F472905
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 655 | 236 | 655 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100606528|Ga0070659_1006065281 |
| Length | 218 |
| Sequence | MSRTLIIGDIHGCFDELSALLEVFKPEHEDRVVAVGDLTVKGPKSRDVLELFMADARFSSVIGNHDFALVKHYRHGHKLKASQARVFDQLRTNDDRYLKFLESLPFLLQVGESVVVHAGLRPGVELGSQSKDDLIELRTLGEDRTDRSGTPWYQEYVGPMAVFGHWPSSEPRRGQFALGIDSGCVYGYELTGYIPEYGEFLKVPALMAYAPSTSNVQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 207 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 208 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 209 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 213 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 214 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 216 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 217 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 221 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 225 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 227 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.22 |
| Rhizosphere | 98.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_6662657 | 2162886011 | Bacteria | 929 |
| 2 | JGI24030J14995_100098 | 3300001426 | Unclassified | 2046 |
| 3 | JGI24034J14986_100037 | 3300001432 | Bacteria | 4793 |
| 4 | JGI24748J21848_1000007 | 3300002074 | Bacteria | 208838 |
| 5 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 6 | JGI24742J22300_10002227 | 3300002244 | Unclassified | 3093 |
| 7 | Ga0065714_10002198 | 3300005288 | Bacteria | 90565 |
| 8 | Ga0065704_10091881 | 3300005289 | Unclassified | 2688 |
| 9 | Ga0065704_10322250 | 3300005289 | Unclassified | 851 |
| 10 | Ga0065712_10000119 | 3300005290 | Bacteria | 137052 |
| 11 | Ga0065712_10098197 | 3300005290 | Bacteria | 2127 |
| 12 | Ga0065712_10300032 | 3300005290 | Bacteria | 862 |
| 13 | Ga0065715_10002770 | 3300005293 | Bacteria | 6344 |
| 14 | Ga0065715_10021680 | 3300005293 | Bacteria | 1857 |
| 15 | Ga0065715_10089354 | 3300005293 | Bacteria | 10947 |
| 16 | Ga0065715_10091482 | 3300005293 | Bacteria | 5762 |
| 17 | Ga0065715_10233599 | 3300005293 | Bacteria | 1225 |
| 18 | Ga0065707_10087432 | 3300005295 | Bacteria | 5028 |
| 19 | Ga0065707_10247255 | 3300005295 | Bacteria | 1136 |
| 20 | Ga0065707_10275915 | 3300005295 | Bacteria | 1028 |
| 21 | Ga0065707_10367904 | 3300005295 | Bacteria | 894 |
| 22 | Ga0070676_10030711 | 3300005328 | Unclassified | 3066 |
| 23 | Ga0070676_10322528 | 3300005328 | Bacteria | 1054 |
| 24 | Ga0070676_10356902 | 3300005328 | Unclassified | 1006 |
| 25 | Ga0070690_100028362 | 3300005330 | Bacteria | 3466 |
| 26 | Ga0070690_100033304 | 3300005330 | Bacteria | 3224 |
| 27 | Ga0070690_100046197 | 3300005330 | Bacteria | 2768 |
| 28 | Ga0070690_100227703 | 3300005330 | Bacteria | 1309 |
| 29 | Ga0070690_100317039 | 3300005330 | Unclassified | 1122 |
| 30 | Ga0070670_100001298 | 3300005331 | Bacteria | 19897 |
| 31 | Ga0070670_100054717 | 3300005331 | Bacteria | 3426 |
| 32 | Ga0070670_100067484 | 3300005331 | Unclassified | 3069 |
| 33 | Ga0070670_100297161 | 3300005331 | Bacteria | 1412 |
| 34 | Ga0068869_100007326 | 3300005334 | Bacteria | 7038 |
| 35 | Ga0068869_100050973 | 3300005334 | Viruses | 3002 |
| 36 | Ga0068869_100070758 | 3300005334 | Bacteria | 2582 |
| 37 | Ga0068869_100247901 | 3300005334 | Unclassified | 1421 |
| 38 | Ga0068869_100304080 | 3300005334 | Bacteria | 1289 |
| 39 | Ga0068869_100481406 | 3300005334 | Bacteria | 1033 |
| 40 | Ga0070680_100004282 | 3300005336 | Bacteria | 10720 |
| 41 | Ga0070680_100029267 | 3300005336 | Unclassified | 4424 |
| 42 | Ga0070680_100403826 | 3300005336 | Unclassified | 1165 |
| 43 | Ga0070682_100000521 | 3300005337 | Bacteria | 24093 |
| 44 | Ga0070682_100006312 | 3300005337 | Bacteria | 6653 |
| 45 | Ga0070682_100082304 | 3300005337 | Bacteria | 2086 |
| 46 | Ga0070682_100168847 | 3300005337 | Unclassified | 1518 |
| 47 | Ga0068868_100205647 | 3300005338 | Bacteria | 1643 |
| 48 | Ga0070660_100151453 | 3300005339 | Unclassified | 1865 |
| 49 | Ga0070689_100365371 | 3300005340 | Bacteria | 1213 |
| 50 | Ga0070691_10361503 | 3300005341 | Unclassified | 809 |
| 51 | Ga0070687_100001368 | 3300005343 | Bacteria | 8535 |
| 52 | Ga0070687_100130872 | 3300005343 | Bacteria | 1448 |
| 53 | Ga0070687_100298848 | 3300005343 | Bacteria | 1021 |
| 54 | Ga0070687_100447059 | 3300005343 | Unclassified | 859 |
| 55 | Ga0070661_100039632 | 3300005344 | Unclassified | 3433 |
| 56 | Ga0070692_10043655 | 3300005345 | Bacteria | 2306 |
| 57 | Ga0070692_10052574 | 3300005345 | Bacteria | 2122 |
| 58 | Ga0070692_10376916 | 3300005345 | Unclassified | 889 |
| 59 | Ga0070669_100014746 | 3300005353 | Bacteria | 5565 |
| 60 | Ga0070669_100133471 | 3300005353 | Bacteria | 1907 |
| 61 | Ga0070675_100254440 | 3300005354 | Bacteria | 1538 |
| 62 | Ga0070675_100524024 | 3300005354 | Unclassified | 1069 |
| 63 | Ga0070675_100613685 | 3300005354 | Bacteria | 987 |
| 64 | Ga0070675_100753690 | 3300005354 | Bacteria | 888 |
| 65 | Ga0070671_100063676 | 3300005355 | Unclassified | 3071 |
| 66 | Ga0070671_100117814 | 3300005355 | Bacteria | 2233 |
| 67 | Ga0070671_100232866 | 3300005355 | Bacteria | 1563 |
| 68 | Ga0070674_100084459 | 3300005356 | Bacteria | 2277 |
| 69 | Ga0070674_100377721 | 3300005356 | Bacteria | 1152 |
| 70 | Ga0070673_100019174 | 3300005364 | Bacteria | 4908 |
