151 Ga0157379_11028882 3300014968 Bacteria 786
152 Ga0157376_10266502 3300014969 Bacteria 1607
153 Ga0163161_10206261 3300017792 Bacteria 1516
154 Ga0214544_1000136 3300021320 Bacteria 107814
155 Ga0214542_1000127 3300021321 Bacteria 107829
156 Ga0214545_1000063 3300021324 Bacteria 107829
157 Ga0214543_1025648 3300021327 Bacteria 3349
158 Ga0209233_1005987 3300025261 Bacteria 3970
159 Ga0209673_1041610 3300025273 Bacteria 1302
160 Ga0209564_1023481 3300025295 Bacteria 2140
161 Ga0209758_1000011 3300025297 Bacteria 1049685
162 Ga0209758_1000455 3300025297 Bacteria 68279
163 Ga0209758_1002032 3300025297 Bacteria 21725
164 Ga0209758_1002609 3300025297 Bacteria 17979
165 Ga0209758_1003239 3300025297 Bacteria 15109
166 Ga0209758_1025408 3300025297 Bacteria 2600
167 Ga0209256_1009705 3300025299 Bacteria 4165
168 Ga0207426_1000505 3300025302 Bacteria 57583
169 Ga0207426_1000551 3300025302 Bacteria 51985
170 Ga0207426_1005180 3300025302 Bacteria 6059
171 Ga0207426_1010268 3300025302 Bacteria 3643
172 Ga0207426_1014745 3300025302 Bacteria 2857
173 Ga0209257_1003002 3300025304 Bacteria 15298
174 Ga0207692_10077716 3300025898 Bacteria 1766
175 Ga0207710_10051486 3300025900 Bacteria 1849
176 Ga0207688_10408045 3300025901 Bacteria 843
177 Ga0207685_10143354 3300025905 Bacteria 1073
178 Ga0207699_10001548 3300025906 Bacteria 10901
179 Ga0207684_10563252 3300025910 Bacteria 974
180 Ga0207654_10106004 3300025911 Bacteria 1740
181 Ga0207671_10020951 3300025914 Bacteria 4970
182 Ga0207671_10589408 3300025914 Bacteria 886
183 Ga0207693_10148467 3300025915 Bacteria 1843
184 Ga0207663_10037957 3300025916 Bacteria 2907
185 Ga0207681_10481508 3300025923 Bacteria 1014
186 Ga0207694_10312874 3300025924 Bacteria 1295
187 Ga0207687_10082863 3300025927 Bacteria 2321
188 Ga0207687_10300007 3300025927 Bacteria 1294
189 Ga0207664_10194671 3300025929 Bacteria 1747
190 Ga0207644_10466192 3300025931 Bacteria 1039
191 Ga0207690_10158241 3300025932 Bacteria 1686
192 Ga0207706_10237194 3300025933 Bacteria 1595
193 Ga0207709_10258823 3300025935 Bacteria 1275
194 Ga0207670_10078401 3300025936 Bacteria 2304
195 Ga0207711_10216910 3300025941 Bacteria 1749
196 Ga0207689_10106626 3300025942 Bacteria 2302
197 Ga0207689_10133579 3300025942 Bacteria 2043
198 Ga0207689_10206577 3300025942 Bacteria 1622
199 Ga0207668_10169544 3300025972 Bacteria 1710
200 Ga0207668_10299061 3300025972 Bacteria 1327
201 Ga0207668_10613420 3300025972 Bacteria 949
202 Ga0207658_10305391 3300025986 Bacteria 1372
203 Ga0207677_10013311 3300026023 Bacteria 4762
204 Ga0207703_10427855 3300026035 Bacteria 1233
205 Ga0207703_10562046 3300026035 Bacteria 1076
206 Ga0207703_10727781 3300026035 Bacteria 944
207 Ga0207639_10100462 3300026041 Bacteria 2337
208 Ga0207639_10218476 3300026041 Bacteria 1645
209 Ga0207678_10036300 3300026067 Bacteria 4290
210 Ga0207678_10065576 3300026067 Bacteria 3118
211 Ga0207678_10066334 3300026067 Bacteria 3100
212 Ga0207678_10363476 3300026067 Bacteria 1249
213 Ga0207702_10789064 3300026078 Bacteria 939
214 Ga0207676_10067440 3300026095 Bacteria 2858
215 Ga0207676_10124236 3300026095 Bacteria 2182
216 Ga0207676_10147493 3300026095 Bacteria 2022
217 Ga0207675_100387724 3300026118 Bacteria 1375
218 Ga0207675_100607104 3300026118 Bacteria 1097
219 Ga0207675_100653474 3300026118 Bacteria 1058
220 Ga0207683_10011017 3300026121 Bacteria 7707
221 Ga0207683_10725095 3300026121 Bacteria 922
222 Ga0207698_10013899 3300026142 Bacteria 5331
223 Ga0207698_10071429 3300026142 Bacteria 2754
224 Ga0209389_1001313 3300027296 Bacteria 17360
225 Ga0209389_1001336 3300027296 Bacteria 17260
226 Ga0209589_1004535 3300027357 Bacteria 23952
227 Ga0209489_100050 3300027361 Bacteria 154669
228 Ga0209489_104795 3300027361 Bacteria 24473
229 Ga0209700_100016 3300027363 Bacteria 252567
230 Ga0209813_10019045 3300027866 Bacteria 1903
231 Ga0268266_10001826 3300028379 Bacteria 24057
232 Ga0268266_10010741 3300028379 Bacteria 7979
233 Ga0268266_10231254 3300028379 Bacteria 1703
234 Ga0268266_10610102 3300028379 Bacteria 1048
235 Ga0268265_10297935 3300028380 Bacteria 1450
236 Ga0268265_10555528 3300028380 Bacteria 1090
237 Ga0268264_10000162 3300028381 Bacteria 148472
238 Ga0268264_10198209 3300028381 Bacteria 1835
239 Ga0268264_10478565 3300028381 Bacteria 1211
240 Ga0265330_10015894 3300031235 Bacteria 3478
241 Ga0265330_10129102 3300031235 Bacteria 1076
242 Ga0265328_10036923 3300031239 Bacteria 1805
243 Ga0265328_10087978 3300031239 Bacteria 1147
244 Ga0265325_10064839 3300031241 Bacteria 1846
245 Ga0265340_10006556 3300031247 Bacteria 6396
246 Ga0265340_10031355 3300031247 Bacteria 2658
247 Ga0265339_10119793 3300031249 Bacteria 1354
248 Ga0265331_10088377 3300031250 Bacteria 1434
249 Ga0265331_10088995 3300031250 Bacteria 1428
250 Ga0265316_10128613 3300031344 Bacteria 1909
251 Ga0307513_10142108 3300031456 Bacteria 2325
252 Ga0307509_10004051 3300031507 Bacteria 21514
