F473004

General Info

Members Datasets Scaffolds Average Seq Length
656 378 472 323

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10013798|Ga0075365_100137985
Length 354
Sequence MSATTTPVEPAGIDTPVLAVDELRVHFPVGRSLGVRRGLVKAVDGVSFAVHRGETLGVVGESGCGKSTVGMAVQGLVPVTSGRITVAGRDVSRARGRSRQAARRQTQMIFQDPTSSLNARMTVGELLEEPLVVHQLVRPAQRRARVLELLDQVHLPREAADRYPHEFSGGQRQRVSIARALAVDPELIVCDEPIASLDLSVRAQILNLLKELQRETQLALLFISHDLAAVSHVSDRVLVMYLGKAMELTTRERVYDEPVHPYTRALLSAVPVPDXDVERSRQRIILRGEVPSPLEPPSGCVFRTRCPVALPVCAEEIPAWTEVAAVGHHDVACHRSEELVTDLSGQLADDLAPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
7 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
8 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
11 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
12 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
13 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
14 2547132181 Kosakonia sacchari SP1 Isolate Stem
15 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
16 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
17 2561511199 Enterobacter sp. R4-368 Isolate Nodule
18 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
19 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
20 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
21 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
22 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
23 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
24 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
25 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
26 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
27 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
28 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
29 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
30 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
31 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
32 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
33 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
34 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
35 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
36 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
37 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
38 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
39 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
40 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
41 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
42 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
43 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
44 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
45 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
46 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
47 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
48 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
49 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
50 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
51 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
52 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
53 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
54 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
55 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
56 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
57 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
58 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
59 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
60 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
61 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
62 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
63 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
64 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
65 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
66 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
67 2636415599 Klebsiella variicola DX120E Isolate Unclassified
68 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
69 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
70 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
71 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
72 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
73 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
74 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
75 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
76 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
77 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
78 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
79 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
80 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
81 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
82 2751185917 Enterobacter sp. HK169 Isolate Unclassified
83 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
84 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
85 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
86 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
87 2775507074 Klebsiella sp. D5A Isolate Unclassified
88 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
89 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
90 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
91 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
92 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
93 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
94 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
95 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
96 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
97 2821118458 Enterobacter asburiae 609 Isolate Unclassified
98 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
99 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
100 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
101 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
102 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
103 2847085930 Erwinia persicina B64 Isolate Bulb
104 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
105 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
106 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
107 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
108 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
109 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
110 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
111 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
112 2865014394 Pantoea sp. R-71966 Isolate Unclassified
113 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
114 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
115 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
116 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
117 2876601092 Pantoea endophytica 596 Isolate Unclassified
118 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
119 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
120 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
121 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
122 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
123 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
124 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
125 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
126 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
127 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
128 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
129 2904504865 Serratia marcescens 1822 Isolate Unclassified
130 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
131 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
132 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
133 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
134 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
135 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
136 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
137 2919150387 Rahnella aceris 1817 Isolate Unclassified
138 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
139 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
140 2927143783 Rahnella sp. 2050 Isolate Unclassified
141 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
142 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
143 2932406140 Serratia sp. 2723 Isolate Rhizosphere
144 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
145 2937539931 Pantoea sp. LS15 Isolate Unclassified
146 2937967321 Serratia sp. YC16 Isolate Unclassified
147 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
148 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
149 2939577877 Serratia sp. 509 Isolate Rhizosphere
150 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
151 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
152 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
153 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
154 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
155 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
156 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
157 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
158 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
159 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
160 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
161 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
162 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
163 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
164 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
165 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
166 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