| 71 | Ga0070673_100031146 | 3300005364 | Bacteria | 4000 |
| 72 | Ga0070673_100032156 | 3300005364 | Bacteria | 3946 |
| 73 | Ga0070673_100060934 | 3300005364 | Bacteria | 2992 |
| 74 | Ga0070673_100177265 | 3300005364 | Bacteria | 1823 |
| 75 | Ga0070673_100343711 | 3300005364 | Unclassified | 1323 |
| 76 | Ga0070673_100441298 | 3300005364 | Unclassified | 1170 |
| 77 | Ga0070659_100003236 | 3300005366 | Bacteria | 11592 |
| 78 | Ga0070659_100606528 | 3300005366 | Bacteria | 941 |
| 79 | Ga0070667_100075838 | 3300005367 | Bacteria | 2871 |
| 80 | Ga0070667_100308962 | 3300005367 | Bacteria | 1425 |
| 81 | Ga0070703_10000049 | 3300005406 | Bacteria | 58073 |
| 82 | Ga0070703_10024402 | 3300005406 | Bacteria | 1787 |
| 83 | Ga0070701_10067337 | 3300005438 | Bacteria | 1905 |
| 84 | Ga0070701_10075517 | 3300005438 | Unclassified | 1812 |
| 85 | Ga0070705_100037158 | 3300005440 | Bacteria | 2744 |
| 86 | Ga0070705_100044060 | 3300005440 | Bacteria | 2561 |
| 87 | Ga0070705_100065375 | 3300005440 | Bacteria | 2177 |
| 88 | Ga0070705_100320810 | 3300005440 | Unclassified | 1118 |
| 89 | Ga0070705_100549702 | 3300005440 | Unclassified | 885 |
| 90 | Ga0070700_100001165 | 3300005441 | Bacteria | 12994 |
| 91 | Ga0070700_100072607 | 3300005441 | Bacteria | 2200 |
| 92 | Ga0070700_100079056 | 3300005441 | Bacteria | 2119 |
| 93 | Ga0070694_100009560 | 3300005444 | Bacteria | 5948 |
| 94 | Ga0070694_100021942 | 3300005444 | Bacteria | 4087 |
| 95 | Ga0070694_100025088 | 3300005444 | Unclassified | 3855 |
| 96 | Ga0070694_100049054 | 3300005444 | Bacteria | 2842 |
| 97 | Ga0070694_100170601 | 3300005444 | Bacteria | 1603 |
| 98 | Ga0070694_100487308 | 3300005444 | Unclassified | 979 |
| 99 | Ga0070708_100001024 | 3300005445 | Bacteria | 21275 |
| 100 | Ga0070708_100045110 | 3300005445 | Unclassified | 3882 |
| 101 | Ga0070678_100175863 | 3300005456 | Bacteria | 1748 |
| 102 | Ga0070662_100256599 | 3300005457 | Unclassified | 1407 |
| 103 | Ga0070662_100290627 | 3300005457 | Bacteria | 1325 |
| 104 | Ga0070662_100296969 | 3300005457 | Unclassified | 1311 |
| 105 | Ga0070662_100345919 | 3300005457 | Unclassified | 1217 |
| 106 | Ga0070662_100581101 | 3300005457 | Bacteria | 941 |
| 107 | Ga0070681_10000383 | 3300005458 | Bacteria | 35789 |
| 108 | Ga0070681_10001279 | 3300005458 | Bacteria | 21955 |
| 109 | Ga0068867_100002030 | 3300005459 | Bacteria | 14153 |
| 110 | Ga0068867_100043408 | 3300005459 | Bacteria | 3292 |
| 111 | Ga0068867_100047363 | 3300005459 | Bacteria | 3160 |
| 112 | Ga0070706_100000001 | 3300005467 | Bacteria | 342302 |
| 113 | Ga0070706_100003314 | 3300005467 | Bacteria | 15900 |
| 114 | Ga0070706_100013408 | 3300005467 | Bacteria | 7577 |
| 115 | Ga0070707_100003580 | 3300005468 | Bacteria | 14649 |
| 116 | Ga0070707_100009936 | 3300005468 | Bacteria | 8856 |
| 117 | Ga0070707_100693397 | 3300005468 | Unclassified | 981 |
| 118 | Ga0070698_100011527 | 3300005471 | Bacteria | 9381 |
| 119 | Ga0070698_100019886 | 3300005471 | Bacteria | 7042 |
| 120 | Ga0070698_100026115 | 3300005471 | Bacteria | 6082 |
| 121 | Ga0070698_100026461 | 3300005471 | Bacteria | 6039 |
| 122 | Ga0070699_100007970 | 3300005518 | Bacteria | 9197 |
| 123 | Ga0070699_100010521 | 3300005518 | Bacteria | 8003 |
| 124 | Ga0070699_100038258 | 3300005518 | Bacteria | 4153 |
| 125 | Ga0070699_100048193 | 3300005518 | Bacteria | 3687 |
| 126 | Ga0070699_100070986 | 3300005518 | Unclassified | 3028 |
| 127 | Ga0070699_100092479 | 3300005518 | Bacteria | 2646 |
| 128 | Ga0070699_100433750 | 3300005518 | Bacteria | 1190 |
| 129 | Ga0070699_100600418 | 3300005518 | Bacteria | 1003 |
| 130 | Ga0070699_100763800 | 3300005518 | Unclassified | 884 |
| 131 | Ga0070699_100991659 | 3300005518 | Unclassified | 770 |
| 132 | Ga0070679_100002107 | 3300005530 | Bacteria | 17921 |
| 133 | Ga0070679_100068148 | 3300005530 | Unclassified | 3549 |
| 134 | Ga0070684_100768561 | 3300005535 | Unclassified | 900 |
| 135 | Ga0070697_100000438 | 3300005536 | Bacteria | 31877 |
| 136 | Ga0070697_100002186 | 3300005536 | Bacteria | 15001 |
| 137 | Ga0070697_100009933 | 3300005536 | Bacteria | 7423 |
| 138 | Ga0070697_100074800 | 3300005536 | Bacteria | 2784 |
| 139 | Ga0070697_100094787 | 3300005536 | Bacteria | 2474 |
| 140 | Ga0070697_100230167 | 3300005536 | Unclassified | 1581 |
| 141 | Ga0070697_100716426 | 3300005536 | Unclassified | 883 |
| 142 | Ga0070697_100967023 | 3300005536 | Bacteria | 756 |
| 143 | Ga0068853_100020464 | 3300005539 | Bacteria | 5502 |
| 144 | Ga0068853_100345488 | 3300005539 | Bacteria | 1383 |
| 145 | Ga0070672_100412207 | 3300005543 | Bacteria | 1159 |
| 146 | Ga0070672_100438337 | 3300005543 | Bacteria | 1124 |
| 147 | Ga0070686_100001507 | 3300005544 | Bacteria | 13100 |
| 148 | Ga0070686_100049648 | 3300005544 | Bacteria | 2663 |
| 149 | Ga0070686_100156706 | 3300005544 | Bacteria | 1600 |
| 150 | Ga0070686_100219885 | 3300005544 | Bacteria | 1372 |
| 151 | Ga0070695_100042394 | 3300005545 | Bacteria | 2889 |
| 152 | Ga0070695_100071804 | 3300005545 | Bacteria | 2268 |
| 153 | Ga0070695_100076985 | 3300005545 | Bacteria | 2197 |
| 154 | Ga0070695_100107704 | 3300005545 | Bacteria | 1886 |
| 155 | Ga0070695_100137801 | 3300005545 | Bacteria | 1689 |
| 156 | Ga0070695_100412779 | 3300005545 | Bacteria | 1026 |
| 157 | Ga0070695_100641558 | 3300005545 | Unclassified | 838 |
| 158 | Ga0070696_100029427 | 3300005546 | Bacteria | 3754 |