253 Ga0307509_10224352 3300031507 Bacteria 1688
254 Ga0307509_10321993 3300031507 Bacteria 1282
255 Ga0307408_100502497 3300031548 Unclassified 1062
256 Ga0307408_101030206 3300031548 Bacteria 760
257 Ga0307508_10286442 3300031616 Bacteria 1240
258 Ga0265342_10074242 3300031712 Bacteria 1976
259 Ga0307516_10025850 3300031730 Bacteria 5971
260 Ga0307516_10027417 3300031730 Bacteria 5775
261 Ga0307516_10047338 3300031730 Bacteria 4237
262 Ga0307405_10158615 3300031731 Bacteria 1600
263 Ga0307410_10416615 3300031852 Bacteria 1089
264 Ga0307407_10309658 3300031903 Bacteria 1104
265 Ga0307409_100205001 3300031995 Bacteria 1767
266 Ga0307409_100758938 3300031995 Bacteria 974
267 Ga0307507_10234252 3300033179 Bacteria 1212
268 Ga0307510_10105668 3300033180 Bacteria 2582
269 Ga0373926_0172918 3300035083 Bacteria 827
270 Ga0373927_0024820 3300035695 Bacteria 3917
271 Ga0373925_0028470 3300037068 Bacteria 4094
272 Ga0373925_0787070 3300037068 Bacteria 784
273 Ga0395900_0321407 3300037418 Bacteria 1528
274 Ga0395905_0029357 3300037471 Bacteria 5181
275 Ga0395905_0445141 3300037471 Bacteria 1193
276 Ga0395901_0272769 3300038443 Bacteria 1759
277 Ga0451797_1453042 3300041453 Bacteria 846
278 Ga0451802_0948964 3300041460 Bacteria 1600
279 Ga0451804_0219794 3300041463 Bacteria 1351
280 Ga0466963_0004299 3300044694 Bacteria 8266
281 Ga0466971_0064947 3300044719 Bacteria 1652
282 Ga0466960_0020021 3300044901 Bacteria 2957
283 Ga0466960_0190061 3300044901 Bacteria 1117
284 Ga0466959_0327999 3300045049 Bacteria 1046
285 Ga0466967_0029412 3300045976 Bacteria 4597
286 Ga0495617_037694 3300046452 Bacteria 1618
287 Ga0495617_058128 3300046452 Bacteria 1281
288 Ga0495603_0008804 3300046455 Bacteria 6101
289 Ga0495590_0070013 3300046457 Bacteria 1230
290 Ga0495638_0067676 3300046460 Bacteria 2192
291 Ga0495638_0094277 3300046460 Bacteria 1800
292 Ga0495638_0115525 3300046460 Bacteria 1590
293 Ga0495638_0122204 3300046460 Bacteria 1537
294 Ga0495641_0083486 3300046461 Bacteria 1431
295 Ga0495651_0034644 3300046462 Bacteria 3935
296 Ga0495605_0036683 3300046474 Bacteria 2470
297 Ga0495605_0072485 3300046474 Bacteria 1624
298 Ga0495639_0152539 3300046475 Bacteria 1115
299 Ga0495664_0057169 3300046477 Bacteria 2320
300 Ga0495584_0081289 3300046491 Bacteria 1631
301 Ga0495594_0126156 3300046499 Bacteria 1448
302 Ga0495596_0137730 3300046500 Bacteria 947
303 Ga0495583_0098609 3300046506 Bacteria 1249
304 Ga0495583_0108008 3300046506 Bacteria 1181
305 Ga0495583_0165827 3300046506 Bacteria 910
306 Ga0495606_0010770 3300046507 Bacteria 7536
307 Ga0495606_0238799 3300046507 Bacteria 1014
308 Ga0495608_0086893 3300046511 Bacteria 2026
309 Ga0495610_0045065 3300046512 Bacteria 2184
310 Ga0495616_0209406 3300046513 Bacteria 853
311 Ga0495628_0029319 3300046516 Bacteria 4463
312 Ga0495631_0068463 3300046518 Bacteria 1535
313 Ga0495643_0085527 3300046522 Bacteria 1635
314 Ga0495643_0170535 3300046522 Bacteria 1064
315 Ga0495644_0006055 3300046523 Bacteria 4710
316 Ga0495644_0156539 3300046523 Bacteria 873
317 Ga0495648_0044751 3300046524 Bacteria 2760
318 Ga0495648_0082977 3300046524 Bacteria 1817
319 Ga0495648_0163773 3300046524 Bacteria 1146
320 Ga0495648_0229796 3300046524 Bacteria 909
321 Ga0495663_0035120 3300046525 Bacteria 1504
322 Ga0495663_0132697 3300046525 Bacteria 841
323 Ga0495652_0047190 3300046529 Bacteria 3694
324 Ga0495609_0035489 3300046538 Bacteria 2257
325 Ga0495609_0036103 3300046538 Bacteria 2234
326 Ga0495621_0009681 3300046539 Bacteria 2934
327 Ga0495645_0018228 3300046543 Bacteria 5040
328 Ga0495622_0049066 3300046557 Bacteria 1960
329 Ga0495622_0098408 3300046557 Bacteria 1341
330 Ga0495633_0065607 3300046558 Bacteria 1696
331 Ga0495633_0126429 3300046558 Bacteria 1183
332 Ga0495656_0007212 3300046615 Bacteria 3923
333 Ga0495656_0029782 3300046615 Bacteria 2200
334 Ga0495656_0075485 3300046615 Bacteria 1508
335 Ga0495668_0049194 3300046616 Bacteria 2338
336 Ga0495668_0059408 3300046616 Bacteria 2110
337 Ga0495668_0200163 3300046616 Bacteria 1093
338 Ga0495668_0215524 3300046616 Bacteria 1051
339 Ga0495634_0111392 3300046642 Bacteria 1759
340 Ga0495611_0166187 3300046648 Bacteria 1031
341 Ga0495625_0133014 3300046660 Bacteria 1684
342 Ga0495625_0363461 3300046660 Bacteria 912
343 Ga0495625_0411583 3300046660 Bacteria 843
344 Ga0495635_0062110 3300046663 Bacteria 2565
345 Ga0495659_0033833 3300046664 Bacteria 1795
346 Ga0495661_0148736 3300046665 Bacteria 1267
347 Ga0495661_0157265 3300046665 Bacteria 1223
348 Ga0495588_0086134 3300046674 Bacteria 1643
349 Ga0495588_0090547 3300046674 Bacteria 1602
350 Ga0495588_0143410 3300046674 Bacteria 1262
351 Ga0495588_0234664 3300046674 Bacteria 968
352 Ga0495657_0006212 3300046675 Bacteria 9371
353 Ga0495599_0068011 3300046678 Bacteria 2224
354 Ga0495623_0034607 3300046679 Bacteria 3239
355 Ga0495646_0068544 3300046680 Bacteria 2094
356 Ga0495669_0012501 3300046684 Bacteria 3614
357 Ga0495670_0060188 3300046691 Bacteria 1908