167 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
168 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
169 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
170 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
171 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
172 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
173 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
174 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
175 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
176 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
177 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
178 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
179 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
180 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
181 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
182 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
183 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
184 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
185 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
186 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
187 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
188 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
189 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
190 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
191 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
192 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
193 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
194 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
195 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
198 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
199 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
200 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
203 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
204 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
205 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
206 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
207 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
208 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
209 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
210 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
211 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
212 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
213 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
214 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
215 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
216 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
217 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
218 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
219 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
220 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
221 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
222 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
223 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
224 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
225 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
226 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
227 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
228 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
229 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
230 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
231 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
232 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
233 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
234 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
235 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
236 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
237 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
238 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
239 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
240 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
246 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
247 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
248 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
250 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
267 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
270 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
271 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
272 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
286 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
287 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
313 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
314 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
362 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
363 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
364 640753048 Serratia proteamaculans 568 Isolate Endosphere
365 8004592986 Serratia sp. S119 Isolate Unclassified
366 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
367 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
368 8018221730 Enterobacter sp. CM29 Isolate Unclassified
369 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
370 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
371 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
372 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
373 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
374 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
375 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
376 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
377 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
378 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.8
Metatranscriptomes 0.15
Isolates 28.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.91
Bulb 0.15
Endosphere 5.79
Nodule 4.88
Rhizoplane 10.52
Rhizosphere 52.59
Stem 0.15
Stem Tuber 0.91
Unclassified 24.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1329442 2162886007 Bacteria 2062
2 SwRhRL2b_contig_2505277 2162886007 Bacteria 1078
3 SwRhRL2b_contig_3210718 2162886007 Bacteria 1632
4 SwRhRL2b_contig_719382 2162886007 Bacteria 5529
5 SwRhRL2b_contig_975791 2162886007 Bacteria 1405
6 JGI24739J22299_10013662 3300001989 Bacteria 2961
7 JGI25162J39368_1000033 3300002737 Bacteria 194080
8 JGI25162J39368_1001594 3300002737 Bacteria 11430
9 JGI25163J39215_1000256 3300002771 Bacteria 19320
10 JGI25164J39214_1000017 3300002772 Bacteria 200566
11 JGI25152J39213_1004163 3300002773 Bacteria 4666
12 rootH2_10009975 3300003320 Bacteria 24076
13 Ga0006562J51391_1020104 3300003578 Bacteria 1219
14 Ga0055538_1000035 3300003751 Bacteria 194080
15 Ga0055539_1000046 3300003752 Bacteria 194080
16 Ga0055533_1000056 3300003756 Bacteria 194080
17 Ga0055532_1000568 3300003758 Bacteria 15486
18 Ga0055525_1000067 3300003759 Bacteria 194080
19 Ga0055541_1000033 3300003841 Bacteria 194080
20 Ga0058692_1000084 3300003856 Bacteria 65638
21 Ga0058692_1000160 3300003856 Bacteria 42011
22 Ga0058692_1000259 3300003856 Bacteria 28696
23 Ga0058692_1001411 3300003856 Bacteria 8865
24 Ga0058692_1002965 3300003856 Bacteria 5451
25 Ga0058692_1004470 3300003856 Bacteria 4138
26 Ga0058692_1027553 3300003856 Bacteria 1105
27 Ga0058692_1028170 3300003856 Bacteria 1086
28 Ga0065704_10000015 3300005289 Bacteria 105766
29 Ga0065704_10000267 3300005289 Bacteria 81463
30 Ga0065704_10009186 3300005289 Bacteria 4187
31 Ga0065704_10080131 3300005289 Bacteria 4003
32 Ga0070680_100054139 3300005336 Bacteria 3275
33 Ga0070682_100011416 3300005337 Bacteria 5075
34 Ga0070660_100199242 3300005339 Bacteria 1624
35 Ga0070675_100346263 3300005354 Bacteria 1317
36 Ga0070674_100251249 3300005356 Bacteria 1389
37 Ga0070688_100009373 3300005365 Bacteria 5350
38 Ga0070659_100176199 3300005366 Bacteria 1753
39 Ga0070701_10016698 3300005438 Bacteria 3418
40 Ga0070663_100166673 3300005455 Bacteria 1700
41 Ga0070685_10027947 3300005466 Bacteria 3122
42 Ga0070686_100024965 3300005544 Bacteria 3588
43 Ga0070665_100000488 3300005548 Bacteria 57081
44 Ga0070704_100188964 3300005549 Bacteria 1654
45 Ga0068855_100356199 3300005563 Bacteria 1611
46 Ga0068857_100029881 3300005577 Bacteria 4809
47 Ga0068857_100147718 3300005577 Bacteria 2127
48 Ga0068854_100253718 3300005578 Bacteria 1406
49 Ga0068856_100078545 3300005614 Bacteria 3272
50 Ga0068858_100344607 3300005842 Bacteria 1426
51 Ga0081539_10050898 3300005985 Bacteria 2340
52 Ga0070717_10000121 3300006028 Bacteria 60014
53 Ga0075365_10013798 3300006038 Bacteria 4847
54 Ga0075364_10001295 3300006051 Bacteria 13480
55 Ga0075364_10006021 3300006051 Bacteria 7093
56 Ga0075364_10059679 3300006051 Bacteria 2501
57 Ga0075362_10021470 3300006177 Bacteria 2710
58 Ga0075366_10008304 3300006195 Bacteria 5768
59 Ga0075433_10036543 3300006852 Bacteria 4232
60 Ga0079104_1000021 3300006946 Bacteria 247219
61 Ga0079104_1000442 3300006946 Bacteria 47153
62 Ga0079104_1000479 3300006946 Bacteria 44459
63 Ga0079104_1000498 3300006946 Bacteria 42552
64 Ga0079104_1000842 3300006946 Bacteria 25518
65 Ga0079104_1001570 3300006946 Bacteria 14951
66 Ga0079104_1002325 3300006946 Bacteria 10442
67 Ga0079104_1004838 3300006946 Bacteria 5593
68 Ga0079104_1005228 3300006946 Bacteria 5242
69 Ga0105251_10001166 3300009011 Bacteria 22806
70 Ga0105251_10001628 3300009011 Bacteria 19028
71 Ga0105251_10002534 3300009011 Bacteria 14233
72 Ga0105251_10003656 3300009011 Bacteria 11030
73 Ga0105251_10007398 3300009011 Bacteria 6771
74 Ga0105251_10014438 3300009011 Bacteria 4365
75 Ga0105251_10014864 3300009011 Bacteria 4279
76 Ga0105251_10019132 3300009011 Bacteria 3624
77 Ga0105244_10000055 3300009036 Bacteria 130164