| 159 | Ga0070696_100040019 | 3300005546 | Bacteria | 3236 |
| 160 | Ga0070696_100040419 | 3300005546 | Unclassified | 3220 |
| 161 | Ga0070696_100041611 | 3300005546 | Bacteria | 3174 |
| 162 | Ga0070696_100082236 | 3300005546 | Bacteria | 2283 |
| 163 | Ga0070696_100281601 | 3300005546 | Bacteria | 1268 |
| 164 | Ga0070696_100311083 | 3300005546 | Unclassified | 1209 |
| 165 | Ga0070696_100396663 | 3300005546 | Unclassified | 1078 |
| 166 | Ga0070696_100649982 | 3300005546 | Unclassified | 855 |
| 167 | Ga0070693_100042517 | 3300005547 | Bacteria | 2560 |
| 168 | Ga0070693_100074871 | 3300005547 | Bacteria | 2003 |
| 169 | Ga0070693_100103332 | 3300005547 | Bacteria | 1740 |
| 170 | Ga0070693_100237665 | 3300005547 | Unclassified | 1202 |
| 171 | Ga0070693_100433314 | 3300005547 | Archaea | 919 |
| 172 | Ga0070693_100458543 | 3300005547 | Unclassified | 896 |
| 173 | Ga0070704_100003983 | 3300005549 | Bacteria | 8517 |
| 174 | Ga0070704_100039745 | 3300005549 | Unclassified | 3232 |
| 175 | Ga0070704_100064854 | 3300005549 | Bacteria | 2627 |
| 176 | Ga0070704_100238957 | 3300005549 | Unclassified | 1486 |
| 177 | Ga0068855_100748904 | 3300005563 | Bacteria | 1042 |
| 178 | Ga0070664_100025486 | 3300005564 | Unclassified | 4902 |
| 179 | Ga0070664_100209453 | 3300005564 | Bacteria | 1742 |
| 180 | Ga0070664_100241183 | 3300005564 | Bacteria | 1623 |
| 181 | Ga0070664_100666061 | 3300005564 | Bacteria | 968 |
| 182 | Ga0068857_100026078 | 3300005577 | Bacteria | 5148 |
| 183 | Ga0068857_100166074 | 3300005577 | Unclassified | 2004 |
| 184 | Ga0068857_100179938 | 3300005577 | Bacteria | 1924 |
| 185 | Ga0068854_100091220 | 3300005578 | Unclassified | 2267 |
| 186 | Ga0068854_100142830 | 3300005578 | Bacteria | 1839 |
| 187 | Ga0068856_100161748 | 3300005614 | Bacteria | 2249 |
| 188 | Ga0070702_100022160 | 3300005615 | Bacteria | 3354 |
| 189 | Ga0070702_100038912 | 3300005615 | Bacteria | 2652 |
| 190 | Ga0068852_100921477 | 3300005616 | Bacteria | 891 |
| 191 | Ga0068859_100004986 | 3300005617 | Bacteria | 13486 |
| 192 | Ga0068859_100007834 | 3300005617 | Bacteria | 10840 |
| 193 | Ga0068859_100030949 | 3300005617 | Bacteria | 5370 |
| 194 | Ga0068859_100043818 | 3300005617 | Bacteria | 4497 |
| 195 | Ga0068859_100053437 | 3300005617 | Bacteria | 4063 |
| 196 | Ga0068859_100070457 | 3300005617 | Bacteria | 3532 |
| 197 | Ga0068859_100291040 | 3300005617 | Bacteria | 1726 |
| 198 | Ga0068859_100325190 | 3300005617 | Bacteria | 1632 |
| 199 | Ga0068859_100429032 | 3300005617 | Unclassified | 1418 |
| 200 | Ga0068859_100512795 | 3300005617 | Archaea | 1294 |
| 201 | Ga0068859_100925601 | 3300005617 | Unclassified | 956 |
| 202 | Ga0068864_100002803 | 3300005618 | Bacteria | 14392 |
| 203 | Ga0068864_100046763 | 3300005618 | Bacteria | 3714 |
| 204 | Ga0068864_100067259 | 3300005618 | Bacteria | 3111 |
| 205 | Ga0068864_100123535 | 3300005618 | Bacteria | 2317 |
| 206 | Ga0068864_100168970 | 3300005618 | Unclassified | 1993 |
| 207 | Ga0068864_100352024 | 3300005618 | Bacteria | 1390 |
| 208 | Ga0068864_100536228 | 3300005618 | Bacteria | 1130 |
| 209 | Ga0068866_10015098 | 3300005718 | Bacteria | 3425 |
| 210 | Ga0068866_10121782 | 3300005718 | Bacteria | 1471 |
| 211 | Ga0068861_100015997 | 3300005719 | Bacteria | 5297 |
| 212 | Ga0068861_100017383 | 3300005719 | Bacteria | 5104 |
| 213 | Ga0068861_100059993 | 3300005719 | Unclassified | 2914 |
| 214 | Ga0068861_100125852 | 3300005719 | Bacteria | 2073 |
| 215 | Ga0068861_100302988 | 3300005719 | Unclassified | 1385 |
| 216 | Ga0068861_100456270 | 3300005719 | Bacteria | 1146 |
| 217 | Ga0068861_100668036 | 3300005719 | Unclassified | 962 |
| 218 | Ga0068861_101145717 | 3300005719 | Unclassified | 749 |
| 219 | Ga0068851_10001177 | 3300005834 | Bacteria | 11357 |
| 220 | Ga0068870_10082607 | 3300005840 | Bacteria | 1779 |
| 221 | Ga0068870_10249820 | 3300005840 | Bacteria | 1099 |
| 222 | Ga0068870_10288525 | 3300005840 | Bacteria | 1031 |
| 223 | Ga0068870_10476098 | 3300005840 | Bacteria | 828 |
| 224 | Ga0068863_100068448 | 3300005841 | Bacteria | 3358 |
| 225 | Ga0068863_100075068 | 3300005841 | Bacteria | 3199 |
| 226 | Ga0068863_100515056 | 3300005841 | Unclassified | 1179 |
| 227 | Ga0068863_100679330 | 3300005841 | Unclassified | 1022 |
| 228 | Ga0068858_100001261 | 3300005842 | Bacteria | 26203 |
| 229 | Ga0068858_100022386 | 3300005842 | Bacteria | 5900 |
| 230 | Ga0068858_100041574 | 3300005842 | Unclassified | 4261 |
| 231 | Ga0068858_100230639 | 3300005842 | Bacteria | 1755 |
| 232 | Ga0068858_100356497 | 3300005842 | Bacteria | 1401 |
| 233 | Ga0068858_100473940 | 3300005842 | Bacteria | 1208 |
| 234 | Ga0068860_100236051 | 3300005843 | Bacteria | 1778 |
| 235 | Ga0068860_100303500 | 3300005843 | Bacteria | 1564 |
| 236 | Ga0068860_101417076 | 3300005843 | Bacteria | 716 |
| 237 | Ga0068862_100029025 | 3300005844 | Bacteria | 4660 |
| 238 | Ga0068862_100238054 | 3300005844 | Unclassified | 1654 |
| 239 | Ga0068862_100599792 | 3300005844 | Bacteria | 1057 |
| 240 | Ga0081539_10000898 | 3300005985 | Bacteria | 56680 |
| 241 | Ga0097621_100008185 | 3300006237 | Bacteria | 7520 |
| 242 | Ga0068871_100002467 | 3300006358 | Bacteria | 12633 |
| 243 | Ga0068871_100009395 | 3300006358 | Bacteria | 7083 |
| 244 | Ga0068871_100559521 | 3300006358 | Unclassified | 1036 |