358 Ga0495670_0114185 3300046691 Bacteria 1399
359 Ga0495670_0152742 3300046691 Bacteria 1211
360 Ga0495671_0184713 3300046692 Bacteria 1012
361 Ga0495649_0025699 3300046694 Bacteria 3279
362 Ga0495589_0069060 3300046794 Bacteria 1728
363 Ga0495589_0205565 3300046794 Bacteria 928
364 Ga0495600_0025275 3300046809 Bacteria 3827
365 Ga0495604_0037299 3300047317 Bacteria 3829
366 Ga0495636_0055997 3300047318 Bacteria 1659
367 Ga0495674_0239048 3300047319 Bacteria 1497
368 Ga0495676_0344486 3300047321 Bacteria 997
369 Ga0495680_0014952 3300047322 Bacteria 6704
370 Ga0495683_0128971 3300047323 Bacteria 1194
371 Ga0495675_0040656 3300047444 Bacteria 2963
372 Ga0495677_0104012 3300047445 Bacteria 1076
373 Ga0495677_0107208 3300047445 Bacteria 1060
374 Ga0495679_091784 3300047446 Bacteria 851
375 Ga0495686_0080299 3300047472 Bacteria 1994
376 Ga0495686_0327875 3300047472 Bacteria 837
377 Ga0496100_0098142 3300048903 Bacteria 2013
378 Ga0496100_0218177 3300048903 Bacteria 1399
379 Ga0496101_0092202 3300048904 Bacteria 2255
380 Ga0496101_0621021 3300048904 Bacteria 854
381 Ga0496102_0001228 3300048905 Bacteria 23201
382 Ga0496102_0167966 3300048905 Bacteria 2065
383 Ga0496102_0537883 3300048905 Bacteria 1091
384 Ga0496104_0053145 3300048907 Bacteria 3826
385 Ga0496104_0064408 3300048907 Bacteria 3477
386 Ga0496104_0086849 3300048907 Bacteria 2986
387 Ga0496104_0585717 3300048907 Bacteria 1026
388 Ga0496105_0043751 3300048908 Bacteria 3693
389 Ga0496105_0512230 3300048908 Bacteria 941
390 Ga0496105_0512519 3300048908 Bacteria 940
391 Ga0496106_0000872 3300048909 Bacteria 21975
392 Ga0496106_0011320 3300048909 Bacteria 6603
393 Ga0496106_0034551 3300048909 Bacteria 3777
394 Ga0496106_0230669 3300048909 Bacteria 1478
395 Ga0496107_0050603 3300048910 Bacteria 2995
396 Ga0496107_0071490 3300048910 Bacteria 2521
397 Ga0496108_0112132 3300048911 Bacteria 2333
398 Ga0496108_0205346 3300048911 Bacteria 1710
399 Ga0496108_0463726 3300048911 Bacteria 1107
400 Ga0496109_0410258 3300048912 Bacteria 1280
401 Ga0496109_0514735 3300048912 Bacteria 1129
402 Ga0496110_0330084 3300048913 Bacteria 1389
403 Ga0496110_0357096 3300048913 Bacteria 1331
404 Ga0496110_0489186 3300048913 Bacteria 1121
405 Ga0496110_0493204 3300048913 Bacteria 1115
406 Ga0496111_0059228 3300048914 Bacteria 2774
407 Ga0496112_0191138 3300048915 Bacteria 2009
408 Ga0496113_0077273 3300048916 Bacteria 2545
409 Ga0496113_0296043 3300048916 Bacteria 1295
410 Ga0496114_0009711 3300048917 Bacteria 7644
411 Ga0496114_0292285 3300048917 Bacteria 1438
412 Ga0496114_0383962 3300048917 Bacteria 1243
413 Ga0496114_0447291 3300048917 Bacteria 1144
414 Ga0496114_0677261 3300048917 Bacteria 906
415 Ga0496115_0004243 3300048918 Bacteria 10365
416 Ga0496115_0031778 3300048918 Bacteria 4162
417 Ga0496115_0705273 3300048918 Bacteria 793
418 Ga0496116_0046844 3300048919 Bacteria 2915
419 Ga0496117_0010585 3300048920 Bacteria 8381
420 Ga0496117_0017698 3300048920 Bacteria 5945
421 Ga0496117_0108751 3300048920 Bacteria 1733
422 Ga0496118_0007948 3300048921 Bacteria 11096
423 Ga0496118_0167932 3300048921 Bacteria 1345
424 Ga0496118_0213993 3300048921 Bacteria 1128
425 Ga0496118_0241819 3300048921 Bacteria 1033
426 Ga0496119_0073680 3300048922 Bacteria 1991
427 Ga0496119_0148893 3300048922 Bacteria 1256
428 Ga0496120_0064952 3300048923 Bacteria 2024
429 Ga0496121_0000110 3300048924 Bacteria 186482
430 Ga0496121_0008232 3300048924 Bacteria 12345
431 Ga0496121_0045785 3300048924 Bacteria 3755
432 Ga0496121_0090517 3300048924 Bacteria 2391
433 Ga0496121_0091430 3300048924 Bacteria 2376
434 Ga0496121_0094458 3300048924 Bacteria 2326
435 Ga0496121_0106311 3300048924 Bacteria 2151
436 Ga0496121_0183286 3300048924 Bacteria 1508
437 Ga0496121_0206395 3300048924 Bacteria 1396
438 Ga0496121_0240916 3300048924 Bacteria 1260
439 Ga0496121_0315643 3300048924 Bacteria 1054
440 Ga0496121_0325600 3300048924 Bacteria 1033
441 Ga0496124_0007971 3300048927 Bacteria 11150
442 Ga0496124_0268819 3300048927 Bacteria 1250
443 Ga0496125_0000850 3300048928 Bacteria 49000
444 Ga0496125_0030441 3300048928 Bacteria 4828
445 Ga0496125_0119308 3300048928 Bacteria 1886
446 Ga0496125_0201057 3300048928 Bacteria 1304
447 Ga0496126_0009637 3300048929 Bacteria 10236
448 Ga0496126_0015967 3300048929 Bacteria 7529
449 Ga0496126_0049134 3300048929 Bacteria 3852
450 Ga0496126_0076962 3300048929 Bacteria 2959
451 Ga0496126_0129290 3300048929 Bacteria 2184
452 Ga0496126_0212337 3300048929 Bacteria 1629
453 Ga0496126_0224935 3300048929 Bacteria 1574
454 Ga0496126_0226026 3300048929 Bacteria 1570
455 Ga0496126_0310230 3300048929 Bacteria 1299
456 Ga0496126_0314180 3300048929 Bacteria 1289
457 Ga0496126_0415700 3300048929 Bacteria 1088
458 Ga0495682_0017242 3300049460 Bacteria 2728
459 nmdc:mga03683_123006_c1 3300050489 Bacteria 1155
460 nmdc:mga03683_59814_c1 3300050489 Bacteria 1608
461 nmdc:mga03n38_2963_c1 3300050490 Bacteria 5365