78 Ga0105244_10000070 3300009036 Bacteria 119389
79 Ga0105244_10001200 3300009036 Bacteria 21311
80 Ga0105244_10002301 3300009036 Bacteria 14506
81 Ga0105244_10002316 3300009036 Bacteria 14476
82 Ga0105244_10003053 3300009036 Bacteria 12272
83 Ga0105244_10003902 3300009036 Bacteria 10483
84 Ga0105244_10038305 3300009036 Bacteria 2501
85 Ga0105244_10039349 3300009036 Bacteria 2461
86 Ga0105244_10056197 3300009036 Bacteria 1993
87 Ga0105244_10113710 3300009036 Bacteria 1315
88 Ga0105250_10000001 3300009092 Bacteria 617357
89 Ga0105250_10000060 3300009092 Bacteria 106781
90 Ga0105250_10000469 3300009092 Bacteria 28768
91 Ga0105250_10000508 3300009092 Bacteria 27277
92 Ga0105250_10003283 3300009092 Bacteria 7698
93 Ga0105250_10004668 3300009092 Bacteria 6264
94 Ga0105250_10008034 3300009092 Bacteria 4502
95 Ga0105250_10026113 3300009092 Bacteria 2352
96 Ga0105250_10035696 3300009092 Bacteria 1995
97 Ga0105250_10046001 3300009092 Bacteria 1750
98 Ga0111539_10154042 3300009094 Bacteria 2690
99 Ga0105245_10039243 3300009098 Bacteria 4215
100 Ga0105243_10190537 3300009148 Bacteria 1791
101 Ga0105243_10194613 3300009148 Bacteria 1774
102 Ga0105242_10028387 3300009176 Bacteria 4454
103 Ga0105238_10030987 3300009551 Bacteria 5444
104 Ga0105246_10027675 3300011119 Bacteria 3718
105 Ga0105246_10080333 3300011119 Bacteria 2321
106 Ga0157373_10000307 3300013100 Bacteria 39624
107 Ga0157373_10010056 3300013100 Bacteria 6971
108 Ga0157373_10052724 3300013100 Bacteria 2893
109 Ga0157373_10123584 3300013100 Bacteria 1820
110 Ga0157371_10000061 3300013102 Bacteria 170142
111 Ga0157371_10000881 3300013102 Bacteria 33819
112 Ga0157371_10003074 3300013102 Bacteria 15480
113 Ga0157371_10017240 3300013102 Bacteria 5370
114 Ga0157371_10040078 3300013102 Bacteria 3347
115 Ga0157371_10083060 3300013102 Bacteria 2268
116 Ga0157370_10003179 3300013104 Bacteria 19423
117 Ga0157370_10005455 3300013104 Bacteria 14264
118 Ga0157370_10010663 3300013104 Bacteria 9670
119 Ga0157369_10003775 3300013105 Bacteria 18006
120 Ga0157378_10435830 3300013297 Bacteria 1298
121 Ga0163162_10004513 3300013306 Bacteria 13405
122 Ga0157372_10007036 3300013307 Bacteria 11984
123 Ga0157372_10012878 3300013307 Bacteria 8916
124 Ga0157372_10021707 3300013307 Bacteria 6940
125 Ga0157372_10023529 3300013307 Bacteria 6679
126 Ga0157372_10025193 3300013307 Bacteria 6465
127 Ga0157372_10030813 3300013307 Bacteria 5869
128 Ga0157372_10030975 3300013307 Bacteria 5855
129 Ga0157372_10082646 3300013307 Bacteria 3637
130 Ga0163163_10008657 3300014325 Bacteria 9049
131 Ga0157380_10197200 3300014326 Bacteria 1783
132 Ga0157377_10064559 3300014745 Bacteria 2100
133 Ga0157377_10102869 3300014745 Bacteria 1705
134 Ga0157379_10064175 3300014968 Bacteria 3282
135 Ga0182006_1000051 3300015261 Bacteria 183089
136 Ga0182006_1012678 3300015261 Bacteria 3682
137 Ga0182007_10019007 3300015262 Bacteria 2477
138 Ga0183366_1001 3300015679 Bacteria 2743932
139 Ga0183370_1001 3300015680 Bacteria 2743932
140 Ga0183369_1001 3300015685 Bacteria 2743932
141 Ga0183368_1001 3300015687 Bacteria 2743932
142 Ga0213874_10037222 3300021377 Bacteria 1438
143 Ga0213876_10000069 3300021384 Bacteria 125594
144 Ga0209760_100073 3300025207 Bacteria 81377
145 Ga0209784_100001 3300025224 Bacteria 3600592
146 Ga0209566_100001 3300025225 Bacteria 3600765
147 Ga0209674_100002 3300025226 Bacteria 3600592
148 Ga0209147_100276 3300025229 Bacteria 45046
149 Ga0209563_100002 3300025230 Bacteria 2045675
150 Ga0207427_100032 3300025231 Bacteria 349939
151 Ga0209437_100001 3300025233 Bacteria 2045675
152 Ga0209437_100073 3300025233 Bacteria 302948
153 Ga0207425_1023644 3300025245 Bacteria 1284
154 Ga0209677_100002 3300025253 Bacteria 2045675
155 Ga0209129_1000004 3300025258 Bacteria 884499
156 Ga0207696_1000028 3300025711 Bacteria 400424
157 Ga0207696_1000030 3300025711 Bacteria 395961
158 Ga0207696_1000190 3300025711 Bacteria 95127
159 Ga0207696_1000280 3300025711 Bacteria 60106
160 Ga0207696_1000814 3300025711 Bacteria 20084
161 Ga0207696_1000937 3300025711 Bacteria 17889
162 Ga0207696_1005769 3300025711 Bacteria 5088
163 Ga0207655_1000001 3300025728 Bacteria 1866413
164 Ga0207655_1000002 3300025728 Bacteria 1148694
165 Ga0207655_1000004 3300025728 Bacteria 1021221
166 Ga0207655_1000007 3300025728 Bacteria 773492
167 Ga0207655_1000168 3300025728 Bacteria 119343
168 Ga0207655_1000343 3300025728 Bacteria 67627
169 Ga0207655_1002954 3300025728 Bacteria 13065
170 Ga0207655_1004094 3300025728 Bacteria 10491
171 Ga0207655_1004282 3300025728 Bacteria 10207
172 Ga0207655_1009359 3300025728 Bacteria 6092
173 Ga0207655_1032737 3300025728 Bacteria 2370
174 Ga0207655_1038367 3300025728 Bacteria 2094
175 Ga0207655_1042398 3300025728 Bacteria 1938
176 Ga0207655_1074718 3300025728 Bacteria 1246
177 Ga0207713_1000001 3300025735 Bacteria 2295391
178 Ga0207713_1000004 3300025735 Bacteria 702781
179 Ga0207713_1000015 3300025735 Bacteria 424741
180 Ga0207713_1000027 3300025735 Bacteria 312621
181 Ga0207713_1003426 3300025735 Bacteria 10826
182 Ga0207713_1004761 3300025735 Bacteria 8720
183 Ga0207713_1010662 3300025735 Bacteria 5065
184 Ga0207713_1018499 3300025735 Bacteria 3448
185 Ga0207713_1035370 3300025735 Bacteria 2157
186 Ga0207660_10029347 3300025917 Bacteria 3772
187 Ga0207657_10189984 3300025919 Bacteria 1657
188 Ga0207687_10082138 3300025927 Bacteria 2331
189 Ga0207709_10179128 3300025935 Bacteria 1495
190 Ga0207661_10032590 3300025944 Bacteria 4037
191 Ga0207661_10038175 3300025944 Bacteria 3762
192 Ga0207640_10022719 3300025981 Bacteria 3759
193 Ga0207658_10103754 3300025986 Bacteria 2233
194 Ga0207677_10059488 3300026023 Bacteria 2635
195 Ga0207703_10188930 3300026035 Bacteria 1823
196 Ga0207708_10002444 3300026075 Bacteria 13660
197 Ga0207648_10012653 3300026089 Bacteria 7888
198 Ga0207674_10003641 3300026116 Bacteria 18796
199 Ga0207698_10381332 3300026142 Bacteria 1341
200 Ga0209281_1000001 3300027111 Bacteria 1933496
201 Ga0209281_1000004 3300027111 Bacteria 1253949
202 Ga0209281_1000006 3300027111 Bacteria 1170244
203 Ga0209281_1000012 3300027111 Bacteria 684886
204 Ga0209281_1000124 3300027111 Bacteria 202831
205 Ga0209281_1000680 3300027111 Bacteria 35553
206 Ga0209281_1000985 3300027111 Bacteria 22705
207 Ga0209281_1001187 3300027111 Bacteria 17882
208 Ga0209281_1002091 3300027111 Bacteria 8910
209 Ga0209281_1004440 3300027111 Bacteria 4199
210 Ga0209371_1000001 3300027312 Bacteria 2771503
211 Ga0209371_1000002 3300027312 Bacteria 1551985
212 Ga0209371_1000005 3300027312 Bacteria 1061740
213 Ga0209371_1000039 3300027312 Bacteria 350081
214 Ga0209371_1000060 3300027312 Bacteria 235042
215 Ga0209371_1000110 3300027312 Bacteria 141059
216 Ga0209371_1000157 3300027312 Bacteria 106573
217 Ga0209371_1000455 3300027312 Bacteria 40435
218 Ga0209371_1001219 3300027312 Bacteria 18550
219 Ga0209371_1001573 3300027312 Bacteria 14966
220 Ga0209371_1002540 3300027312 Bacteria 10099
221 Ga0209371_1002626 3300027312 Bacteria 9834
222 Ga0209371_1003116 3300027312 Bacteria 8451
223 Ga0209371_1006345 3300027312 Bacteria 4401
224 Ga0209371_1009760 3300027312 Bacteria 3022
225 Ga0209371_1011714 3300027312 Bacteria 2583
226 Ga0268266_10000629 3300028379 Bacteria 47968
227 Ga0265323_10007031 3300028653 Bacteria 4701
228 Ga0265323_10007320 3300028653 Bacteria 4595
229 Ga0268256_1000001 3300030500 Bacteria 2771065
230 Ga0268256_1000002 3300030500 Bacteria 1535763
231 Ga0268256_1000006 3300030500 Bacteria 1063991
232 Ga0268256_1000033 3300030500 Bacteria 420973
233 Ga0268256_1000084 3300030500 Bacteria 164658
234 Ga0268256_1000280 3300030500 Bacteria 52883
235 Ga0268256_1000515 3300030500 Bacteria 32474
236 Ga0268256_1000745 3300030500 Bacteria 23896
237 Ga0268256_1001352 3300030500 Bacteria 14966
238 Ga0268256_1001470 3300030500 Bacteria 14051
239 Ga0268256_1001685 3300030500 Bacteria 12610
240 Ga0268256_1002802 3300030500 Bacteria 8451
241 Ga0268256_1004178 3300030500 Bacteria 6109
242 Ga0268256_1010382 3300030500 Bacteria 3022
243 Ga0268256_1012739 3300030500 Bacteria 2583
244 Ga0265320_10022488 3300031240 Bacteria 3371
245 Ga0265320_10023076 3300031240 Bacteria 3318
246 Ga0265316_10008003 3300031344 Bacteria 9871
247 Ga0265316_10102219 3300031344 Bacteria 2177
248 Ga0307513_10000021 3300031456 Bacteria 228078
249 Ga0265314_10046453 3300031711 Bacteria 3063
250 Ga0307405_10141213 3300031731 Bacteria 1680
251 Ga0307414_10002591 3300032004 Bacteria 9512
252 Ga0373924_0120994 3300035410 Bacteria 1136
253 Ga0436365_0368505 3300039437 Bacteria 454216
254 Ga0436360_0412811 3300039438 Bacteria 2976
255 Ga0436363_0942232 3300039450 Bacteria 8075
256 Ga0439438_000001 3300041405 Bacteria 1263568
257 Ga0439438_006075 3300041405 Bacteria 4328
258 Ga0439438_010041 3300041405 Bacteria 3025
259 Ga0439466_0000191 3300041411 Bacteria 24528
260 Ga0451853_1907721 3300041512 Bacteria 1715
261 Ga0439432_017052 3300042006 Bacteria 2439
262 Ga0439452_000001 3300042010 Bacteria 1725439
263 Ga0439452_000002 3300042010 Bacteria 1377577
264 Ga0439452_000016 3300042010 Bacteria 338131
265 Ga0439452_000025 3300042010 Bacteria 228862
266 Ga0439452_003218 3300042010 Bacteria 5774
267 Ga0450900_008958 3300042136 Bacteria 1261
268 Ga0450907_004044 3300042146 Bacteria 2548
269 Ga0439464_0001027 3300042439 Bacteria 6373
270 Ga0451577_0000024 3300042876 Bacteria 411758
271 Ga0451577_0107203 3300042876 Bacteria 2497
272 Ga0466981_0000007 3300044669 Bacteria 155983
273 Ga0453683_0001980 3300044673 Bacteria 16587
274 Ga0453684_0005807 3300044712 Bacteria 24052
275 Ga0453684_0565458 3300044712 Bacteria 1251
276 Ga0451576_0029691 3300045051 Bacteria 5849
277 Ga0451576_0058083 3300045051 Bacteria 4043
278 Ga0495591_000007 3300046458 Bacteria 366385