| 245 | Ga0068871_100600614 | 3300006358 | Bacteria | 1001 |
| 246 | Ga0075428_100306290 | 3300006844 | Unclassified | 1708 |
| 247 | Ga0075428_100342300 | 3300006844 | Bacteria | 1605 |
| 248 | Ga0075428_100864419 | 3300006844 | Bacteria | 960 |
| 249 | Ga0075428_100906089 | 3300006844 | Bacteria | 935 |
| 250 | Ga0075430_100226825 | 3300006846 | Bacteria | 1549 |
| 251 | Ga0075430_100250246 | 3300006846 | Bacteria | 1468 |
| 252 | Ga0075430_100436073 | 3300006846 | Bacteria | 1081 |
| 253 | Ga0075431_100005951 | 3300006847 | Bacteria | 12072 |
| 254 | Ga0075431_100108057 | 3300006847 | Bacteria | 2871 |
| 255 | Ga0075431_100128547 | 3300006847 | Bacteria | 2614 |
| 256 | Ga0075433_10020523 | 3300006852 | Bacteria | 5527 |
| 257 | Ga0075433_10028353 | 3300006852 | Bacteria | 4759 |
| 258 | Ga0075433_10053421 | 3300006852 | Bacteria | 3522 |
| 259 | Ga0075433_10072374 | 3300006852 | Bacteria | 3030 |
| 260 | Ga0075433_10089846 | 3300006852 | Bacteria | 2715 |
| 261 | Ga0075433_10139844 | 3300006852 | Unclassified | 2152 |
| 262 | Ga0075433_10610270 | 3300006852 | Bacteria | 958 |
| 263 | Ga0075434_100018537 | 3300006871 | Bacteria | 6725 |
| 264 | Ga0075434_100028680 | 3300006871 | Bacteria | 5472 |
| 265 | Ga0075434_100106418 | 3300006871 | Bacteria | 2815 |
| 266 | Ga0075434_101278631 | 3300006871 | Unclassified | 745 |
| 267 | Ga0075429_100040092 | 3300006880 | Bacteria | 4077 |
| 268 | Ga0075429_100091303 | 3300006880 | Bacteria | 2657 |
| 269 | Ga0068865_100030351 | 3300006881 | Bacteria | 3595 |
| 270 | Ga0075436_100008947 | 3300006914 | Bacteria | 6854 |
| 271 | Ga0097620_100004986 | 3300006931 | Bacteria | 13486 |
| 272 | Ga0097620_100007834 | 3300006931 | Bacteria | 10840 |
| 273 | Ga0097620_100030950 | 3300006931 | Bacteria | 5370 |
| 274 | Ga0097620_100043818 | 3300006931 | Bacteria | 4497 |
| 275 | Ga0097620_100053440 | 3300006931 | Bacteria | 4063 |
| 276 | Ga0097620_100070455 | 3300006931 | Bacteria | 3532 |
| 277 | Ga0097620_100291033 | 3300006931 | Bacteria | 1726 |
| 278 | Ga0097620_100302886 | 3300006931 | Unclassified | 1692 |
| 279 | Ga0097620_100325194 | 3300006931 | Bacteria | 1632 |
| 280 | Ga0097620_100429000 | 3300006931 | Unclassified | 1418 |
| 281 | Ga0097620_100512794 | 3300006931 | Archaea | 1294 |
| 282 | Ga0097620_100925707 | 3300006931 | Unclassified | 956 |
| 283 | Ga0075435_100209617 | 3300007076 | Bacteria | 1653 |
| 284 | Ga0075435_100209643 | 3300007076 | Bacteria | 1653 |
| 285 | Ga0099794_10144467 | 3300007265 | Bacteria | 1206 |
| 286 | Ga0099795_10187434 | 3300007788 | Bacteria | 867 |
| 287 | Ga0105240_10063290 | 3300009093 | Bacteria | 4602 |
| 288 | Ga0111539_10004471 | 3300009094 | Bacteria | 18282 |
| 289 | Ga0111539_10061895 | 3300009094 | Unclassified | 4433 |
| 290 | Ga0111539_10178567 | 3300009094 | Unclassified | 2480 |
| 291 | Ga0111539_10251650 | 3300009094 | Bacteria | 2057 |
| 292 | Ga0111539_10345936 | 3300009094 | Unclassified | 1731 |
| 293 | Ga0105245_10015028 | 3300009098 | Bacteria | 6746 |
| 294 | Ga0105245_10803055 | 3300009098 | Bacteria | 979 |
| 295 | Ga0105245_10998986 | 3300009098 | Unclassified | 881 |
| 296 | Ga0105245_11151096 | 3300009098 | Bacteria | 823 |
| 297 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 298 | Ga0105247_10060962 | 3300009101 | Bacteria | 2339 |
| 299 | Ga0105247_10327482 | 3300009101 | Unclassified | 1071 |
| 300 | Ga0114129_10003333 | 3300009147 | Bacteria | 22577 |
| 301 | Ga0114129_10038702 | 3300009147 | Bacteria | 6725 |
| 302 | Ga0114129_10061731 | 3300009147 | Bacteria | 5238 |
| 303 | Ga0114129_10131197 | 3300009147 | Bacteria | 3441 |
| 304 | Ga0114129_10232270 | 3300009147 | Bacteria | 2484 |
| 305 | Ga0114129_10386533 | 3300009147 | Bacteria | 1847 |
| 306 | Ga0114129_10703202 | 3300009147 | Bacteria | 1299 |
| 307 | Ga0114129_11005074 | 3300009147 | Unclassified | 1050 |
| 308 | Ga0114129_11007422 | 3300009147 | Bacteria | 1049 |
| 309 | Ga0114129_11136260 | 3300009147 | Unclassified | 976 |
| 310 | Ga0105243_10000124 | 3300009148 | Bacteria | 87031 |
| 311 | Ga0105243_10000436 | 3300009148 | Bacteria | 43715 |
| 312 | Ga0105243_10003913 | 3300009148 | Bacteria | 11886 |
| 313 | Ga0105243_10049750 | 3300009148 | Bacteria | 3308 |
| 314 | Ga0105243_10114163 | 3300009148 | Bacteria | 2266 |
| 315 | Ga0105243_10383468 | 3300009148 | Bacteria | 1301 |
| 316 | Ga0105243_10625560 | 3300009148 | Bacteria | 1040 |
| 317 | Ga0105241_10071258 | 3300009174 | Bacteria | 2698 |
| 318 | Ga0105241_10250662 | 3300009174 | Bacteria | 1501 |
| 319 | Ga0105241_10529459 | 3300009174 | Unclassified | 1055 |
| 320 | Ga0105242_10000021 | 3300009176 | Bacteria | 115541 |
| 321 | Ga0105242_10006988 | 3300009176 | Bacteria | 8713 |
| 322 | Ga0105242_10114474 | 3300009176 | Bacteria | 2305 |
| 323 | Ga0105242_10271146 | 3300009176 | Unclassified | 1537 |
| 324 | Ga0105242_10841082 | 3300009176 | Bacteria | 912 |
| 325 | Ga0105248_10005805 | 3300009177 | Bacteria | 13569 |
| 326 | Ga0105248_10032138 | 3300009177 | Bacteria | 5865 |
| 327 | Ga0105248_10069315 | 3300009177 | Bacteria | 3959 |
| 328 | Ga0105248_10083368 | 3300009177 | Unclassified | 3596 |
| 329 | Ga0105237_10006578 | 3300009545 | Bacteria | 12857 |
| 330 | Ga0105237_10039930 | 3300009545 | Bacteria | 4734 |
| 331 | Ga0105238_10618827 | 3300009551 | Bacteria | 1091 |
| 332 | Ga0105249_10042347 | 3300009553 | Bacteria | 4141 |