462 nmdc:mga03n38_7461_c1 3300050490 Bacteria 3872
463 nmdc:mga0yw44_139804_c1 3300050492 Bacteria 1573
464 nmdc:mga0yw44_239319_c1 3300050492 Bacteria 1206
465 nmdc:mga0yw44_37410_c1 3300050492 Bacteria 2865
466 nmdc:mga06z11_11048_c1 3300050494 Bacteria 3876
467 nmdc:mga04h51_83521_c1 3300050495 Bacteria 1138
468 nmdc:mga07m45_233999_c1 3300050496 Bacteria 1069
469 nmdc:mga07m45_256168_c1 3300050496 Bacteria 1018
470 nmdc:mga05p37_75879_c1 3300050507 Bacteria 4138
471 nmdc:mga09592_205866_c1 3300050508 Bacteria 1704
472 nmdc:mga0sz30_131604_c1 3300050516 Bacteria 1102
473 nmdc:mga0sz30_13469_c1 3300050516 Bacteria 1634
474 nmdc:mga0sz30_21687_c1 3300050516 Bacteria 2602
475 Ga0500635_0028908 3300053080 Bacteria 1775
476 Ga0495619_0207038 3300053085 Bacteria 1358
477 Ga0500643_000042 3300053087 Bacteria 158933
478 Ga0500643_011960 3300053087 Bacteria 3132
479 Ga0500647_0073401 3300053091 Bacteria 1642
480 Ga0500647_0175352 3300053091 Bacteria 987
481 Ga0500583_0018820 3300053092 Bacteria 2816
482 Ga0500583_0060494 3300053092 Bacteria 1786
483 Ga0500566_0000264 3300053094 Bacteria 28047
484 Ga0500566_0027838 3300053094 Bacteria 3307
485 Ga0500566_0050799 3300053094 Bacteria 2373
486 Ga0500566_0097311 3300053094 Bacteria 1618
487 Ga0500641_0033313 3300053096 Bacteria 2044
488 Ga0500641_0074886 3300053096 Bacteria 1430
489 Ga0500650_0231965 3300053098 Bacteria 832
490 Ga0500554_015050 3300053102 Bacteria 2010
491 Ga0500555_097529 3300053103 Bacteria 749
492 Ga0500557_000006 3300053105 Bacteria 141252
493 Ga0500558_096543 3300053106 Bacteria 1181
494 Ga0500562_003681 3300053108 Bacteria 3850
495 Ga0500572_142693 3300053111 Bacteria 780
496 Ga0500595_001887 3300053119 Bacteria 10803
497 Ga0500595_007717 3300053119 Bacteria 4448
498 Ga0500595_007915 3300053119 Bacteria 4372
499 Ga0500614_063896 3300053123 Bacteria 995
500 Ga0500617_045320 3300053124 Bacteria 1966
501 Ga0500642_0000686 3300053130 Bacteria 10021
502 Ga0500642_0024530 3300053130 Bacteria 2438
503 Ga0500559_0070215 3300053136 Bacteria 1576
504 Ga0500559_0080445 3300053136 Bacteria 1480
505 Ga0500568_0110345 3300053139 Bacteria 1028
506 Ga0500568_0157825 3300053139 Bacteria 838
507 Ga0500577_0093064 3300053142 Bacteria 1221
508 Ga0500589_100539 3300053147 Bacteria 1256
509 Ga0500603_026591 3300053150 Bacteria 1464
510 Ga0500604_0031192 3300053151 Bacteria 1563
511 Ga0500616_0061752 3300053153 Bacteria 1938
512 Ga0500622_0086649 3300053156 Bacteria 1560
513 Ga0500638_000372 3300053162 Bacteria 10470
514 Ga0500638_077492 3300053162 Bacteria 1582
515 Ga0500638_134387 3300053162 Bacteria 1118
516 Ga0500639_015076 3300053163 Bacteria 4067
517 Ga0500636_0005482 3300053177 Bacteria 7248
518 Ga0500636_0005968 3300053177 Bacteria 6979
519 Ga0500636_0084316 3300053177 Bacteria 1827
520 Ga0500636_0174659 3300053177 Bacteria 1159
521 Ga0500637_0000753 3300053178 Bacteria 12967
522 Ga0500637_0033606 3300053178 Bacteria 2865
523 Ga0500570_077214 3300053724 Bacteria 1521
524 Ga0500611_006460 3300053727 Bacteria 1710
525 Ga0500625_000351 3300053729 Bacteria 11670
526 Ga0500645_007279 3300053730 Bacteria 3869
527 Ga0500609_006454 3300053731 Bacteria 1598
528 Ga0500552_015446 3300053733 Bacteria 1021
529 Ga0500596_004073 3300053735 Bacteria 2711
530 Ga0500599_000308 3300053736 Bacteria 4749
531 Ga0500601_000355 3300053737 Bacteria 8336
532 Ga0500661_001131 3300055283 Bacteria 4997
533 2511397699 2511231028 Bacteria 8046582
534 2513627123 2513237092 Bacteria 8341956
535 2513637232 2513237094 Bacteria 8789602
536 2513651624 2513237095 Bacteria 8976980
537 2513876786 2513237139 Bacteria 8737671
538 2514012176 2513237161 Bacteria 8871253
539 2517107377 2517093001 Bacteria 9002274
540 2524439540 2524023205 Bacteria 8918781
541 2528851005 2528768022 Bacteria 10457665
542 2617348031 2617270735 Bacteria 9163226
543 2617377736 2617270741 Bacteria 8201522
544 2745081813 2744054633 Bacteria 8678936
545 2793065985 2791355196 Bacteria 7323613
546 2805918766 2802429603 Bacteria 8777136
547 2818243235 2816332527 Bacteria 8933356
548 2824605481 2824600985 Bacteria 8488197
549 2824614819 2824609381 Bacteria 8672835
550 2824658070 2824653114 Bacteria 8493680
551 2824667913 2824661429 Bacteria 9877870
552 2824673926 2824671348 Bacteria 8369588
553 2824681676 2824679649 Bacteria 8248951
554 2824690626 2824687955 Bacteria 8360029
555 2824698147 2824696289 Bacteria 8335049
556 2824707488 2824704595 Bacteria 9667483
557 2824736965 2824732956 Bacteria 7810675
558 2824746422 2824746037 Bacteria 7911610
559 2824759251 2824753945 Bacteria 9787441
560 2824769559 2824763712 Bacteria 9792355
561 2824776142 2824773399 Bacteria 8360218
562 2842045023 2842038055 Bacteria 8002051
563 2842052791 2842045827 Bacteria 8006841
564 2844320536 2844315083 Bacteria 8138177
565 2847938079 2847930680 Bacteria 9342022
566 2847939994 2847939898 Bacteria 8606328
567 2849077806 2849076700 Bacteria 7039503
568 2857510982 2857509624 Bacteria 7472071