279 Ga0495591_000284 3300046458 Bacteria 47332
280 Ga0495591_000738 3300046458 Bacteria 23626
281 Ga0495591_004448 3300046458 Bacteria 6870
282 Ga0495591_022859 3300046458 Bacteria 2014
283 Ga0495638_0001088 3300046460 Bacteria 26461
284 Ga0495650_0000005 3300046471 Bacteria 766553
285 Ga0495650_0000026 3300046471 Bacteria 476029
286 Ga0495650_0000126 3300046471 Bacteria 178143
287 Ga0495607_0014054 3300046501 Bacteria 5226
288 Ga0495606_0002025 3300046507 Bacteria 24869
289 Ga0495620_0002941 3300046515 Bacteria 9796
290 Ga0495631_0069574 3300046518 Bacteria 1522
291 Ga0495644_0006309 3300046523 Bacteria 4607
292 Ga0495648_0007335 3300046524 Bacteria 8836
293 Ga0495648_0013543 3300046524 Bacteria 6019
294 Ga0495654_0000007 3300046530 Bacteria 403529
295 Ga0495654_0000136 3300046530 Bacteria 76653
296 Ga0495597_0001674 3300046542 Bacteria 15404
297 Ga0495625_0024926 3300046660 Bacteria 4543
298 Ga0495588_0008354 3300046674 Bacteria 4749
299 Ga0495671_0005318 3300046692 Bacteria 7556
300 Ga0495649_0001831 3300046694 Bacteria 15606
301 Ga0495649_0018237 3300046694 Bacteria 3952
302 Ga0495660_0000016 3300046810 Bacteria 321859
303 Ga0495660_0000075 3300046810 Bacteria 106495
304 Ga0495660_0024883 3300046810 Bacteria 3405
305 Ga0495672_0000001 3300047320 Bacteria 1458820
306 Ga0495672_0000015 3300047320 Bacteria 502855
307 Ga0495672_0000020 3300047320 Bacteria 432845
308 Ga0495683_0039455 3300047323 Bacteria 2386
309 Ga0495679_000018 3300047446 Bacteria 239433
310 Ga0495679_003930 3300047446 Bacteria 7016
311 Ga0495679_009489 3300047446 Bacteria 3892
312 Ga0495673_0000007 3300047469 Bacteria 796722
313 Ga0495673_0000247 3300047469 Bacteria 75782
314 Ga0495681_0028187 3300047470 Bacteria 2893
315 Ga0495686_0001593 3300047472 Bacteria 23963
316 Ga0496101_0000058 3300048904 Bacteria 131047
317 Ga0496102_0001157 3300048905 Bacteria 24094
318 Ga0496102_0099202 3300048905 Bacteria 2703
319 Ga0496104_0000324 3300048907 Bacteria 42437
320 Ga0496104_0010773 3300048907 Bacteria 8179
321 Ga0496105_0002596 3300048908 Bacteria 13141
322 Ga0496105_0134948 3300048908 Bacteria 2033
323 Ga0496107_0046913 3300048910 Bacteria 3110
324 Ga0496108_0015163 3300048911 Bacteria 6287
325 Ga0496108_0146480 3300048911 Bacteria 2036
326 Ga0496109_0448961 3300048912 Bacteria 1218
327 Ga0496113_0116585 3300048916 Bacteria 2084
328 Ga0496114_0034941 3300048917 Bacteria 4150
329 Ga0496116_0000048 3300048919 Bacteria 314562
330 Ga0496116_0000086 3300048919 Bacteria 217597
331 Ga0496116_0000087 3300048919 Bacteria 217284
332 Ga0496116_0000347 3300048919 Bacteria 73563
333 Ga0496116_0018501 3300048919 Bacteria 5368
334 Ga0496116_0025184 3300048919 Bacteria 4378
335 Ga0496116_0062835 3300048919 Bacteria 2395
336 Ga0496116_0090729 3300048919 Bacteria 1859
337 Ga0496116_0187871 3300048919 Bacteria 1097
338 Ga0496117_0000022 3300048920 Bacteria 439512
339 Ga0496117_0000058 3300048920 Bacteria 264132
340 Ga0496117_0001102 3300048920 Bacteria 40740
341 Ga0496117_0001297 3300048920 Bacteria 36808
342 Ga0496117_0002520 3300048920 Bacteria 22944
343 Ga0496117_0002891 3300048920 Bacteria 20813
344 Ga0496117_0004084 3300048920 Bacteria 16379
345 Ga0496117_0007937 3300048920 Bacteria 10199
346 Ga0496117_0151950 3300048920 Bacteria 1369
347 Ga0496118_0000007 3300048921 Bacteria 650986
348 Ga0496118_0000328 3300048921 Bacteria 81811
349 Ga0496118_0000476 3300048921 Bacteria 66457
350 Ga0496118_0002356 3300048921 Bacteria 25604
351 Ga0496118_0002853 3300048921 Bacteria 22556
352 Ga0496118_0003275 3300048921 Bacteria 20619
353 Ga0496118_0005005 3300048921 Bacteria 15309
354 Ga0496118_0009237 3300048921 Bacteria 10008
355 Ga0496118_0031410 3300048921 Bacteria 4402
356 Ga0496118_0038423 3300048921 Bacteria 3836
357 Ga0496119_0000001 3300048922 Bacteria 789520
358 Ga0496119_0000018 3300048922 Bacteria 306476
359 Ga0496119_0000089 3300048922 Bacteria 134344
360 Ga0496119_0000395 3300048922 Bacteria 59960
361 Ga0496119_0002456 3300048922 Bacteria 20349
362 Ga0496119_0012581 3300048922 Bacteria 6856
363 Ga0496119_0013747 3300048922 Bacteria 6410
364 Ga0496119_0014488 3300048922 Bacteria 6164
365 Ga0496119_0023927 3300048922 Bacteria 4313
366 Ga0496119_0043495 3300048922 Bacteria 2836
367 Ga0496120_0000002 3300048923 Bacteria 547999
368 Ga0496120_0000091 3300048923 Bacteria 149829
369 Ga0496120_0000117 3300048923 Bacteria 134343
370 Ga0496120_0000601 3300048923 Bacteria 54492
371 Ga0496120_0000957 3300048923 Bacteria 39360
372 Ga0496120_0001234 3300048923 Bacteria 32345
373 Ga0496120_0004578 3300048923 Bacteria 11518
374 Ga0496120_0007207 3300048923 Bacteria 8322
375 Ga0496120_0009019 3300048923 Bacteria 7129
376 Ga0496121_0000103 3300048924 Bacteria 194818
377 Ga0496121_0000966 3300048924 Bacteria 51632
378 Ga0496121_0000968 3300048924 Bacteria 51540
379 Ga0496121_0004326 3300048924 Bacteria 19223
380 Ga0496121_0008064 3300048924 Bacteria 12548
381 Ga0496121_0018960 3300048924 Bacteria 6903
382 Ga0496121_0021394 3300048924 Bacteria 6337
383 Ga0496121_0031393 3300048924 Bacteria 4853
384 Ga0496122_0000005 3300048925 Bacteria 630659
385 Ga0496122_0000086 3300048925 Bacteria 207993
386 Ga0496122_0001791 3300048925 Bacteria 32883
387 Ga0496122_0002471 3300048925 Bacteria 26132
388 Ga0496122_0003065 3300048925 Bacteria 22535
389 Ga0496122_0006159 3300048925 Bacteria 13948
390 Ga0496122_0011631 3300048925 Bacteria 8878
391 Ga0496122_0025116 3300048925 Bacteria 5189
392 Ga0496122_0029043 3300048925 Bacteria 4675
393 Ga0496122_0119269 3300048925 Bacteria 1706
394 Ga0496122_0141436 3300048925 Bacteria 1504
395 Ga0496123_0000008 3300048926 Bacteria 630628
396 Ga0496123_0000014 3300048926 Bacteria 433465
397 Ga0496123_0000021 3300048926 Bacteria 378760
398 Ga0496123_0001457 3300048926 Bacteria 32945
399 Ga0496123_0001460 3300048926 Bacteria 32883
400 Ga0496123_0003023 3300048926 Bacteria 19393
401 Ga0496123_0003139 3300048926 Bacteria 18951
402 Ga0496123_0004474 3300048926 Bacteria 14659
403 Ga0496123_0015460 3300048926 Bacteria 6258
404 Ga0496123_0023569 3300048926 Bacteria 4707
405 Ga0496123_0041280 3300048926 Bacteria 3201
406 Ga0496124_0000059 3300048927 Bacteria 241949
407 Ga0496124_0000092 3300048927 Bacteria 189213
408 Ga0496124_0000208 3300048927 Bacteria 115312
409 Ga0496124_0001437 3300048927 Bacteria 35236
410 Ga0496124_0002174 3300048927 Bacteria 26214
411 Ga0496124_0002242 3300048927 Bacteria 25715
412 Ga0496124_0004217 3300048927 Bacteria 16922
413 Ga0496124_0009979 3300048927 Bacteria 9699
414 Ga0496124_0010360 3300048927 Bacteria 9449
415 Ga0496124_0012136 3300048927 Bacteria 8537
416 Ga0496124_0023634 3300048927 Bacteria 5607
417 Ga0496124_0036362 3300048927 Bacteria 4296
418 Ga0496124_0111844 3300048927 Bacteria 2197
419 Ga0496125_0000009 3300048928 Bacteria 677678
420 Ga0496125_0000817 3300048928 Bacteria 50621
421 Ga0496125_0001863 3300048928 Bacteria 29003
422 Ga0496125_0002491 3300048928 Bacteria 23841
423 Ga0496125_0006905 3300048928 Bacteria 12149
424 Ga0496125_0057820 3300048928 Bacteria 3137
425 Ga0496126_0000229 3300048929 Bacteria 120333
426 Ga0496126_0001518 3300048929 Bacteria 35794
427 Ga0496126_0002148 3300048929 Bacteria 27467
428 Ga0496126_0025889 3300048929 Bacteria 5634
429 Ga0496126_0048729 3300048929 Bacteria 3870
430 Ga0496126_0119970 3300048929 Bacteria 2282
431 Ga0496126_0137028 3300048929 Bacteria 2110
432 Ga0496126_0265049 3300048929 Bacteria 1427
433 Ga0495682_0000001 3300049460 Bacteria 1559116
434 Ga0501032_0002537 3300049569 Bacteria 14292
435 Ga0501032_0003765 3300049569 Bacteria 11511
436 Ga0501033_0000312 3300049570 Bacteria 46009
437 Ga0501034_0078424 3300049571 Bacteria 3307
438 Ga0501036_0004072 3300049572 Bacteria 11761
439 Ga0501037_0003244 3300049573 Bacteria 11792
440 Ga0501038_0004145 3300049574 Bacteria 13487
441 Ga0501039_0024539 3300049575 Bacteria 4632
442 Ga0501042_0003029 3300049578 Bacteria 10453
443 Ga0501043_0018698 3300049579 Bacteria 5437
444 Ga0501046_0011011 3300049580 Bacteria 7750
445 Ga0501046_0011179 3300049580 Bacteria 7691
446 Ga0501047_0007152 3300049581 Bacteria 10485
447 Ga0501047_0097160 3300049581 Bacteria 2824
448 Ga0501047_0145886 3300049581 Bacteria 2244
449 Ga0501048_0004517 3300049582 Bacteria 10594
450 Ga0501067_0127746 3300049583 Bacteria 1414
451 Ga0501068_0172709 3300049584 Bacteria 1364
452 Ga0501069_0069869 3300049585 Bacteria 1967
453 Ga0501070_0024722 3300049586 Bacteria 5038
454 Ga0501070_0052313 3300049586 Bacteria 3390
455 Ga0501070_0238975 3300049586 Bacteria 1487
456 Ga0501080_0267838 3300049742 Bacteria 1555
457 Ga0501083_0036971 3300049744 Bacteria 3327
458 Ga0501035_0000239 3300049822 Bacteria 65762
459 Ga0501035_0003554 3300049822 Bacteria 14889
460 Ga0501035_0026071 3300049822 Bacteria 5353
461 Ga0501044_0001125 3300049823 Bacteria 31755
462 Ga0501044_0006903 3300049823 Bacteria 12502
463 Ga0501044_0160632 3300049823 Bacteria 2224
464 nmdc:mga00v17_22297_c1 3300050491 Bacteria 3653
465 nmdc:mga00v17_4767_c1 3300050491 Bacteria 7099
466 nmdc:mga00v17_79074_c1 3300050491 Bacteria 2050
467 nmdc:mga0yw44_48562_c1 3300050492 Bacteria 2559
468 nmdc:mga0k408_20155_c1 3300050493 Bacteria 3732
469 nmdc:mga0a205_37137_c1 3300050515 Bacteria 4683
470 Ga0500618_000075 3300053125 Bacteria 80931
471 Ga0500621_000002 3300053126 Bacteria 849473
472 Ga0500573_0019137 3300053140 Bacteria 3915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0448961 Ga0496109_0448961_112_1134 292
2 iso_pu_bacteria 2734482000 2734970296 292
3 iso_pu_bacteria 2919119836 2919123511 293
4 iso_pu_bacteria 2917736166 2917738224 294
5 iso_pu_bacteria 2765235802 2765466645 295
6 iso_pu_bacteria 2510917027 2511181046 296
7 iso_pu_bacteria 2512564013 2512639398 296
8 iso_pu_bacteria 2857465823 2857472561 296