| 333 | Ga0105249_10174569 | 3300009553 | Unclassified | 2086 |
| 334 | Ga0105249_10196432 | 3300009553 | Bacteria | 1972 |
| 335 | Ga0105249_10225350 | 3300009553 | Bacteria | 1847 |
| 336 | Ga0105249_10538463 | 3300009553 | Bacteria | 1217 |
| 337 | Ga0105249_10595220 | 3300009553 | Bacteria | 1160 |
| 338 | Ga0105249_10597823 | 3300009553 | Bacteria | 1158 |
| 339 | Ga0105249_11332280 | 3300009553 | Unclassified | 790 |
| 340 | Ga0099796_10070306 | 3300010159 | Unclassified | 1262 |
| 341 | Ga0105239_10043879 | 3300010375 | Bacteria | 4903 |
| 342 | Ga0105239_10090240 | 3300010375 | Unclassified | 3381 |
| 343 | Ga0105239_11057616 | 3300010375 | Bacteria | 934 |
| 344 | Ga0105239_11175605 | 3300010375 | Unclassified | 884 |
| 345 | Ga0105246_10163841 | 3300011119 | Archaea | 1696 |
| 346 | Ga0105246_10190435 | 3300011119 | Unclassified | 1587 |
| 347 | Ga0105246_10400791 | 3300011119 | Bacteria | 1139 |
| 348 | Ga0157373_10238865 | 3300013100 | Bacteria | 1284 |
| 349 | Ga0157374_10082843 | 3300013296 | Bacteria | 3046 |
| 350 | Ga0157374_10135832 | 3300013296 | Bacteria | 2384 |
| 351 | Ga0157378_10000379 | 3300013297 | Bacteria | 43998 |
| 352 | Ga0157378_10013290 | 3300013297 | Bacteria | 7199 |
| 353 | Ga0157378_10013296 | 3300013297 | Bacteria | 7197 |
| 354 | Ga0157378_10013817 | 3300013297 | Bacteria | 7060 |
| 355 | Ga0157378_10019504 | 3300013297 | Bacteria | 5962 |
| 356 | Ga0157378_10019839 | 3300013297 | Bacteria | 5910 |
| 357 | Ga0157378_10064345 | 3300013297 | Bacteria | 3280 |
| 358 | Ga0157378_10094716 | 3300013297 | Bacteria | 2719 |
| 359 | Ga0157378_10131278 | 3300013297 | Bacteria | 2319 |
| 360 | Ga0157378_10390138 | 3300013297 | Bacteria | 1369 |
| 361 | Ga0157378_10480197 | 3300013297 | Unclassified | 1238 |
| 362 | Ga0163162_10012958 | 3300013306 | Bacteria | 8138 |
| 363 | Ga0163162_10016077 | 3300013306 | Bacteria | 7315 |
| 364 | Ga0163162_10023010 | 3300013306 | Bacteria | 6145 |
| 365 | Ga0163162_10164920 | 3300013306 | Unclassified | 2339 |
| 366 | Ga0163162_10279213 | 3300013306 | Bacteria | 1802 |
| 367 | Ga0163162_11009000 | 3300013306 | Bacteria | 941 |
| 368 | Ga0157372_10045651 | 3300013307 | Bacteria | 4861 |
| 369 | Ga0157372_10069140 | 3300013307 | Unclassified | 3972 |
| 370 | Ga0157372_10115325 | 3300013307 | Bacteria | 3080 |
| 371 | Ga0157375_10007377 | 3300013308 | Bacteria | 9625 |
| 372 | Ga0157375_10021696 | 3300013308 | Bacteria | 5895 |
| 373 | Ga0157375_10114446 | 3300013308 | Unclassified | 2799 |
| 374 | Ga0157375_10187707 | 3300013308 | Unclassified | 2221 |
| 375 | Ga0157375_10366866 | 3300013308 | Bacteria | 1606 |
| 376 | Ga0163163_10008020 | 3300014325 | Bacteria | 9349 |
| 377 | Ga0163163_10012225 | 3300014325 | Bacteria | 7814 |
| 378 | Ga0163163_10028251 | 3300014325 | Bacteria | 5384 |
| 379 | Ga0163163_10048588 | 3300014325 | Bacteria | 4173 |
| 380 | Ga0163163_10115085 | 3300014325 | Bacteria | 2721 |
| 381 | Ga0163163_11073599 | 3300014325 | Unclassified | 868 |
| 382 | Ga0157380_10001291 | 3300014326 | Bacteria | 16301 |
| 383 | Ga0157380_10001861 | 3300014326 | Bacteria | 13957 |
| 384 | Ga0157380_10031640 | 3300014326 | Bacteria | 4064 |
| 385 | Ga0157380_10081331 | 3300014326 | Bacteria | 2649 |
| 386 | Ga0157380_10212352 | 3300014326 | Unclassified | 1725 |
| 387 | Ga0157380_10361450 | 3300014326 | Unclassified | 1362 |
| 388 | Ga0157377_10022713 | 3300014745 | Bacteria | 3317 |
| 389 | Ga0157377_10028162 | 3300014745 | Bacteria | 3022 |
| 390 | Ga0157377_10216200 | 3300014745 | Unclassified | 1225 |
| 391 | Ga0157379_10180486 | 3300014968 | Unclassified | 1907 |
| 392 | Ga0157379_10266429 | 3300014968 | Unclassified | 1557 |
| 393 | Ga0157379_10499591 | 3300014968 | Bacteria | 1127 |
| 394 | Ga0157379_10862066 | 3300014968 | Bacteria | 857 |
| 395 | Ga0157376_10030500 | 3300014969 | Bacteria | 4306 |
| 396 | Ga0157376_10158248 | 3300014969 | Bacteria | 2051 |
| 397 | Ga0163161_10026181 | 3300017792 | Unclassified | 4132 |
| 398 | Ga0163161_10081320 | 3300017792 | Bacteria | 2385 |
| 399 | Ga0213876_10083750 | 3300021384 | Bacteria | 1687 |
| 400 | Ga0207672_1000795 | 3300025223 | Unclassified | 3367 |
| 401 | Ga0207697_10005901 | 3300025315 | Bacteria | 5624 |
| 402 | Ga0207656_10019923 | 3300025321 | Bacteria | 2658 |
| 403 | Ga0207653_10000163 | 3300025885 | Bacteria | 47337 |
| 404 | Ga0207653_10000825 | 3300025885 | Bacteria | 10338 |
| 405 | Ga0207653_10032887 | 3300025885 | Bacteria | 1679 |
| 406 | Ga0207653_10054182 | 3300025885 | Bacteria | 1341 |
| 407 | Ga0207682_10129840 | 3300025893 | Bacteria | 1124 |
| 408 | Ga0207642_10033642 | 3300025899 | Bacteria | 2171 |
| 409 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 410 | Ga0207710_10021224 | 3300025900 | Bacteria | 2781 |
| 411 | Ga0207688_10041601 | 3300025901 | Bacteria | 2557 |
| 412 | Ga0207680_10076168 | 3300025903 | Bacteria | 2094 |
| 413 | Ga0207647_10141864 | 3300025904 | Unclassified | 1408 |
| 414 | Ga0207699_10369802 | 3300025906 | Bacteria | 1016 |
| 415 | Ga0207645_10067496 | 3300025907 | Bacteria | 2286 |
| 416 | Ga0207645_10234079 | 3300025907 | Bacteria | 1213 |
| 417 | Ga0207645_10297052 | 3300025907 | Bacteria | 1075 |
| 418 | Ga0207643_10025868 | 3300025908 | Unclassified | 3246 |
| 419 | Ga0207643_10239787 | 3300025908 | Bacteria | 1114 |
| 420 | Ga0207684_10000286 | 3300025910 | Bacteria | 72634 |
| 421 | Ga0207684_10010256 | 3300025910 | Bacteria | 8247 |