569 2874616781 2874612657 Bacteria 8252029
570 2874625862 2874620515 Bacteria 8290088
571 2876769113 2876761206 Bacteria 10111113
572 2879084374 2879083081 Bacteria 8587928
573 2879100223 2879099564 Bacteria 10442239
574 2881367790 2881364244 Bacteria 7710352
575 2881672257 2881665667 Bacteria 8175609
576 2885368473 2885366525 Bacteria 8326213
577 2885410058 2885409591 Bacteria 9235467
578 2888386028 2888378607 Bacteria 9652610
579 2888426144 2888419890 Bacteria 7857137
580 2903732827 2903727486 Bacteria 8281579
581 2904673777 2904666416 Bacteria 8226587
582 2904717596 2904711408 Bacteria 9771557
583 2906605626 2906602504 Bacteria 8295279
584 2906628004 2906626472 Bacteria 8826946
585 2906644075 2906643746 Bacteria 8722424
586 2908782218 2908775508 Bacteria 8092255
587 2922376356
588 2922399926 2922393267 Bacteria 8285685
589 2929624012 2929615660 Bacteria 9193770
590 2929633153 2929624759 Bacteria 9339455
591 2932792678 2932784394 Bacteria 9704911
592 2932797855 2932794094 Bacteria 7915132
593 2932806391 2932801729 Bacteria 7987968
594 2932815232 2932809354 Bacteria 9135765
595 2932824489 2932818245 Bacteria 9955613
596 2932832111 2932828146 Bacteria 9745859
597 2933585913 2933577622 Bacteria 9116884
598 2935622050 2935616580 Bacteria 9032984
599 2935643940 2935638405 Bacteria 10015038
600 2935669145 2935665750 Bacteria 9571747
601 2935683297 2935675223 Bacteria 9928132
602 2935692238 2935684952 Bacteria 9590419
603 2935700591 2935694250 Bacteria 9291695
604 2935708780 2935703347 Bacteria 10242284
605 2935720524 2935713505 Bacteria 9608509
606 2935729805 2935722832 Bacteria 9608746
607 2935739213 2935732158 Bacteria 9706831
608 2935748246 2935741537 Bacteria 9707219
609 2935758449 2935750917 Bacteria 9590372
610 2935766124 2935760218 Bacteria 9817913
611 2935771003 2935769743 Bacteria 7878163
612 2935781170 2935777560 Bacteria 8077691
613 2935786296 2935785616 Bacteria 7962367
614 2935793907 2935793552 Bacteria 8012592
615 2935805861 2935801545 Bacteria 9301974
616 2935815580 2935810662 Bacteria 9401221
617 2935833192 2935827899 Bacteria 10038562
618 2935843238 2935837841 Bacteria 9454360
619 2935860297 2935855204 Bacteria 9035059
620 2935867694 2935864058 Bacteria 9784707
621 2935878496 2935873716 Bacteria 9632195
622 2935888398 2935883170 Bacteria 7964738
623 2935998620 2935992306 Bacteria 9802711
624 2936006927 2936002035 Bacteria 9362176
625 2936040818 2936037263 Bacteria 9446081
626 2940564353 2940556831 Bacteria 9590747
627 2941531734 2941531003 Bacteria 7653939
628 2941544784 2941538514 Bacteria 9402094
629 3005488403 3005483717 Bacteria 7877331
630 3005511515 3005506211 Bacteria 6943378
631 3005594393 3005587118 Bacteria 7794411
632 3005716322 3005710791 Bacteria 7622528
633 8006934527 8006933436 Bacteria 10410654
634 8006974497 8006973647 Bacteria 10679141
635 8006988504 8006984368 Bacteria 9651211
636 8016520055 8016511872 Bacteria 9921665
637 8016527972 8016522445 Bacteria 8156687
638 8016533095 8016530956 Bacteria 8155261
639 8016555797 8016548790 Bacteria 8155074
640 8016564146 8016557553 Bacteria 8154380
641 8016571410 8016566248 Bacteria 8158151
642 8016575669 8016575299 Bacteria 8154085
643 8016595044 8016583857 Bacteria 10421953
644 8016601849 8016595262 Bacteria 8149947
645 8016616466 8016613128 Bacteria 8794220
646 8016624672 8016622563 Bacteria 7999408
647 8017065499 8017057580 Bacteria 10023680
648 8019532894 8019530166 Bacteria 8155624
649 8019546958 8019538911 Bacteria 7872763
650 8019551711 8019547302 Bacteria 7996444
651 8019584902 8019576017 Bacteria 10049540
652 8019592854 8019586578 Bacteria 10212056
653 8019598603 8019597564 Bacteria 10041141
654 8019609773 8019608314 Bacteria 10042931
655 8055744516 8055742211 Bacteria 9226248
656 8056970442 8056967851 Bacteria 9038162
657 Ga0500559_0020815
658 JGI24739J22299_10023399
659 JGI25406J46586_10110595
660 JGI25153J46596_10002708
661 JGI25153J46596_10003233
662 JGI25153J46596_10018636
663 rootH2_10105818
664 rootL2_10012892
665 JGI25160J50197_1003677
666 JGI25160J50197_1013118
667 JGI25160J50197_1014007
668 JGI25404J52841_10003710
669 Ga0055531_10003250
670 Ga0055543_1002127
671 Ga0065165_1002451
672 Ga0065165_1018596
673 Ga0070676_10317297
674 Ga0068869_100200462
675 Ga0070661_100940264
676 Ga0070668_100074414
677 Ga0070669_100247433
678 Ga0070671_100393572
679 Ga0070674_100234133
680 Ga0070659_100312742
681 Ga0070667_100055593
682 Ga0070714_100075094
683 Ga0070710_10000456
684 Ga0070701_10333970
685 Ga0070711_100009171
686 Ga0070700_100259562
687 Ga0070678_100036434
688 Ga0070662_100273064
689 Ga0070706_100164216
690 Ga0070698_100367565
691 Ga0070697_100028518
692 Ga0068853_100481580
693 Ga0068853_100772606
694 Ga0070665_100013957
695 Ga0070665_100051966
696 Ga0070665_100163742
697 Ga0070665_100579680
698 Ga0070704_100279894
699 Ga0070664_100169042
700 Ga0070664_100432982
701 Ga0068856_101071145
702 Ga0070702_100144355
703 Ga0068852_100021760