9 iso_pu_bacteria 2857591370 2857597842 296
10 iso_pu_bacteria 2915597211 2915598639 296
11 iso_pu_bacteria 2915606848 2915610223 296
12 iso_pu_bacteria 2929183550 2929183784 296
13 3300025986 Ga0207658_10103754 Ga0207658_101037542 297
14 3300031456 Ga0307513_10000021 Ga0307513_10000021109 298
15 iso_pu_bacteria 2856342000 2856348015 298
16 iso_pu_bacteria 2874123672 2874124900 298
17 iso_pu_bacteria 2970524798 2970529527 298
18 iso_pu_bacteria 2970540015 2970546628 298
19 3300021377 Ga0213874_10037222 Ga0213874_100372221 299
20 3300039438 Ga0436360_0412811 Ga0436360_0412811_1036_2022 299
21 3300039450 Ga0436363_0942232 Ga0436363_0942232_4962_5948 299
22 iso_pu_bacteria 2597489875 2597816234 299
23 iso_pu_bacteria 2838074704 2838075559 299
24 iso_pu_bacteria 2888343758 2888348657 299
25 iso_pu_bacteria 2889790730 2889791955 299
26 iso_pu_bacteria 2889914905 2889917102 299
27 iso_pu_bacteria 2896384573 2896388883 299
28 iso_pu_bacteria 2920760137 2920767383 299
29 3300003758 Ga0055532_1000568 Ga0055532_100056812 300
30 3300025229 Ga0209147_100276 Ga0209147_10027633 300
31 3300035410 Ga0373924_0120994 Ga0373924_0120994_120_1091 300
32 iso_pu_bacteria 2513237144 2513910499 300
33 iso_pu_bacteria 2816332139 2816506488 300
34 iso_pu_bacteria 2816332139 2816507851 300
35 3300009011 Ga0105251_10007398 Ga0105251_100073982 301
36 3300013306 Ga0163162_10004513 Ga0163162_1000451310 301
37 3300013307 Ga0157372_10007036 Ga0157372_100070368 301
38 3300015262 Ga0182007_10019007 Ga0182007_100190073 301
39 3300025711 Ga0207696_1000937 Ga0207696_100093717 301
40 3300025728 Ga0207655_1004282 Ga0207655_10042826 301
41 3300025735 Ga0207713_1010662 Ga0207713_10106623 301
42 3300041411 Ga0439466_0000191 Ga0439466_0000191_21520_22521 301
43 3300042146 Ga0450907_004044 Ga0450907_004044_643_1644 301
44 3300042439 Ga0439464_0001027 Ga0439464_0001027_3592_4593 301
45 3300046458 Ga0495591_022859 Ga0495591_022859_230_1231 301
46 3300046524 Ga0495648_0013543 Ga0495648_0013543_2321_3322 301
47 3300046810 Ga0495660_0024883 Ga0495660_0024883_548_1549 301
48 3300047320 Ga0495672_0000015 Ga0495672_0000015_58825_59826 301
49 3300047446 Ga0495679_003930 Ga0495679_003930_3089_4090 301
50 3300047472 Ga0495686_0001593 Ga0495686_0001593_14786_15748 301
51 3300048905 Ga0496102_0099202 Ga0496102_0099202_1315_2316 301
52 3300048908 Ga0496105_0002596 Ga0496105_0002596_11719_12720 301
53 3300048920 Ga0496117_0000058 Ga0496117_0000058_206255_207256 301
54 3300048921 Ga0496118_0000328 Ga0496118_0000328_56972_57973 301
55 3300048922 Ga0496119_0002456 Ga0496119_0002456_9397_10398 301
56 3300048923 Ga0496120_0000957 Ga0496120_0000957_13457_14458 301
57 3300048924 Ga0496121_0000103 Ga0496121_0000103_19715_20716 301
58 3300048925 Ga0496122_0141436 Ga0496122_0141436_405_1406 301
59 3300048927 Ga0496124_0000208 Ga0496124_0000208_80268_81269 301
60 3300053140 Ga0500573_0019137 Ga0500573_0019137_255_1238 301
61 3300009092 Ga0105250_10004668 Ga0105250_100046685 302
62 3300031731 Ga0307405_10141213 Ga0307405_101412131 302
63 3300002737 JGI25162J39368_1001594 JGI25162J39368_10015943 303
64 3300006051 Ga0075364_10006021 Ga0075364_100060215 303
65 3300009011 Ga0105251_10001166 Ga0105251_1000116616 303
66 3300009036 Ga0105244_10056197 Ga0105244_100561972 303
67 3300009092 Ga0105250_10026113 Ga0105250_100261132 303
68 3300013100 Ga0157373_10123584 Ga0157373_101235841 303
69 3300013105 Ga0157369_10003775 Ga0157369_100037758 303
70 3300013307 Ga0157372_10030813 Ga0157372_100308135 303
71 3300025233 Ga0209437_100073 Ga0209437_10007319 303
72 3300025728 Ga0207655_1002954 Ga0207655_100295418 303
73 3300025735 Ga0207713_1000001 Ga0207713_10000011290 303
74 3300032004 Ga0307414_10002591 Ga0307414_100025913 303
75 3300044712 Ga0453684_0565458 Ga0453684_0565458_184_1161 303
76 3300045051 Ga0451576_0029691 Ga0451576_0029691_1546_2523 303
77 3300048905 Ga0496102_0001157 Ga0496102_0001157_21124_22125 303
78 3300048919 Ga0496116_0025184 Ga0496116_0025184_2242_3243 303
79 3300048920 Ga0496117_0000022 Ga0496117_0000022_104263_105264 303
80 3300048921 Ga0496118_0000007 Ga0496118_0000007_471134_472135 303
81 3300048925 Ga0496122_0003065 Ga0496122_0003065_10963_11964 303
82 3300048926 Ga0496123_0004474 Ga0496123_0004474_210_1211 303
83 3300048927 Ga0496124_0010360 Ga0496124_0010360_5914_6915 303
84 3300049586 Ga0501070_0024722 Ga0501070_0024722_1618_2586 303
85 3300049586 Ga0501070_0238975 Ga0501070_0238975_25_993 303
86 3300049822 Ga0501035_0026071 Ga0501035_0026071_2307_3275 303
87 3300049823 Ga0501044_0160632 Ga0501044_0160632_202_1170 303
88 3300050491 nmdc:mga00v17_4767_c1 nmdc:mga00v17_4767_c1_2700_3701 303
89 iso_pu_bacteria 3001267043 3001271408 303
90 3300006177 Ga0075362_10021470 Ga0075362_100214702 304
91 3300006195 Ga0075366_10008304 Ga0075366_100083044 304
92 3300009094 Ga0111539_10154042 Ga0111539_101540423 304
93 3300048922 Ga0496119_0043495 Ga0496119_0043495_1845_2822 304
94 3300050493 nmdc:mga0k408_20155_c1 nmdc:mga0k408_20155_c1_2092_3093 304
95 3300005336 Ga0070680_100054139 Ga0070680_1000541394 305
96 3300005337 Ga0070682_100011416 Ga0070682_1000114164 305
97 3300005339 Ga0070660_100199242 Ga0070660_1001992422 305
98 3300005354 Ga0070675_100346263 Ga0070675_1003462632 305
99 3300005365 Ga0070688_100009373 Ga0070688_1000093732 305
100 3300005366 Ga0070659_100176199 Ga0070659_1001761992 305
101 3300005438 Ga0070701_10016698 Ga0070701_100166983 305
102 3300005455 Ga0070663_100166673 Ga0070663_1001666732 305
103 3300005466 Ga0070685_10027947 Ga0070685_100279473 305
104 3300005544 Ga0070686_100024965 Ga0070686_1000249652 305
105 3300005549 Ga0070704_100188964 Ga0070704_1001889642 305
106 3300005563 Ga0068855_100356199 Ga0068855_1003561991 305
107 3300005577 Ga0068857_100147718 Ga0068857_1001477182 305
108 3300005578 Ga0068854_100253718 Ga0068854_1002537182 305
109 3300005614 Ga0068856_100078545 Ga0068856_1000785453 305
110 3300005842 Ga0068858_100344607 Ga0068858_1003446072 305
111 3300006852 Ga0075433_10036543 Ga0075433_100365432 305
112 3300009011 Ga0105251_10002534 Ga0105251_1000253410 305
113 3300009098 Ga0105245_10039243 Ga0105245_100392432 305
114 3300009148 Ga0105243_10194613 Ga0105243_101946132 305
115 3300009176 Ga0105242_10028387 Ga0105242_100283874 305
116 3300009551 Ga0105238_10030987 Ga0105238_100309874 305
117 3300011119 Ga0105246_10027675 Ga0105246_100276752 305
118 3300013102 Ga0157371_10000061 Ga0157371_1000006194 305
119 3300013297 Ga0157378_10435830 Ga0157378_104358302 305
120 3300013307 Ga0157372_10023529 Ga0157372_100235296 305
121 3300014326 Ga0157380_10197200 Ga0157380_101972002 305
122 3300014745 Ga0157377_10102869 Ga0157377_101028692 305
123 3300014968 Ga0157379_10064175 Ga0157379_100641752 305
124 3300025735 Ga0207713_1000027 Ga0207713_1000027287 305
125 3300025917 Ga0207660_10029347 Ga0207660_100293473 305
126 3300025919 Ga0207657_10189984 Ga0207657_101899842 305
127 3300025927 Ga0207687_10082138 Ga0207687_100821383 305
128 3300025935 Ga0207709_10179128 Ga0207709_101791282 305
129 3300025944 Ga0207661_10032590 Ga0207661_100325903 305
130 3300025981 Ga0207640_10022719 Ga0207640_100227192 305
131 3300026023 Ga0207677_10059488 Ga0207677_100594883 305
132 3300026035 Ga0207703_10188930 Ga0207703_101889302 305
133 3300026075 Ga0207708_10002444 Ga0207708_100024443 305
134 3300026089 Ga0207648_10012653 Ga0207648_100126533 305
135 3300026142 Ga0207698_10381332 Ga0207698_103813322 305
136 3300048910 Ga0496107_0046913 Ga0496107_0046913_1584_2576 305
137 3300048911 Ga0496108_0015163 Ga0496108_0015163_1446_2438 305
138 3300048917 Ga0496114_0034941 Ga0496114_0034941_355_1347 305
139 3300048920 Ga0496117_0151950 Ga0496117_0151950_297_1316 305
140 3300048921 Ga0496118_0000476 Ga0496118_0000476_59810_60829 305
141 3300050515 nmdc:mga0a205_37137_c1 nmdc:mga0a205_37137_c1_3221_4213 305
142 3300005356 Ga0070674_100251249 Ga0070674_1002512492 306
143 3300005985 Ga0081539_10050898 Ga0081539_100508982 306
144 3300042876 Ga0451577_0000024 Ga0451577_0000024_100948_101928 306
145 3300048911 Ga0496108_0146480 Ga0496108_0146480_925_1920 306
146 3300048916 Ga0496113_0116585 Ga0496113_0116585_868_1863 306
147 3300049583 Ga0501067_0127746 Ga0501067_0127746_372_1367 306
148 3300049585 Ga0501069_0069869 Ga0501069_0069869_881_1876 306
149 3300009092 Ga0105250_10000001 Ga0105250_10000001468 307
150 3300025711 Ga0207696_1000028 Ga0207696_1000028217 307
151 3300006028 Ga0070717_10000121 Ga0070717_1000012122 308
152 3300014325 Ga0163163_10008657 Ga0163163_100086572 308
153 3300025944 Ga0207661_10038175 Ga0207661_100381754 308
154 3300028653 Ga0265323_10007031 Ga0265323_100070313 308
155 3300028653 Ga0265323_10007320 Ga0265323_100073204 308
156 3300031240 Ga0265320_10022488 Ga0265320_100224883 308
157 3300031240 Ga0265320_10023076 Ga0265320_100230763 308
158 3300031344 Ga0265316_10008003 Ga0265316_100080032 308
159 3300031344 Ga0265316_10102219 Ga0265316_101022192 308
160 3300031711 Ga0265314_10046453 Ga0265314_100464532 308
161 3300042876 Ga0451577_0107203 Ga0451577_0107203_735_1718 308
162 3300044673 Ga0453683_0001980 Ga0453683_0001980_4727_5710 308
163 3300044712 Ga0453684_0005807 Ga0453684_0005807_22955_23938 308
164 3300045051 Ga0451576_0058083 Ga0451576_0058083_1846_2829 308
165 3300047470 Ga0495681_0028187 Ga0495681_0028187_1340_2374 308
166 3300049569 Ga0501032_0002537 Ga0501032_0002537_8830_9813 308
167 3300049569 Ga0501032_0003765 Ga0501032_0003765_2594_3577 308
168 3300049570 Ga0501033_0000312 Ga0501033_0000312_2819_3802 308
169 3300049571 Ga0501034_0078424 Ga0501034_0078424_1125_2108 308
170 3300049572 Ga0501036_0004072 Ga0501036_0004072_8213_9196 308
171 3300049573 Ga0501037_0003244 Ga0501037_0003244_9017_10000 308