| 422 | Ga0207684_10016170 | 3300025910 | Bacteria | 6411 |
| 423 | Ga0207684_10030630 | 3300025910 | Unclassified | 4579 |
| 424 | Ga0207654_10021362 | 3300025911 | Bacteria | 3442 |
| 425 | Ga0207654_10456738 | 3300025911 | Unclassified | 896 |
| 426 | Ga0207707_10000080 | 3300025912 | Bacteria | 96693 |
| 427 | Ga0207707_10071957 | 3300025912 | Bacteria | 3014 |
| 428 | Ga0207695_10104060 | 3300025913 | Bacteria | 2829 |
| 429 | Ga0207671_10009947 | 3300025914 | Bacteria | 7903 |
| 430 | Ga0207671_10217838 | 3300025914 | Bacteria | 1495 |
| 431 | Ga0207660_10026610 | 3300025917 | Bacteria | 3940 |
| 432 | Ga0207660_10137816 | 3300025917 | Bacteria | 1863 |
| 433 | Ga0207660_10463937 | 3300025917 | Unclassified | 1025 |
| 434 | Ga0207662_10006191 | 3300025918 | Bacteria | 6442 |
| 435 | Ga0207662_10146668 | 3300025918 | Bacteria | 1498 |
| 436 | Ga0207662_10238991 | 3300025918 | Bacteria | 1188 |
| 437 | Ga0207662_10470207 | 3300025918 | Bacteria | 862 |
| 438 | Ga0207649_10014254 | 3300025920 | Unclassified | 4448 |
| 439 | Ga0207652_10001974 | 3300025921 | Bacteria | 17736 |
| 440 | Ga0207652_10136637 | 3300025921 | Unclassified | 2189 |
| 441 | Ga0207646_10006373 | 3300025922 | Bacteria | 12204 |
| 442 | Ga0207646_10008262 | 3300025922 | Bacteria | 10449 |
| 443 | Ga0207646_10196853 | 3300025922 | Unclassified | 1820 |
| 444 | Ga0207646_10237350 | 3300025922 | Bacteria | 1647 |
| 445 | Ga0207681_10001502 | 3300025923 | Bacteria | 15046 |
| 446 | Ga0207681_10117473 | 3300025923 | Bacteria | 1945 |
| 447 | Ga0207681_10302511 | 3300025923 | Bacteria | 1266 |
| 448 | Ga0207694_10001759 | 3300025924 | Bacteria | 18159 |
| 449 | Ga0207650_10001407 | 3300025925 | Bacteria | 17349 |
| 450 | Ga0207650_10058628 | 3300025925 | Bacteria | 2867 |
| 451 | Ga0207650_10084552 | 3300025925 | Bacteria | 2412 |
| 452 | Ga0207650_10129684 | 3300025925 | Bacteria | 1972 |
| 453 | Ga0207650_10511585 | 3300025925 | Bacteria | 1004 |
| 454 | Ga0207659_10249843 | 3300025926 | Bacteria | 1439 |
| 455 | Ga0207659_10276841 | 3300025926 | Bacteria | 1371 |
| 456 | Ga0207659_10549955 | 3300025926 | Unclassified | 981 |
| 457 | Ga0207659_10724219 | 3300025926 | Bacteria | 852 |
| 458 | Ga0207687_10127494 | 3300025927 | Bacteria | 1913 |
| 459 | Ga0207644_10006884 | 3300025931 | Bacteria | 7401 |
| 460 | Ga0207644_10086786 | 3300025931 | Unclassified | 2324 |
| 461 | Ga0207644_10102018 | 3300025931 | Bacteria | 2157 |
| 462 | Ga0207644_10557494 | 3300025931 | Unclassified | 949 |
| 463 | Ga0207706_10598342 | 3300025933 | Bacteria | 947 |
| 464 | Ga0207706_10905139 | 3300025933 | Unclassified | 745 |
| 465 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 466 | Ga0207686_10066174 | 3300025934 | Bacteria | 2307 |
| 467 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 468 | Ga0207709_10001413 | 3300025935 | Bacteria | 16815 |
| 469 | Ga0207709_10016805 | 3300025935 | Bacteria | 4076 |
| 470 | Ga0207709_10187682 | 3300025935 | Unclassified | 1465 |
| 471 | Ga0207709_10222440 | 3300025935 | Bacteria | 1362 |
| 472 | Ga0207709_10373106 | 3300025935 | Bacteria | 1083 |
| 473 | Ga0207670_10294525 | 3300025936 | Bacteria | 1269 |
| 474 | Ga0207704_10012525 | 3300025938 | Bacteria | 4211 |
| 475 | Ga0207665_10026931 | 3300025939 | Bacteria | 3798 |
| 476 | Ga0207691_10568557 | 3300025940 | Bacteria | 961 |
| 477 | Ga0207711_10008138 | 3300025941 | Bacteria | 8776 |
| 478 | Ga0207711_10045821 | 3300025941 | Bacteria | 3736 |
| 479 | Ga0207711_10049505 | 3300025941 | Bacteria | 3597 |
| 480 | Ga0207711_10093311 | 3300025941 | Unclassified | 2651 |
| 481 | Ga0207711_10212800 | 3300025941 | Bacteria | 1766 |
| 482 | Ga0207711_10255711 | 3300025941 | Bacteria | 1609 |
| 483 | Ga0207689_10001286 | 3300025942 | Bacteria | 24193 |
| 484 | Ga0207689_10016417 | 3300025942 | Bacteria | 6268 |
| 485 | Ga0207689_10158117 | 3300025942 | Bacteria | 1868 |
| 486 | Ga0207689_10184606 | 3300025942 | Bacteria | 1720 |
| 487 | Ga0207689_10233449 | 3300025942 | Unclassified | 1520 |
| 488 | Ga0207689_10325268 | 3300025942 | Unclassified | 1276 |
| 489 | Ga0207689_10346251 | 3300025942 | Bacteria | 1235 |
| 490 | Ga0207679_10050471 | 3300025945 | Unclassified | 3040 |
| 491 | Ga0207679_10262907 | 3300025945 | Bacteria | 1472 |
| 492 | Ga0207679_10429087 | 3300025945 | Bacteria | 1168 |
| 493 | Ga0207651_10020599 | 3300025960 | Unclassified | 3985 |
| 494 | Ga0207651_10031485 | 3300025960 | Bacteria | 3392 |
| 495 | Ga0207651_10120501 | 3300025960 | Unclassified | 1989 |
| 496 | Ga0207651_10153369 | 3300025960 | Bacteria | 1796 |
| 497 | Ga0207651_10166053 | 3300025960 | Unclassified | 1736 |
| 498 | Ga0207651_10563174 | 3300025960 | Bacteria | 992 |
| 499 | Ga0207651_10577924 | 3300025960 | Unclassified | 980 |
| 500 | Ga0207712_10000180 | 3300025961 | Bacteria | 65420 |
| 501 | Ga0207712_10058094 | 3300025961 | Bacteria | 2732 |
| 502 | Ga0207712_10360001 | 3300025961 | Bacteria | 1212 |
| 503 | Ga0207668_10014287 | 3300025972 | Bacteria | 4913 |
| 504 | Ga0207640_10034507 | 3300025981 | Bacteria | 3158 |
| 505 | Ga0207640_10590791 | 3300025981 | Bacteria | 939 |
| 506 | Ga0207640_10675190 | 3300025981 | Bacteria | 883 |
| 507 | Ga0207658_10260782 | 3300025986 | Bacteria | 1477 |
| 508 | Ga0207658_10376053 | 3300025986 | Bacteria | 1243 |
| 509 | Ga0207677_10111181 | 3300026023 | Bacteria | 2041 |