704 Ga0068859_100059292
705 Ga0068859_100262160
706 Ga0068864_100091445
707 Ga0068864_100425088
708 Ga0068866_10312206
709 Ga0068861_100095251
710 Ga0068861_100147388
711 Ga0068861_100542983
712 Ga0068851_10049286
713 Ga0068870_10352609
714 Ga0068858_100174510
715 Ga0068858_100471027
716 Ga0068858_100880814
717 Ga0068860_100000375
718 Ga0068860_100270696
719 Ga0068860_100622847
720 Ga0081455_10011331
721 Ga0081455_10203051
722 Ga0081540_1001325
723 Ga0081540_1005168
724 Ga0081540_1006128
725 Ga0081540_1010129
726 Ga0081539_10047729
727 Ga0070717_10464725
728 Ga0075365_10024563
729 Ga0075365_10028975
730 Ga0075365_10053489
731 Ga0075365_10131729
732 Ga0075365_10295109
733 Ga0075368_10084119
734 Ga0075368_10086009
735 Ga0075368_10230584
736 Ga0075363_100005540
737 Ga0075363_100007334
738 Ga0075363_100304115
739 Ga0075363_100347738
740 Ga0075364_10044763
741 Ga0075364_10171987
742 Ga0070712_100137085
743 Ga0075362_10204218
744 Ga0075367_10001088
745 Ga0075367_10036817
746 Ga0075367_10037730
747 Ga0075367_10135147
748 Ga0075369_10015328
749 Ga0075369_10061784
750 Ga0075369_10108914
751 Ga0075369_10155588
752 Ga0075366_10046167
753 Ga0075366_10267695
754 Ga0075366_10273948
755 Ga0097621_100184134
756 Ga0097621_100212333
757 Ga0075370_10023334
758 Ga0068871_100043550
759 Ga0068871_100567927
760 Ga0068871_100715702
761 Ga0075429_100177237
762 Ga0068865_100134322
763 Ga0097620_100059293
764 Ga0097620_100262165
765 Ga0099825_1038128
766 Ga0099824_1028508
767 Ga0099823_1009877
768 Ga0099794_10039023
769 Ga0099794_10102531
770 Ga0111539_10338761
771 Ga0105245_10009439
772 Ga0105245_10424269
773 Ga0105245_10637428
774 Ga0105247_10075334
775 Ga0105247_10094791
776 Ga0105247_10288324
777 Ga0105247_10664498
778 Ga0114129_10196368
779 Ga0105243_10066405
780 Ga0105243_10378803
781 Ga0105241_10011623
782 Ga0105241_10026653
783 Ga0105241_10160952
784 Ga0105241_10286118
785 Ga0105248_10514044
786 Ga0105237_10260496
787 Ga0105237_10395736
788 Ga0105249_10072125
789 Ga0105239_10028656
790 Ga0105239_10132924
791 Ga0105239_10554377
792 Ga0105246_10020383
793 Ga0157374_10015011
794 Ga0157378_10509911
795 Ga0163162_10140908
796 Ga0163162_10282085
797 Ga0163162_10727476
798 Ga0157375_10070304
799 Ga0157375_10104941
800 Ga0163163_10054061
801 Ga0163163_10253148
802 Ga0163163_10255063
803 Ga0163163_10290686
804 Ga0157380_10659476
805 Ga0157377_10149932
806 Ga0157377_10204831
807 Ga0157379_11028882
808 Ga0157376_10266502
809 Ga0163161_10206261
810 Ga0214544_1000136
811 Ga0214542_1000127
812 Ga0214545_1000063
813 Ga0214543_1025648
814 Ga0209233_1005987
815 Ga0209673_1041610
816 Ga0209564_1023481
817 Ga0209758_1000011
818 Ga0209758_1000455
819 Ga0209758_1002032
820 Ga0209758_1002609
821 Ga0209758_1003239
822 Ga0209758_1025408
823 Ga0209256_1009705
824 Ga0207426_1000505
825 Ga0207426_1000551
826 Ga0207426_1005180
827 Ga0207426_1010268
828 Ga0207426_1014745
829 Ga0209257_1003002
830 Ga0207692_10077716
831 Ga0207710_10051486
832 Ga0207688_10408045
833 Ga0207685_10143354
834 Ga0207699_10001548
835 Ga0207684_10563252
836 Ga0207654_10106004
837 Ga0207671_10020951
838 Ga0207671_10589408
839 Ga0207693_10148467
840 Ga0207663_10037957
841 Ga0207681_10481508
842 Ga0207694_10312874
843 Ga0207687_10082863
844 Ga0207687_10300007
845 Ga0207664_10194671
846 Ga0207644_10466192
847 Ga0207690_10158241
848 Ga0207706_10237194
849 Ga0207709_10258823
850 Ga0207670_10078401
851 Ga0207711_10216910
852 Ga0207689_10106626
853 Ga0207689_10133579
854 Ga0207689_10206577
855 Ga0207668_10169544
856 Ga0207668_10299061
857 Ga0207668_10613420
858 Ga0207658_10305391
859 Ga0207677_10013311
860 Ga0207703_10427855
861 Ga0207703_10562046
862 Ga0207703_10727781
863 Ga0207639_10100462
864 Ga0207639_10218476
865 Ga0207678_10036300
866 Ga0207678_10065576
867 Ga0207678_10066334
868 Ga0207678_10363476
869 Ga0207702_10789064
870 Ga0207676_10067440
871 Ga0207676_10124236
872 Ga0207676_10147493
873 Ga0207675_100387724
874 Ga0207675_100607104
875 Ga0207675_100653474
876 Ga0207683_10011017
877 Ga0207683_10725095
878 Ga0207698_10013899
879 Ga0207698_10071429
880 Ga0209389_1001313
881 Ga0209389_1001336
882 Ga0209589_1004535
883 Ga0209489_100050
884 Ga0209489_104795
885 Ga0209700_100016
886 Ga0209813_10019045
887 Ga0268266_10001826
888 Ga0268266_10010741
889 Ga0268266_10231254
890 Ga0268266_10610102
891 Ga0268265_10297935
892 Ga0268265_10555528
893 Ga0268264_10000162
894 Ga0268264_10198209
895 Ga0268264_10478565
896 Ga0265330_10015894
897 Ga0265330_10129102
898 Ga0265328_10036923
899 Ga0265328_10087978
900 Ga0265325_10064839
901 Ga0265340_10006556
902 Ga0265340_10031355
903 Ga0265339_10119793
904 Ga0265331_10088377
905 Ga0265331_10088995
906 Ga0265316_10128613
907 Ga0307513_10142108
908 Ga0307509_10004051
909 Ga0307509_10224352
910 Ga0307509_10321993
911 Ga0307408_100502497
912 Ga0307408_101030206
913 Ga0307508_10286442
914 Ga0265342_10074242
915 Ga0307516_10025850
916 Ga0307516_10027417