172 3300049574 Ga0501038_0004145 Ga0501038_0004145_3160_4143 308
173 3300049575 Ga0501039_0024539 Ga0501039_0024539_653_1636 308
174 3300049578 Ga0501042_0003029 Ga0501042_0003029_1911_2894 308
175 3300049579 Ga0501043_0018698 Ga0501043_0018698_3137_4120 308
176 3300049580 Ga0501046_0011011 Ga0501046_0011011_2823_3806 308
177 3300049580 Ga0501046_0011179 Ga0501046_0011179_882_1865 308
178 3300049581 Ga0501047_0007152 Ga0501047_0007152_8969_9952 308
179 3300049581 Ga0501047_0097160 Ga0501047_0097160_1105_2088 308
180 3300049582 Ga0501048_0004517 Ga0501048_0004517_6476_7459 308
181 3300049584 Ga0501068_0172709 Ga0501068_0172709_268_1251 308
182 3300049586 Ga0501070_0052313 Ga0501070_0052313_117_1100 308
183 3300049742 Ga0501080_0267838 Ga0501080_0267838_268_1251 308
184 3300049744 Ga0501083_0036971 Ga0501083_0036971_1476_2462 308
185 3300049822 Ga0501035_0000239 Ga0501035_0000239_64086_65069 308
186 3300049822 Ga0501035_0003554 Ga0501035_0003554_11077_12060 308
187 3300049823 Ga0501044_0001125 Ga0501044_0001125_5136_6119 308
188 3300049823 Ga0501044_0006903 Ga0501044_0006903_8690_9673 308
189 iso_pu_bacteria 2515154107 2515611162 308
190 iso_pu_bacteria 2791355091 2792624404 308
191 iso_pu_bacteria 2791355092 2792630220 308
192 3300009036 Ga0105244_10002301 Ga0105244_100023014 309
193 3300014745 Ga0157377_10064559 Ga0157377_100645592 309
194 3300025728 Ga0207655_1000343 Ga0207655_100034348 309
195 3300049581 Ga0501047_0145886 Ga0501047_0145886_668_1654 309
196 3300053125 Ga0500618_000075 Ga0500618_000075_67707_68729 309
197 3300003856 Ga0058692_1000084 Ga0058692_100008450 310
198 3300027312 Ga0209371_1000039 Ga0209371_1000039125 310
199 3300030500 Ga0268256_1000033 Ga0268256_1000033237 310
200 iso_pu_bacteria 2932406140 2932407758 310
201 iso_pu_bacteria 2939577877 2939580163 310
202 iso_pu_bacteria 8055693939 8055695945 310
203 3300003856 Ga0058692_1001411 Ga0058692_100141110 311
204 3300005289 Ga0065704_10009186 Ga0065704_100091864 311
205 3300006946 Ga0079104_1000842 Ga0079104_10008428 311
206 3300013102 Ga0157371_10017240 Ga0157371_100172402 311
207 3300027111 Ga0209281_1000680 Ga0209281_10006808 311
208 3300027312 Ga0209371_1000002 Ga0209371_1000002746 311
209 3300030500 Ga0268256_1000002 Ga0268256_1000002718 311
210 3300042006 Ga0439432_017052 Ga0439432_017052_1191_2195 311
211 3300048924 Ga0496121_0008064 Ga0496121_0008064_6521_7525 311
212 3300048925 Ga0496122_0011631 Ga0496122_0011631_6521_7525 311
213 3300048926 Ga0496123_0041280 Ga0496123_0041280_969_1973 311
214 3300048927 Ga0496124_0004217 Ga0496124_0004217_13017_14021 311
215 3300048928 Ga0496125_0001863 Ga0496125_0001863_6512_7516 311
216 iso_pu_bacteria 2506520007 2506578797 311
217 iso_pu_bacteria 2506520008 2506583936 311
218 iso_pu_bacteria 2508501071 2508852729 311
219 iso_pu_bacteria 2510065045 2510247199 311
220 iso_pu_bacteria 2512047030 2512345489 311
221 iso_pu_bacteria 2537561728 2538424841 311
222 iso_pu_bacteria 2599185299 2599925859 311
223 iso_pu_bacteria 2608642108 2608669640 311
224 iso_pu_bacteria 2648501693 2650899190 311
225 iso_pu_bacteria 2654587920 2656279731 311
226 iso_pu_bacteria 2684622997 2686353577 311
227 iso_pu_bacteria 2687453601 2689445308 311
228 iso_pu_bacteria 2706794495 2707099077 311
229 iso_pu_bacteria 2718217991 2719637782 311
230 iso_pu_bacteria 2772190666 2772439282 311
231 iso_pu_bacteria 2808606414 2809125125 311
232 iso_pu_bacteria 2844528606 2844531116 311
233 iso_pu_bacteria 2846540461 2846545047 311
234 iso_pu_bacteria 2847085930 2847087431 311
235 iso_pu_bacteria 2847797336 2847799634 311
236 iso_pu_bacteria 2852103415 2852107683 311
237 iso_pu_bacteria 2854601825 2854604020 311
238 iso_pu_bacteria 2855195626 2855199762 311
239 iso_pu_bacteria 2858466076 2858468517 311
240 iso_pu_bacteria 2865014394 2865015488 311
241 iso_pu_bacteria 2869551831 2869554748 311
242 iso_pu_bacteria 2871272651 2871272842 311
243 iso_pu_bacteria 2871282230 2871284977 311
244 iso_pu_bacteria 2881609920 2881611938 311
245 iso_pu_bacteria 2888366609 2888369341 311
246 iso_pu_bacteria 2888373701 2888378016 311
247 iso_pu_bacteria 2900051742 2900051963 311
248 iso_pu_bacteria 2908669403 2908669532 311
249 iso_pu_bacteria 2937967321 2937967913 311
250 iso_pu_bacteria 2945951305 2945952761 311
251 iso_pu_bacteria 2984494565 2984496866 311
252 iso_pu_bacteria 2990261002 2990262283 311
253 iso_pu_bacteria 3000376612 3000379324 311
254 iso_pu_bacteria 640753048 640938236 311
255 iso_pu_bacteria 8004592986 8004597069 311
256 iso_pu_bacteria 8015394850 8015396436 311
257 3300006946 Ga0079104_1000498 Ga0079104_10004987 312
258 3300027111 Ga0209281_1000012 Ga0209281_1000012389 312
259 3300027312 Ga0209371_1003116 Ga0209371_10031162 312
260 3300027312 Ga0209371_1009760 Ga0209371_10097603 312
261 3300030500 Ga0268256_1002802 Ga0268256_10028029 312
262 3300030500 Ga0268256_1010382 Ga0268256_10103822 312
263 3300042010 Ga0439452_003218 Ga0439452_003218_3557_4561 312
264 3300048922 Ga0496119_0000395 Ga0496119_0000395_8913_9917 312
265 3300048923 Ga0496120_0004578 Ga0496120_0004578_1146_2150 312
266 3300048929 Ga0496126_0002148 Ga0496126_0002148_5060_6064 312
267 iso_pu_bacteria 2511231025 2511380817 312
268 iso_pu_bacteria 2511231035 2511437009 312
269 iso_pu_bacteria 2547132181 2547695801 312
270 iso_pu_bacteria 2547132416 2548649931 312
271 iso_pu_bacteria 2554235234 2555257381 312
272 iso_pu_bacteria 2561511199 2562462490 312
273 iso_pu_bacteria 2599185169 2599408864 312
274 iso_pu_bacteria 2600255254 2601522620 312
275 iso_pu_bacteria 2600255255 2601527647 312
276 iso_pu_bacteria 2600255256 2601533674 312
277 iso_pu_bacteria 2600255257 2601539674 312
278 iso_pu_bacteria 2600255280 2601614478 312
279 iso_pu_bacteria 2600255281 2601619198 312
280 iso_pu_bacteria 2600255287 2601642189 312
281 iso_pu_bacteria 2600255288 2601647044 312
282 iso_pu_bacteria 2600255289 2601652625 312
283 iso_pu_bacteria 2600255290 2601657951 312
284 iso_pu_bacteria 2600255291 2601662012 312
285 iso_pu_bacteria 2600255298 2601694970 312
286 iso_pu_bacteria 2600255299 2601699642 312
287 iso_pu_bacteria 2600255300 2601706470 312
288 iso_pu_bacteria 2600255301 2601710776 312
289 iso_pu_bacteria 2600255302 2601715790 312
290 iso_pu_bacteria 2600255303 2601719993 312
291 iso_pu_bacteria 2600255304 2601726196 312
292 iso_pu_bacteria 2600255305 2601730737 312
293 iso_pu_bacteria 2600255306 2601735753 312
294 iso_pu_bacteria 2600255307 2601741020 312
295 iso_pu_bacteria 2600255309 2601750950 312
296 iso_pu_bacteria 2600255310 2601758024 312
297 iso_pu_bacteria 2600255311 2601763725 312
298 iso_pu_bacteria 2600255392 2602018204 312
299 iso_pu_bacteria 2602042046 2603637603 312
300 iso_pu_bacteria 2602042047 2603642019 312
301 iso_pu_bacteria 2602042052 2603659374 312
302 iso_pu_bacteria 2602042053 2603664649 312
303 iso_pu_bacteria 2602042066 2603698796 312
304 iso_pu_bacteria 2602042067 2603702563 312
305 iso_pu_bacteria 2602042103 2603838129 312
306 iso_pu_bacteria 2602042104 2603843207 312
307 iso_pu_bacteria 2602042105 2603848280 312
308 iso_pu_bacteria 2602042106 2603853355 312
309 iso_pu_bacteria 2602042109 2603867296 312
310 iso_pu_bacteria 2602042110 2603871406 312
311 iso_pu_bacteria 2602042111 2603876329 312
312 iso_pu_bacteria 2603880178 2606048598 312
313 iso_pu_bacteria 2603880184 2606069076 312
314 iso_pu_bacteria 2603880202 2606144890 312
315 iso_pu_bacteria 2603880211 2606176000 312
316 iso_pu_bacteria 2609459761 2609914640 312
317 iso_pu_bacteria 2636415599 2637224670 312
318 iso_pu_bacteria 2667528172 2671101751 312
319 iso_pu_bacteria 2671180115 2671584740 312
320 iso_pu_bacteria 2675903046 2676406004 312
321 iso_pu_bacteria 2681812866 2681998413 312
322 iso_pu_bacteria 2681812869 2682005788 312
323 iso_pu_bacteria 2711768156 2712469868 312
324 iso_pu_bacteria 2751185917 2753856360 312
325 iso_pu_bacteria 2765235842 2765589363 312
326 iso_pu_bacteria 2775506706 2775539406 312
327 iso_pu_bacteria 2775507074 2777022236 312
328 iso_pu_bacteria 2791354903 2791921552 312
329 iso_pu_bacteria 2791355010 2792310810 312
330 iso_pu_bacteria 2791355275 2793405368 312
331 iso_pu_bacteria 2811995292 2813728647 312
332 iso_pu_bacteria 2814123068 2814696167 312
333 iso_pu_bacteria 2821118458 2821122627 312
334 iso_pu_bacteria 2823373977 2823375106 312
335 iso_pu_bacteria 2844425489 2844427845 312
336 iso_pu_bacteria 2876601092 2876604008 312
337 iso_pu_bacteria 2884086401 2884088589 312
338 iso_pu_bacteria 2891670763 2891673873 312
339 iso_pu_bacteria 2904513164 2904514381 312
340 iso_pu_bacteria 2919108558 2919108577 312
341 iso_pu_bacteria 2923634449 2923635271 312
342 iso_pu_bacteria 2927833300 2927833746 312
343 iso_pu_bacteria 2935625433 2935626466 312
344 iso_pu_bacteria 2937539931 2937541331 312
345 iso_pu_bacteria 2939568625 2939569434 312
346 iso_pu_bacteria 2939573065 2939573428 312
347 iso_pu_bacteria 2939602548 2939603140 312
348 iso_pu_bacteria 2939607340 2939609208 312
349 iso_pu_bacteria 2939617950 2939621315 312
350 iso_pu_bacteria 2939642701 2939643543 312
351 iso_pu_bacteria 2945874760 2945878127 312
352 iso_pu_bacteria 2969079654 2969081711 312
353 iso_pu_bacteria 2971820967 2971823146 312
354 iso_pu_bacteria 2974310843 2974311738 312
355 iso_pu_bacteria 2974435778 2974438627 312
356 iso_pu_bacteria 2984559226 2984564139 312
357 iso_pu_bacteria 2984595703 2984596874 312
358 iso_pu_bacteria 8016733728 8016735692 312
359 iso_pu_bacteria 8018221730 8018221798 312
360 iso_pu_bacteria 8018405270 8018407420 312
361 iso_pu_bacteria 8019499862 8019500909 312
362 iso_pu_bacteria 8019504834 8019508020 312
363 iso_pu_bacteria 8054844752 8054845495 312
364 iso_pu_bacteria 8054849141 8054852983 312
365 iso_pu_bacteria 8055087960 8055090630 312