| 510 | Ga0207703_10002069 | 3300026035 | Bacteria | 17649 |
| 511 | Ga0207703_10031488 | 3300026035 | Unclassified | 4194 |
| 512 | Ga0207703_10038722 | 3300026035 | Bacteria | 3807 |
| 513 | Ga0207703_10091588 | 3300026035 | Unclassified | 2558 |
| 514 | Ga0207703_10553963 | 3300026035 | Bacteria | 1084 |
| 515 | Ga0207703_10658530 | 3300026035 | Unclassified | 994 |
| 516 | Ga0207639_10059425 | 3300026041 | Unclassified | 2945 |
| 517 | Ga0207708_10001124 | 3300026075 | Bacteria | 20108 |
| 518 | Ga0207708_10035790 | 3300026075 | Bacteria | 3778 |
| 519 | Ga0207708_10105844 | 3300026075 | Unclassified | 2181 |
| 520 | Ga0207708_10718931 | 3300026075 | Unclassified | 855 |
| 521 | Ga0207702_10024513 | 3300026078 | Bacteria | 5006 |
| 522 | Ga0207641_10044300 | 3300026088 | Unclassified | 3742 |
| 523 | Ga0207641_10198955 | 3300026088 | Bacteria | 1846 |
| 524 | Ga0207648_10002250 | 3300026089 | Bacteria | 20862 |
| 525 | Ga0207648_10060567 | 3300026089 | Bacteria | 3301 |
| 526 | Ga0207648_10240070 | 3300026089 | Bacteria | 1613 |
| 527 | Ga0207648_10704928 | 3300026089 | Bacteria | 935 |
| 528 | Ga0207676_10004331 | 3300026095 | Bacteria | 10041 |
| 529 | Ga0207676_10109467 | 3300026095 | Bacteria | 2308 |
| 530 | Ga0207676_10243392 | 3300026095 | Bacteria | 1615 |
| 531 | Ga0207676_10506852 | 3300026095 | Bacteria | 1147 |
| 532 | Ga0207676_10674053 | 3300026095 | Bacteria | 1000 |
| 533 | Ga0207676_10818931 | 3300026095 | Unclassified | 909 |
| 534 | Ga0207674_10001135 | 3300026116 | Bacteria | 34563 |
| 535 | Ga0207674_10059514 | 3300026116 | Bacteria | 3865 |
| 536 | Ga0207674_10188958 | 3300026116 | Unclassified | 2010 |
| 537 | Ga0207674_10216156 | 3300026116 | Bacteria | 1865 |
| 538 | Ga0207674_10226575 | 3300026116 | Bacteria | 1817 |
| 539 | Ga0207675_100003630 | 3300026118 | Bacteria | 15046 |
| 540 | Ga0207675_100130908 | 3300026118 | Bacteria | 2379 |
| 541 | Ga0207675_100135208 | 3300026118 | Bacteria | 2339 |
| 542 | Ga0207675_100304308 | 3300026118 | Unclassified | 1553 |
| 543 | Ga0207675_100446645 | 3300026118 | Unclassified | 1281 |
| 544 | Ga0207675_101161577 | 3300026118 | Unclassified | 792 |
| 545 | Ga0207683_10101495 | 3300026121 | Bacteria | 2569 |
| 546 | Ga0207683_10354861 | 3300026121 | Bacteria | 1346 |
| 547 | Ga0207698_10104836 | 3300026142 | Bacteria | 2354 |
| 548 | Ga0207428_10002796 | 3300027907 | Bacteria | 17330 |
| 549 | Ga0207428_10035987 | 3300027907 | Bacteria | 4041 |
| 550 | Ga0207428_10247785 | 3300027907 | Bacteria | 1329 |
| 551 | Ga0268265_10029493 | 3300028380 | Bacteria | 3938 |
| 552 | Ga0268265_10185530 | 3300028380 | Bacteria | 1791 |
| 553 | Ga0268265_10222225 | 3300028380 | Bacteria | 1653 |
| 554 | Ga0268265_10258243 | 3300028380 | Bacteria | 1547 |
| 555 | Ga0268265_10366611 | 3300028380 | Unclassified | 1321 |
| 556 | Ga0268264_10080869 | 3300028381 | Bacteria | 2776 |
| 557 | Ga0268264_10295645 | 3300028381 | Bacteria | 1522 |
| 558 | Ga0268264_10330647 | 3300028381 | Unclassified | 1444 |
| 559 | Ga0268264_10424031 | 3300028381 | Bacteria | 1284 |
| 560 | Ga0314311_1222542 | 3300030733 | Unclassified | 2781 |
| 561 | Ga0307408_100317938 | 3300031548 | Bacteria | 1310 |
| 562 | Ga0307408_100769980 | 3300031548 | Bacteria | 871 |
| 563 | Ga0307405_10128925 | 3300031731 | Bacteria | 1744 |
| 564 | Ga0307405_10240397 | 3300031731 | Bacteria | 1341 |
| 565 | Ga0307406_10209501 | 3300031901 | Bacteria | 1441 |
| 566 | Ga0307406_10694595 | 3300031901 | Unclassified | 849 |
| 567 | Ga0307412_10133627 | 3300031911 | Bacteria | 1806 |
| 568 | Ga0307416_100070396 | 3300032002 | Bacteria | 2900 |
| 569 | Ga0307416_100180972 | 3300032002 | Bacteria | 1976 |
| 570 | Ga0307414_10692211 | 3300032004 | Bacteria | 922 |
| 571 | Ga0307411_10349869 | 3300032005 | Unclassified | 1204 |
| 572 | Ga0307415_100218038 | 3300032126 | Unclassified | 1527 |
| 573 | Ga0373946_0254273 | 3300035171 | Bacteria | 858 |
| 574 | Ga0395900_0075407 | 3300037418 | Bacteria | 3468 |
| 575 | Ga0395898_0068505 | 3300037466 | Bacteria | 3434 |
| 576 | Ga0395901_0145592 | 3300038443 | Bacteria | 2490 |
| 577 | Ga0242420_001536 | 3300038996 | Bacteria | 3094 |
| 578 | Ga0242420_010818 | 3300038996 | Unclassified | 1522 |
| 579 | Ga0436365_0394125 | 3300039437 | Bacteria | 6649 |
| 580 | Ga0439433_0092665 | 3300041999 | Unclassified | 744 |
| 581 | Ga0451577_0291501 | 3300042876 | Unclassified | 1479 |
| 582 | Ga0453683_0030304 | 3300044673 | Bacteria | 3420 |
| 583 | Ga0451576_0696384 | 3300045051 | Unclassified | 1068 |
| 584 | Ga0451576_0699737 | 3300045051 | Unclassified | 1065 |
| 585 | Ga0495610_0048285 | 3300046512 | Bacteria | 2090 |
| 586 | Ga0495663_0000122 | 3300046525 | Bacteria | 32201 |
| 587 | Ga0495598_0001729 | 3300046537 | Bacteria | 4378 |
| 588 | Ga0495598_0004536 | 3300046537 | Bacteria | 3015 |
| 589 | Ga0495621_0037742 | 3300046539 | Bacteria | 1682 |
| 590 | Ga0495659_0004579 | 3300046664 | Unclassified | 4352 |
| 591 | Ga0495636_0207908 | 3300047318 | Unclassified | 895 |
| 592 | Ga0496102_0866998 | 3300048905 | Unclassified | 825 |
| 593 | Ga0496104_0734661 | 3300048907 | Unclassified | 894 |
| 594 | Ga0496106_0014031 | 3300048909 | Bacteria | 5923 |
| 595 | Ga0496106_0127452 | 3300048909 | Bacteria | 1994 |
| 596 | Ga0496106_0136244 | 3300048909 | Bacteria | 1929 |
| 597 | Ga0496107_0253773 | 3300048910 | Unclassified | 1309 |