917 Ga0307516_10047338
918 Ga0307405_10158615
919 Ga0307410_10416615
920 Ga0307407_10309658
921 Ga0307409_100205001
922 Ga0307409_100758938
923 Ga0307507_10234252
924 Ga0307510_10105668
925 Ga0373926_0172918
926 Ga0373927_0024820
927 Ga0373925_0028470
928 Ga0373925_0787070
929 Ga0395900_0321407
930 Ga0395905_0029357
931 Ga0395905_0445141
932 Ga0395901_0272769
933 Ga0451797_1453042
934 Ga0451802_0948964
935 Ga0451804_0219794
936 Ga0466963_0004299
937 Ga0466971_0064947
938 Ga0466960_0020021
939 Ga0466960_0190061
940 Ga0466959_0327999
941 Ga0466967_0029412
942 Ga0495617_037694
943 Ga0495617_058128
944 Ga0495603_0008804
945 Ga0495590_0070013
946 Ga0495638_0067676
947 Ga0495638_0094277
948 Ga0495638_0115525
949 Ga0495638_0122204
950 Ga0495641_0083486
951 Ga0495651_0034644
952 Ga0495605_0036683
953 Ga0495605_0072485
954 Ga0495639_0152539
955 Ga0495664_0057169
956 Ga0495584_0081289
957 Ga0495594_0126156
958 Ga0495596_0137730
959 Ga0495583_0098609
960 Ga0495583_0108008
961 Ga0495583_0165827
962 Ga0495606_0010770
963 Ga0495606_0238799
964 Ga0495608_0086893
965 Ga0495610_0045065
966 Ga0495616_0209406
967 Ga0495628_0029319
968 Ga0495631_0068463
969 Ga0495643_0085527
970 Ga0495643_0170535
971 Ga0495644_0006055
972 Ga0495644_0156539
973 Ga0495648_0044751
974 Ga0495648_0082977
975 Ga0495648_0163773
976 Ga0495648_0229796
977 Ga0495663_0035120
978 Ga0495663_0132697
979 Ga0495652_0047190
980 Ga0495609_0035489
981 Ga0495609_0036103
982 Ga0495621_0009681
983 Ga0495645_0018228
984 Ga0495622_0049066
985 Ga0495622_0098408
986 Ga0495633_0065607
987 Ga0495633_0126429
988 Ga0495656_0007212
989 Ga0495656_0029782
990 Ga0495656_0075485
991 Ga0495668_0049194
992 Ga0495668_0059408
993 Ga0495668_0200163
994 Ga0495668_0215524
995 Ga0495634_0111392
996 Ga0495611_0166187
997 Ga0495625_0133014
998 Ga0495625_0363461
999 Ga0495625_0411583
1000 Ga0495635_0062110
1001 Ga0495659_0033833
1002 Ga0495661_0148736
1003 Ga0495661_0157265
1004 Ga0495588_0086134
1005 Ga0495588_0090547
1006 Ga0495588_0143410
1007 Ga0495588_0234664
1008 Ga0495657_0006212
1009 Ga0495599_0068011
1010 Ga0495623_0034607
1011 Ga0495646_0068544
1012 Ga0495669_0012501
1013 Ga0495670_0060188
1014 Ga0495670_0114185
1015 Ga0495670_0152742
1016 Ga0495671_0184713
1017 Ga0495649_0025699
1018 Ga0495589_0069060
1019 Ga0495589_0205565
1020 Ga0495600_0025275
1021 Ga0495604_0037299
1022 Ga0495636_0055997
1023 Ga0495674_0239048
1024 Ga0495676_0344486
1025 Ga0495680_0014952
1026 Ga0495683_0128971
1027 Ga0495675_0040656
1028 Ga0495677_0104012
1029 Ga0495677_0107208
1030 Ga0495679_091784
1031 Ga0495686_0080299
1032 Ga0495686_0327875
1033 Ga0496100_0098142
1034 Ga0496100_0218177
1035 Ga0496101_0092202
1036 Ga0496101_0621021
1037 Ga0496102_0001228
1038 Ga0496102_0167966
1039 Ga0496102_0537883
1040 Ga0496104_0053145
1041 Ga0496104_0064408
1042 Ga0496104_0086849
1043 Ga0496104_0585717
1044 Ga0496105_0043751
1045 Ga0496105_0512230
1046 Ga0496105_0512519
1047 Ga0496106_0000872
1048 Ga0496106_0011320
1049 Ga0496106_0034551
1050 Ga0496106_0230669
1051 Ga0496107_0050603
1052 Ga0496107_0071490
1053 Ga0496108_0112132
1054 Ga0496108_0205346
1055 Ga0496108_0463726
1056 Ga0496109_0410258
1057 Ga0496109_0514735
1058 Ga0496110_0330084
1059 Ga0496110_0357096
1060 Ga0496110_0489186
1061 Ga0496110_0493204
1062 Ga0496111_0059228
1063 Ga0496112_0191138
1064 Ga0496113_0077273
1065 Ga0496113_0296043
1066 Ga0496114_0009711
1067 Ga0496114_0292285
1068 Ga0496114_0383962
1069 Ga0496114_0447291
1070 Ga0496114_0677261
1071 Ga0496115_0004243
1072 Ga0496115_0031778
1073 Ga0496115_0705273
1074 Ga0496116_0046844
1075 Ga0496117_0010585
1076 Ga0496117_0017698
1077 Ga0496117_0108751
1078 Ga0496118_0007948
1079 Ga0496118_0167932
1080 Ga0496118_0213993
1081 Ga0496118_0241819
1082 Ga0496119_0073680
1083 Ga0496119_0148893
1084 Ga0496120_0064952
1085 Ga0496121_0000110
1086 Ga0496121_0008232
1087 Ga0496121_0045785
1088 Ga0496121_0090517
1089 Ga0496121_0091430
1090 Ga0496121_0094458
1091 Ga0496121_0106311
1092 Ga0496121_0183286
1093 Ga0496121_0206395
1094 Ga0496121_0240916
1095 Ga0496121_0315643
1096 Ga0496121_0325600
1097 Ga0496124_0007971
1098 Ga0496124_0268819
1099 Ga0496125_0000850
1100 Ga0496125_0030441
1101 Ga0496125_0119308
1102 Ga0496125_0201057
1103 Ga0496126_0009637
1104 Ga0496126_0015967
1105 Ga0496126_0049134
1106 Ga0496126_0076962
1107 Ga0496126_0129290
1108 Ga0496126_0212337
1109 Ga0496126_0224935
1110 Ga0496126_0226026
1111 Ga0496126_0310230
1112 Ga0496126_0314180
1113 Ga0496126_0415700
1114 Ga0495682_0017242
1115 nmdc:mga03683_123006_c1
1116 nmdc:mga03683_59814_c1
1117 nmdc:mga03n38_2963_c1
1118 nmdc:mga03n38_7461_c1
1119 nmdc:mga0yw44_139804_c1
1120 nmdc:mga0yw44_239319_c1
1121 nmdc:mga0yw44_37410_c1
1122 nmdc:mga06z11_11048_c1
1123 nmdc:mga04h51_83521_c1
1124 nmdc:mga07m45_233999_c1
1125 nmdc:mga07m45_256168_c1
1126 nmdc:mga05p37_75879_c1
1127 nmdc:mga09592_205866_c1
1128 nmdc:mga0sz30_131604_c1
1129 nmdc:mga0sz30_13469_c1
1130 nmdc:mga0sz30_21687_c1