366 iso_pu_bacteria 8055092621 8055096714 312
367 iso_pu_bacteria 8055097453 8055098747 312
368 iso_pu_bacteria 8057304971 8057309151 312
369 2162886007 SwRhRL2b_contig_719382 SwRhRL2b_0901.00005330 313
370 3300002737 JGI25162J39368_1000033 JGI25162J39368_100003317 313
371 3300002771 JGI25163J39215_1000256 JGI25163J39215_10002561 313
372 3300002772 JGI25164J39214_1000017 JGI25164J39214_100001717 313
373 3300003578 Ga0006562J51391_1020104 Ga0006562J51391_10201042 313
374 3300003751 Ga0055538_1000035 Ga0055538_1000035177 313
375 3300003752 Ga0055539_1000046 Ga0055539_100004617 313
376 3300003756 Ga0055533_1000056 Ga0055533_1000056177 313
377 3300003759 Ga0055525_1000067 Ga0055525_1000067177 313
378 3300003841 Ga0055541_1000033 Ga0055541_100003317 313
379 3300003856 Ga0058692_1028170 Ga0058692_10281701 313
380 3300005289 Ga0065704_10000015 Ga0065704_1000001575 313
381 3300005577 Ga0068857_100029881 Ga0068857_1000298814 313
382 3300006038 Ga0075365_10013798 Ga0075365_100137985 313
383 3300006946 Ga0079104_1000442 Ga0079104_10004428 313
384 3300006946 Ga0079104_1005228 Ga0079104_10052285 313
385 3300009011 Ga0105251_10001628 Ga0105251_1000162816 313
386 3300009036 Ga0105244_10038305 Ga0105244_100383052 313
387 3300009092 Ga0105250_10000469 Ga0105250_1000046917 313
388 3300009148 Ga0105243_10190537 Ga0105243_101905372 313
389 3300015679 Ga0183366_1001 Ga0183366_10011772 313
390 3300015680 Ga0183370_1001 Ga0183370_10011772 313
391 3300015685 Ga0183369_1001 Ga0183369_10011772 313
392 3300015687 Ga0183368_1001 Ga0183368_10011772 313
393 3300025207 Ga0209760_100073 Ga0209760_10007334 313
394 3300025224 Ga0209784_100001 Ga0209784_1000011541 313
395 3300025225 Ga0209566_100001 Ga0209566_1000011541 313
396 3300025226 Ga0209674_100002 Ga0209674_1000021541 313
397 3300025230 Ga0209563_100002 Ga0209563_10000276 313
398 3300025231 Ga0207427_100032 Ga0207427_10003276 313
399 3300025233 Ga0209437_100001 Ga0209437_10000176 313
400 3300025253 Ga0209677_100002 Ga0209677_10000276 313
401 3300025711 Ga0207696_1000030 Ga0207696_1000030369 313
402 3300025728 Ga0207655_1038367 Ga0207655_10383672 313
403 3300025728 Ga0207655_1042398 Ga0207655_10423982 313
404 3300025735 Ga0207713_1000015 Ga0207713_100001516 313
405 3300025735 Ga0207713_1003426 Ga0207713_10034264 313
406 3300025735 Ga0207713_1004761 Ga0207713_10047613 313
407 3300026116 Ga0207674_10003641 Ga0207674_1000364117 313
408 3300027111 Ga0209281_1000006 Ga0209281_1000006565 313
409 3300027111 Ga0209281_1002091 Ga0209281_10020913 313
410 3300027312 Ga0209371_1001219 Ga0209371_10012194 313
411 3300027312 Ga0209371_1002540 Ga0209371_10025407 313
412 3300030500 Ga0268256_1001470 Ga0268256_100147013 313
413 3300030500 Ga0268256_1001685 Ga0268256_10016853 313
414 3300046471 Ga0495650_0000126 Ga0495650_0000126_107742_108779 313
415 3300046810 Ga0495660_0000075 Ga0495660_0000075_100832_101869 313
416 3300048907 Ga0496104_0000324 Ga0496104_0000324_29604_30608 313
417 3300048907 Ga0496104_0010773 Ga0496104_0010773_2536_3573 313
418 3300048908 Ga0496105_0134948 Ga0496105_0134948_83_1087 313
419 3300048919 Ga0496116_0000048 Ga0496116_0000048_51034_52071 313
420 3300048919 Ga0496116_0000086 Ga0496116_0000086_155514_156515 313
421 3300048919 Ga0496116_0062835 Ga0496116_0062835_346_1350 313
422 3300048919 Ga0496116_0187871 Ga0496116_0187871_48_1052 313
423 3300048920 Ga0496117_0001102 Ga0496117_0001102_37541_38545 313
424 3300048920 Ga0496117_0004084 Ga0496117_0004084_13572_14576 313
425 3300048920 Ga0496117_0007937 Ga0496117_0007937_6522_7559 313
426 3300048921 Ga0496118_0002853 Ga0496118_0002853_1092_2096 313
427 3300048921 Ga0496118_0009237 Ga0496118_0009237_6650_7687 313
428 3300048922 Ga0496119_0013747 Ga0496119_0013747_4502_5506 313
429 3300048922 Ga0496119_0023927 Ga0496119_0023927_3171_4172 313
430 3300048923 Ga0496120_0000091 Ga0496120_0000091_103105_104106 313
431 3300048923 Ga0496120_0007207 Ga0496120_0007207_4080_5084 313
432 3300048924 Ga0496121_0000966 Ga0496121_0000966_48378_49382 313
433 3300048924 Ga0496121_0021394 Ga0496121_0021394_5229_6233 313
434 3300048924 Ga0496121_0031393 Ga0496121_0031393_1807_2811 313
435 3300048925 Ga0496122_0000086 Ga0496122_0000086_97427_98464 313
436 3300048925 Ga0496122_0006159 Ga0496122_0006159_6020_7024 313
437 3300048925 Ga0496122_0025116 Ga0496122_0025116_2379_3383 313
438 3300048926 Ga0496123_0000021 Ga0496123_0000021_97573_98610 313
439 3300048926 Ga0496123_0003023 Ga0496123_0003023_18336_19340 313
440 3300048926 Ga0496123_0015460 Ga0496123_0015460_54_1058 313
441 3300048927 Ga0496124_0000092 Ga0496124_0000092_75632_76669 313
442 3300048927 Ga0496124_0002242 Ga0496124_0002242_1089_2093 313
443 3300048928 Ga0496125_0000817 Ga0496125_0000817_2428_3432 313
444 3300048928 Ga0496125_0002491 Ga0496125_0002491_4624_5661 313
445 3300048929 Ga0496126_0000229 Ga0496126_0000229_43678_44715 313
446 3300048929 Ga0496126_0001518 Ga0496126_0001518_4365_5369 313
447 3300048929 Ga0496126_0025889 Ga0496126_0025889_1414_2418 313
448 3300050492 nmdc:mga0yw44_48562_c1 nmdc:mga0yw44_48562_c1_143_1207 313
449 iso_pu_bacteria 2984576629 2984578131 313
450 iso_pu_bacteria 2990256926 2990257645 313
451 3300006946 Ga0079104_1000479 Ga0079104_100047919 314
452 3300013307 Ga0157372_10012878 Ga0157372_100128788 314
453 3300027111 Ga0209281_1000124 Ga0209281_100012453 314
454 3300027312 Ga0209371_1001573 Ga0209371_100157314 314
455 3300030500 Ga0268256_1001352 Ga0268256_100135214 314
456 3300041405 Ga0439438_010041 Ga0439438_010041_1249_2247 314
457 3300048922 Ga0496119_0000018 Ga0496119_0000018_127959_128960 314
458 3300048923 Ga0496120_0000002 Ga0496120_0000002_207216_208217 314
459 3300001989 JGI24739J22299_10013662 JGI24739J22299_100136623 315
460 3300003856 Ga0058692_1000160 Ga0058692_100016032 315
461 3300003856 Ga0058692_1000259 Ga0058692_100025931 315
462 3300003856 Ga0058692_1002965 Ga0058692_10029653 315
463 3300009011 Ga0105251_10014438 Ga0105251_100144383 315
464 3300009036 Ga0105244_10000055 Ga0105244_1000005514 315
465 3300009036 Ga0105244_10001200 Ga0105244_1000120013 315
466 3300013100 Ga0157373_10010056 Ga0157373_100100562 315
467 3300013100 Ga0157373_10052724 Ga0157373_100527243 315
468 3300013102 Ga0157371_10003074 Ga0157371_100030747 315
469 3300013102 Ga0157371_10040078 Ga0157371_100400782 315
470 3300013104 Ga0157370_10003179 Ga0157370_1000317923 315
471 3300015261 Ga0182006_1012678 Ga0182006_10126783 315
472 3300025728 Ga0207655_1000004 Ga0207655_1000004884 315
473 3300027312 Ga0209371_1000005 Ga0209371_1000005411 315
474 3300027312 Ga0209371_1000110 Ga0209371_100011094 315
475 3300027312 Ga0209371_1000157 Ga0209371_100015747 315
476 3300027312 Ga0209371_1002626 Ga0209371_10026267 315
477 3300027312 Ga0209371_1006345 Ga0209371_10063455 315
478 3300027312 Ga0209371_1011714 Ga0209371_10117143 315
479 3300030500 Ga0268256_1000006 Ga0268256_1000006646 315
480 3300030500 Ga0268256_1000280 Ga0268256_100028036 315
481 3300030500 Ga0268256_1000745 Ga0268256_10007457 315
482 3300030500 Ga0268256_1004178 Ga0268256_10041785 315
483 3300030500 Ga0268256_1012739 Ga0268256_10127393 315
484 3300041405 Ga0439438_000001 Ga0439438_000001_1065982_1066983 315
485 3300042010 Ga0439452_000001 Ga0439452_000001_1102778_1103779 315
486 3300046458 Ga0495591_000738 Ga0495591_000738_1037_2038 315
487 3300046471 Ga0495650_0000026 Ga0495650_0000026_311234_312235 315
488 3300046501 Ga0495607_0014054 Ga0495607_0014054_2196_3197 315
489 3300046507 Ga0495606_0002025 Ga0495606_0002025_7575_8576 315
490 3300046518 Ga0495631_0069574 Ga0495631_0069574_100_1101 315
491 3300046523 Ga0495644_0006309 Ga0495644_0006309_1388_2389 315
492 3300046524 Ga0495648_0007335 Ga0495648_0007335_2945_3946 315
493 3300046530 Ga0495654_0000136 Ga0495654_0000136_47425_48426 315
494 3300046692 Ga0495671_0005318 Ga0495671_0005318_4259_5260 315
495 3300046810 Ga0495660_0000016 Ga0495660_0000016_126541_127542 315
496 3300047320 Ga0495672_0000001 Ga0495672_0000001_356573_357574 315
497 3300047320 Ga0495672_0000020 Ga0495672_0000020_336807_337811 315
498 3300047323 Ga0495683_0039455 Ga0495683_0039455_310_1311 315
499 3300047469 Ga0495673_0000247 Ga0495673_0000247_10174_11175 315
500 3300048919 Ga0496116_0000087 Ga0496116_0000087_208478_209479 315
501 3300048920 Ga0496117_0002520 Ga0496117_0002520_11915_12916 315
502 3300048921 Ga0496118_0003275 Ga0496118_0003275_18047_19048 315
503 3300048922 Ga0496119_0000089 Ga0496119_0000089_54348_55349 315
504 3300048923 Ga0496120_0000117 Ga0496120_0000117_78995_79996 315
505 3300048927 Ga0496124_0023634 Ga0496124_0023634_632_1633 315
506 3300049460 Ga0495682_0000001 Ga0495682_0000001_744961_745962 315
507 3300053126 Ga0500621_000002 Ga0500621_000002_756398_757399 315
508 2162886007 SwRhRL2b_contig_1329442 SwRhRL2b_0901.00006270 316
509 2162886007 SwRhRL2b_contig_2505277 SwRhRL2b_0292.00002760 316
510 2162886007 SwRhRL2b_contig_3210718 SwRhRL2b_0722.00005030 316
511 2162886007 SwRhRL2b_contig_975791 SwRhRL2b_0119.00005990 316
512 3300002773 JGI25152J39213_1004163 JGI25152J39213_10041633 316
513 3300003320 rootH2_10009975 rootH2_100099757 316
514 3300003856 Ga0058692_1004470 Ga0058692_10044702 316
515 3300003856 Ga0058692_1027553 Ga0058692_10275531 316
516 3300005289 Ga0065704_10000267 Ga0065704_1000026715 316
517 3300005289 Ga0065704_10080131 Ga0065704_100801312 316
518 3300005548 Ga0070665_100000488 Ga0070665_1000004887 316
519 3300006051 Ga0075364_10001295 Ga0075364_1000129519 316
520 3300006051 Ga0075364_10059679 Ga0075364_100596793 316
521 3300006946 Ga0079104_1000021 Ga0079104_1000021230 316
522 3300006946 Ga0079104_1001570 Ga0079104_10015707 316
523 3300006946 Ga0079104_1002325 Ga0079104_10023258 316