1131 Ga0500635_0028908
1132 Ga0495619_0207038
1133 Ga0500643_000042
1134 Ga0500643_011960
1135 Ga0500647_0073401
1136 Ga0500647_0175352
1137 Ga0500583_0018820
1138 Ga0500583_0060494
1139 Ga0500566_0000264
1140 Ga0500566_0027838
1141 Ga0500566_0050799
1142 Ga0500566_0097311
1143 Ga0500641_0033313
1144 Ga0500641_0074886
1145 Ga0500650_0231965
1146 Ga0500554_015050
1147 Ga0500555_097529
1148 Ga0500557_000006
1149 Ga0500558_096543
1150 Ga0500562_003681
1151 Ga0500572_142693
1152 Ga0500595_001887
1153 Ga0500595_007717
1154 Ga0500595_007915
1155 Ga0500614_063896
1156 Ga0500617_045320
1157 Ga0500642_0000686
1158 Ga0500642_0024530
1159 Ga0500559_0070215
1160 Ga0500559_0080445
1161 Ga0500568_0110345
1162 Ga0500568_0157825
1163 Ga0500577_0093064
1164 Ga0500589_100539
1165 Ga0500603_026591
1166 Ga0500604_0031192
1167 Ga0500616_0061752
1168 Ga0500622_0086649
1169 Ga0500638_000372
1170 Ga0500638_077492
1171 Ga0500638_134387
1172 Ga0500639_015076
1173 Ga0500636_0005482
1174 Ga0500636_0005968
1175 Ga0500636_0084316
1176 Ga0500636_0174659
1177 Ga0500637_0000753
1178 Ga0500637_0033606
1179 Ga0500570_077214
1180 Ga0500611_006460
1181 Ga0500625_000351
1182 Ga0500645_007279
1183 Ga0500609_006454
1184 Ga0500552_015446
1185 Ga0500596_004073
1186 Ga0500599_000308
1187 Ga0500601_000355
1188 Ga0500661_001131
1189 2511397699
1190 2513627123
1191 2513637232
1192 2513651624
1193 2513876786
1194 2514012176
1195 2517107377
1196 2524439540
1197 2528851005
1198 2617348031
1199 2617377736
1200 2745081813
1201 2793065985
1202 2805918766
1203 2818243235
1204 2824605481
1205 2824614819
1206 2824658070
1207 2824667913
1208 2824673926
1209 2824681676
1210 2824690626
1211 2824698147
1212 2824707488
1213 2824736965
1214 2824746422
1215 2824759251
1216 2824769559
1217 2824776142
1218 2842045023
1219 2842052791
1220 2844320536
1221 2847938079
1222 2847939994
1223 2849077806
1224 2857510982
1225 2874616781
1226 2874625862
1227 2876769113
1228 2879084374
1229 2879100223
1230 2881367790
1231 2881672257
1232 2885368473
1233 2885410058
1234 2888386028
1235 2888426144
1236 2903732827
1237 2904673777
1238 2904717596
1239 2906605626
1240 2906628004
1241 2906644075
1242 2908782218
1243 2922376356
1244 2922399926
1245 2929624012
1246 2929633153
1247 2932792678
1248 2932797855
1249 2932806391
1250 2932815232
1251 2932824489
1252 2932832111
1253 2933585913
1254 2935622050
1255 2935643940
1256 2935669145
1257 2935683297
1258 2935692238
1259 2935700591
1260 2935708780
1261 2935720524
1262 2935729805
1263 2935739213
1264 2935748246
1265 2935758449
1266 2935766124
1267 2935771003
1268 2935781170
1269 2935786296
1270 2935793907
1271 2935805861
1272 2935815580
1273 2935833192
1274 2935843238
1275 2935860297
1276 2935867694
1277 2935878496
1278 2935888398
1279 2935998620
1280 2936006927
1281 2936040818
1282 2940564353
1283 2941531734
1284 2941544784
1285 3005488403
1286 3005511515
1287 3005594393
1288 3005716322
1289 8006934527
1290 8006974497
1291 8006988504
1292 8016520055
1293 8016527972
1294 8016533095
1295 8016555797
1296 8016564146
1297 8016571410
1298 8016575669
1299 8016595044
1300 8016601849
1301 8016616466
1302 8016624672
1303 8017065499
1304 8019532894
1305 8019546958
1306 8019551711
1307 8019584902
1308 8019592854
1309 8019598603
1310 8019609773
1311 8055744516
1312 8056970442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

43

219

0.9

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

46

225

0.88

PF12710

HAD

haloacid dehalogenase-like hydrolase

46

210

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w04-assembly1.cif.gz_A crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss 0.8682 11 220
4uas-assembly2.cif.gz_B crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate 0.859 12 213
2go7-assembly3.cif.gz_C crystal structure of a hydrolase from haloacid dehalogenase-like family (sp_2064) from streptococcus pneumoniae tigr4 at 2.10 a resolution 0.8529 12 189
7ocn-assembly1.cif.gz_A crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8511 12 213
7ocr-assembly1.cif.gz_A nadph and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8486 12 213
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.93 94 190 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9026 86 213 3.40.50.1000
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9015 94 207 3.40.50.1000
1z4nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8996 110 190 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8978 92 220 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0F5FPU0-F1-model_v4 Haloacid dehalogenase 0.9762 10 222 GO:0003824
AF-U5QSH6-F1-model_v4 HAD-superfamily hydrolase 0.9752 11 226 GO:0016787
AF-A0A2G5E3Q0-F1-model_v4 Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp 0.9736 77 222 GO:0003824
AF-A0A7I8JVJ9-F1-model_v4 Uncharacterized protein 0.9711 11 206 GO:0003824
AF-A0A370X5B0-F1-model_v4 HAD family hydrolase 0.9685 12 224 GO:0016787

Map