524 3300006946 Ga0079104_1004838 Ga0079104_10048383 316
525 3300009011 Ga0105251_10003656 Ga0105251_100036567 316
526 3300009011 Ga0105251_10014864 Ga0105251_100148643 316
527 3300009011 Ga0105251_10019132 Ga0105251_100191322 316
528 3300009036 Ga0105244_10000070 Ga0105244_1000007052 316
529 3300009036 Ga0105244_10002316 Ga0105244_1000231612 316
530 3300009036 Ga0105244_10003053 Ga0105244_100030537 316
531 3300009036 Ga0105244_10003902 Ga0105244_100039022 316
532 3300009036 Ga0105244_10039349 Ga0105244_100393493 316
533 3300009036 Ga0105244_10113710 Ga0105244_101137101 316
534 3300009092 Ga0105250_10000060 Ga0105250_1000006090 316
535 3300009092 Ga0105250_10000508 Ga0105250_1000050811 316
536 3300009092 Ga0105250_10003283 Ga0105250_100032836 316
537 3300009092 Ga0105250_10008034 Ga0105250_100080344 316
538 3300009092 Ga0105250_10035696 Ga0105250_100356962 316
539 3300009092 Ga0105250_10046001 Ga0105250_100460012 316
540 3300011119 Ga0105246_10080333 Ga0105246_100803332 316
541 3300013100 Ga0157373_10000307 Ga0157373_100003079 316
542 3300013102 Ga0157371_10000881 Ga0157371_1000088120 316
543 3300013102 Ga0157371_10083060 Ga0157371_100830603 316
544 3300013104 Ga0157370_10005455 Ga0157370_1000545510 316
545 3300013104 Ga0157370_10010663 Ga0157370_100106634 316
546 3300013307 Ga0157372_10021707 Ga0157372_100217077 316
547 3300013307 Ga0157372_10025193 Ga0157372_100251936 316
548 3300013307 Ga0157372_10030975 Ga0157372_100309755 316
549 3300013307 Ga0157372_10082646 Ga0157372_100826462 316
550 3300015261 Ga0182006_1000051 Ga0182006_100005115 316
551 3300021384 Ga0213876_10000069 Ga0213876_1000006916 316
552 3300025245 Ga0207425_1023644 Ga0207425_10236442 316
553 3300025258 Ga0209129_1000004 Ga0209129_1000004452 316
554 3300025711 Ga0207696_1000190 Ga0207696_100019035 316
555 3300025711 Ga0207696_1000280 Ga0207696_100028042 316
556 3300025711 Ga0207696_1000814 Ga0207696_10008142 316
557 3300025711 Ga0207696_1005769 Ga0207696_10057695 316
558 3300025728 Ga0207655_1000001 Ga0207655_10000011650 316
559 3300025728 Ga0207655_1000002 Ga0207655_1000002799 316
560 3300025728 Ga0207655_1000007 Ga0207655_100000775 316
561 3300025728 Ga0207655_1000168 Ga0207655_100016852 316
562 3300025728 Ga0207655_1004094 Ga0207655_10040949 316
563 3300025728 Ga0207655_1009359 Ga0207655_10093599 316
564 3300025728 Ga0207655_1032737 Ga0207655_10327372 316
565 3300025728 Ga0207655_1074718 Ga0207655_10747181 316
566 3300025735 Ga0207713_1000004 Ga0207713_1000004470 316
567 3300025735 Ga0207713_1018499 Ga0207713_10184994 316
568 3300025735 Ga0207713_1035370 Ga0207713_10353702 316
569 3300027111 Ga0209281_1000001 Ga0209281_1000001461 316
570 3300027111 Ga0209281_1000004 Ga0209281_1000004773 316
571 3300027111 Ga0209281_1000985 Ga0209281_100098522 316
572 3300027111 Ga0209281_1001187 Ga0209281_10011878 316
573 3300027111 Ga0209281_1004440 Ga0209281_10044403 316
574 3300027312 Ga0209371_1000001 Ga0209371_10000011792 316
575 3300027312 Ga0209371_1000060 Ga0209371_1000060174 316
576 3300027312 Ga0209371_1000455 Ga0209371_100045520 316
577 3300028379 Ga0268266_10000629 Ga0268266_1000062939 316
578 3300030500 Ga0268256_1000001 Ga0268256_1000001849 316
579 3300030500 Ga0268256_1000084 Ga0268256_100008455 316
580 3300030500 Ga0268256_1000515 Ga0268256_100051515 316
581 3300039437 Ga0436365_0368505 Ga0436365_0368505_134711_135715 316
582 3300041405 Ga0439438_006075 Ga0439438_006075_1354_2358 316
583 3300041512 Ga0451853_1907721 Ga0451853_1907721_699_1703 316
584 3300042010 Ga0439452_000002 Ga0439452_000002_879496_880500 316
585 3300042010 Ga0439452_000016 Ga0439452_000016_138356_139360 316
586 3300042010 Ga0439452_000025 Ga0439452_000025_161403_162407 316
587 3300042136 Ga0450900_008958 Ga0450900_008958_101_1105 316
588 3300044669 Ga0466981_0000007 Ga0466981_0000007_21077_22081 316
589 3300046458 Ga0495591_000007 Ga0495591_000007_201674_202678 316
590 3300046458 Ga0495591_000284 Ga0495591_000284_19682_20686 316
591 3300046458 Ga0495591_004448 Ga0495591_004448_3486_4490 316
592 3300046460 Ga0495638_0001088 Ga0495638_0001088_7413_8417 316
593 3300046471 Ga0495650_0000005 Ga0495650_0000005_75616_76620 316
594 3300046515 Ga0495620_0002941 Ga0495620_0002941_8527_9531 316
595 3300046530 Ga0495654_0000007 Ga0495654_0000007_238809_239813 316
596 3300046542 Ga0495597_0001674 Ga0495597_0001674_5002_6006 316
597 3300046660 Ga0495625_0024926 Ga0495625_0024926_1783_2787 316
598 3300046674 Ga0495588_0008354 Ga0495588_0008354_2040_3044 316
599 3300046694 Ga0495649_0001831 Ga0495649_0001831_13512_14516 316
600 3300046694 Ga0495649_0018237 Ga0495649_0018237_1420_2424 316
601 3300047446 Ga0495679_000018 Ga0495679_000018_83489_84493 316
602 3300047446 Ga0495679_009489 Ga0495679_009489_2688_3692 316
603 3300047469 Ga0495673_0000007 Ga0495673_0000007_508651_509655 316
604 3300048904 Ga0496101_0000058 Ga0496101_0000058_1466_2470 316
605 3300048919 Ga0496116_0000347 Ga0496116_0000347_64593_65597 316
606 3300048919 Ga0496116_0018501 Ga0496116_0018501_3277_4281 316
607 3300048919 Ga0496116_0090729 Ga0496116_0090729_359_1363 316
608 3300048920 Ga0496117_0001297 Ga0496117_0001297_6691_7695 316
609 3300048920 Ga0496117_0002891 Ga0496117_0002891_10803_11807 316
610 3300048921 Ga0496118_0002356 Ga0496118_0002356_4933_5937 316
611 3300048921 Ga0496118_0005005 Ga0496118_0005005_1261_2265 316
612 3300048921 Ga0496118_0031410 Ga0496118_0031410_785_1789 316
613 3300048921 Ga0496118_0038423 Ga0496118_0038423_2048_3052 316
614 3300048922 Ga0496119_0000001 Ga0496119_0000001_383847_384851 316
615 3300048922 Ga0496119_0012581 Ga0496119_0012581_5037_6041 316
616 3300048922 Ga0496119_0014488 Ga0496119_0014488_3365_4369 316
617 3300048923 Ga0496120_0000601 Ga0496120_0000601_46282_47286 316
618 3300048923 Ga0496120_0001234 Ga0496120_0001234_4656_5660 316
619 3300048923 Ga0496120_0009019 Ga0496120_0009019_1241_2245 316
620 3300048924 Ga0496121_0000968 Ga0496121_0000968_49581_50585 316
621 3300048924 Ga0496121_0004326 Ga0496121_0004326_3505_4509 316
622 3300048924 Ga0496121_0018960 Ga0496121_0018960_1287_2291 316
623 3300048925 Ga0496122_0000005 Ga0496122_0000005_581947_582951 316
624 3300048925 Ga0496122_0001791 Ga0496122_0001791_17921_18925 316
625 3300048925 Ga0496122_0002471 Ga0496122_0002471_21423_22427 316
626 3300048925 Ga0496122_0029043 Ga0496122_0029043_1819_2823 316
627 3300048925 Ga0496122_0119269 Ga0496122_0119269_509_1513 316
628 3300048926 Ga0496123_0000008 Ga0496123_0000008_47678_48682 316
629 3300048926 Ga0496123_0000014 Ga0496123_0000014_199132_200136 316
630 3300048926 Ga0496123_0001457 Ga0496123_0001457_12354_13358 316
631 3300048926 Ga0496123_0001460 Ga0496123_0001460_17921_18925 316
632 3300048926 Ga0496123_0003139 Ga0496123_0003139_556_1560 316
633 3300048926 Ga0496123_0023569 Ga0496123_0023569_2871_3875 316
634 3300048927 Ga0496124_0000059 Ga0496124_0000059_157236_158240 316
635 3300048927 Ga0496124_0001437 Ga0496124_0001437_2243_3247 316
636 3300048927 Ga0496124_0002174 Ga0496124_0002174_17821_18825 316
637 3300048927 Ga0496124_0009979 Ga0496124_0009979_7304_8308 316
638 3300048927 Ga0496124_0012136 Ga0496124_0012136_3194_4198 316
639 3300048927 Ga0496124_0036362 Ga0496124_0036362_727_1731 316
640 3300048927 Ga0496124_0111844 Ga0496124_0111844_700_1704 316
641 3300048928 Ga0496125_0000009 Ga0496125_0000009_73801_74805 316
642 3300048928 Ga0496125_0006905 Ga0496125_0006905_8513_9517 316
643 3300048928 Ga0496125_0057820 Ga0496125_0057820_695_1699 316
644 3300048929 Ga0496126_0048729 Ga0496126_0048729_174_1178 316
645 3300048929 Ga0496126_0119970 Ga0496126_0119970_1098_2102 316
646 3300048929 Ga0496126_0137028 Ga0496126_0137028_823_1827 316
647 3300048929 Ga0496126_0265049 Ga0496126_0265049_239_1243 316
648 3300050491 nmdc:mga00v17_22297_c1 nmdc:mga00v17_22297_c1_1057_2061 316
649 3300050491 nmdc:mga00v17_79074_c1 nmdc:mga00v17_79074_c1_274_1278 316
650 iso_pu_bacteria 2585427591 2585830406 316
651 iso_pu_bacteria 2585427592 2585831938 316
652 iso_pu_bacteria 2667528173 2671110094 316
653 iso_pu_bacteria 2904474040 2904478955 316
654 iso_pu_bacteria 2904504865 2904504914 316
655 iso_pu_bacteria 2919150387 2919155063 316
656 iso_pu_bacteria 2927143783 2927148646 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

195

0.97

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

246

313

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9031 12 253
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9002 11 247
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.8755 10 253
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.8693 9 250
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.8649 10 243
ID Description Score Start End Superfamily
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9764 9 315 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.946 9 315 3.40.50.300
af_Q2FZR0_1_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9454 9 311 3.40.50.300
af_I6Y482_280_547_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9293 11 254 3.40.50.300
af_P33916_272_529_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.925 9 248 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D0NJ34-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.9747 144 312 GO:0005524
GO:0015833
GO:0016887
AF-A0A365UU64-F1-model_v4 deleted 0.95 138 253
AF-A0A3D0NJ34-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.947 144 312 GO:0005524
GO:0015833
GO:0016887
AF-A0A259PZD2-F1-model_v4 ABC transporter ATP-binding protein 0.9465 124 249 GO:0005524
GO:0016887
AF-A0A845DDU1-F1-model_v4 ABC transporter ATP-binding protein 0.9409 117 311 GO:0005524
GO:0015833
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.8 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map