| 598 | Ga0496108_0388182 | 3300048911 | Unclassified | 1219 |
| 599 | Ga0496112_0598222 | 3300048915 | Unclassified | 1035 |
| 600 | Ga0501291_019026 | 3300049514 | Unclassified | 1074 |
| 601 | Ga0501295_042387 | 3300049518 | Unclassified | 948 |
| 602 | Ga0501299_051604 | 3300049522 | Unclassified | 851 |
| 603 | Ga0501300_012663 | 3300049523 | Unclassified | 1229 |
| 604 | Ga0501072_0523912 | 3300049588 | Unclassified | 937 |
| 605 | Ga0501075_0319470 | 3300049591 | Bacteria | 1183 |
| 606 | Ga0501206_009937 | 3300049653 | Bacteria | 1268 |
| 607 | Ga0501207_008145 | 3300049654 | Bacteria | 1509 |
| 608 | Ga0501208_005920 | 3300049655 | Bacteria | 1530 |
| 609 | Ga0501216_007138 | 3300049660 | Bacteria | 1731 |
| 610 | Ga0501217_014045 | 3300049661 | Bacteria | 1804 |
| 611 | Ga0501217_090744 | 3300049661 | Bacteria | 857 |
| 612 | Ga0501233_018107 | 3300049668 | Unclassified | 1478 |
| 613 | Ga0501243_006435 | 3300049675 | Bacteria | 1778 |
| 614 | Ga0501249_005337 | 3300049679 | Bacteria | 2627 |
| 615 | Ga0501259_004049 | 3300049688 | Bacteria | 2331 |
| 616 | Ga0501261_030256 | 3300049690 | Unclassified | 816 |
| 617 | Ga0501225_0013604 | 3300049705 | Bacteria | 2276 |
| 618 | Ga0501234_027812 | 3300049707 | Unclassified | 909 |
| 619 | Ga0501245_020460 | 3300049708 | Unclassified | 1033 |
| 620 | Ga0501272_006159 | 3300049769 | Bacteria | 1278 |
| 621 | Ga0501273_010836 | 3300049770 | Unclassified | 1126 |
| 622 | Ga0501280_007910 | 3300049776 | Bacteria | 1485 |
| 623 | Ga0501212_001102 | 3300049851 | Bacteria | 2948 |
| 624 | nmdc:mga05p37_114743_c1 | 3300050507 | Bacteria | 3311 |
| 625 | nmdc:mga05p37_1192297_c1 | 3300050507 | Unclassified | 787 |
| 626 | nmdc:mga05p37_124133_c1 | 3300050507 | Bacteria | 3171 |
| 627 | nmdc:mga05p37_147370_c1 | 3300050507 | Unclassified | 2880 |
| 628 | nmdc:mga05p37_14770_c1 | 3300050507 | Bacteria | 9377 |
| 629 | nmdc:mga05p37_241878_c1 | 3300050507 | Bacteria | 2170 |
| 630 | nmdc:mga05p37_26820_c1 | 3300050507 | Bacteria | 7008 |
| 631 | nmdc:mga05p37_59851_c1 | 3300050507 | Unclassified | 4690 |
| 632 | nmdc:mga05p37_801592_c1 | 3300050507 | Unclassified | 1030 |
| 633 | nmdc:mga05p37_844989_c1 | 3300050507 | Unclassified | 995 |
| 634 | nmdc:mga05p37_9803_c1 | 3300050507 | Bacteria | 11367 |
| 635 | nmdc:mga09592_171380_c1 | 3300050508 | Bacteria | 1877 |
| 636 | nmdc:mga09592_86211_c1 | 3300050508 | Bacteria | 2679 |
| 637 | nmdc:mga0qj67_412595_c1 | 3300050509 | Bacteria | 1089 |
| 638 | nmdc:mga06r32_109410_c1 | 3300050510 | Bacteria | 2717 |
| 639 | nmdc:mga08y16_3098_c1 | 3300050511 | Bacteria | 17205 |
| 640 | nmdc:mga08y16_397058_c1 | 3300050511 | Bacteria | 1412 |
| 641 | nmdc:mga0n895_127529_c1 | 3300050512 | Bacteria | 2568 |
| 642 | nmdc:mga0n895_180966_c1 | 3300050512 | Bacteria | 2139 |
| 643 | nmdc:mga0n895_192108_c1 | 3300050512 | Unclassified | 2073 |
| 644 | nmdc:mga0n895_509276_c1 | 3300050512 | Bacteria | 1212 |
| 645 | nmdc:mga0n895_71066_c1 | 3300050512 | Bacteria | 3450 |
| 646 | nmdc:mga0n895_820493_c1 | 3300050512 | Bacteria | 919 |
| 647 | nmdc:mga0rr50_109283_c1 | 3300050513 | Unclassified | 2186 |
| 648 | nmdc:mga0rr50_229844_c1 | 3300050513 | Bacteria | 1534 |
| 649 | nmdc:mga0a205_123017_c1 | 3300050515 | Unclassified | 2494 |
| 650 | nmdc:mga0a205_219490_c1 | 3300050515 | Bacteria | 1787 |
| 651 | nmdc:mga0a205_220467_c1 | 3300050515 | Bacteria | 1782 |
| 652 | nmdc:mga0a205_357291_c1 | 3300050515 | Bacteria | 1328 |
| 653 | nmdc:mga0a205_40562_c1 | 3300050515 | Bacteria | 4482 |
| 654 | nmdc:mga0a205_6769_c2 | 3300050515 | Bacteria | 9509 |
| 655 | nmdc:mga0a205_709314_c1 | 3300050515 | Unclassified | 856 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10226575 | Ga0207674_102265752 | 181 |
| 2 | 3300001432 | JGI24034J14986_100037 | JGI24034J14986_1000374 | 208 |
| 3 | 3300005617 | Ga0068859_100925601 | Ga0068859_1009256012 | 208 |
| 4 | 3300006931 | Ga0097620_100925707 | Ga0097620_1009257072 | 208 |
| 5 | 3300025223 | Ga0207672_1000795 | Ga0207672_10007954 | 208 |
| 6 | 3300025922 | Ga0207646_10196853 | Ga0207646_101968532 | 208 |
| 7 | 3300005293 | Ga0065715_10233599 | Ga0065715_102335992 | 210 |
| 8 | 3300005334 | Ga0068869_100050973 | Ga0068869_1000509732 | 210 |
| 9 | 3300005338 | Ga0068868_100205647 | Ga0068868_1002056471 | 210 |
| 10 | 3300005340 | Ga0070689_100365371 | Ga0070689_1003653711 | 210 |
| 11 | 3300005355 | Ga0070671_100117814 | Ga0070671_1001178141 | 210 |
| 12 | 3300005367 | Ga0070667_100308962 | Ga0070667_1003089621 | 210 |
| 13 | 3300005564 | Ga0070664_100209453 | Ga0070664_1002094532 | 210 |
| 14 | 3300005616 | Ga0068852_100921477 | Ga0068852_1009214771 | 210 |
| 15 | 3300005617 | Ga0068859_100004986 | Ga0068859_1000049864 | 210 |
| 16 | 3300005618 | Ga0068864_100046763 | Ga0068864_1000467633 | 210 |
| 17 | 3300005842 | Ga0068858_100041574 | Ga0068858_1000415742 | 210 |
| 18 | 3300006358 | Ga0068871_100002467 | Ga0068871_10000246711 | 210 |
| 19 | 3300006931 | Ga0097620_100004986 | Ga0097620_1000049864 | 210 |
| 20 | 3300025936 | Ga0207670_10294525 | Ga0207670_102945252 | 210 |
| 21 | 3300025941 | Ga0207711_10093311 | Ga0207711_100933111 | 210 |
| 22 | 3300025942 | Ga0207689_10016417 | Ga0207689_100164172 | 210 |
| 23 | 3300025945 | Ga0207679_10429087 | Ga0207679_104290871 | 210 |
| 24 | 3300025960 | Ga0207651_10120501 | Ga0207651_101205011 | 210 |
| 25 | 3300025986 | Ga0207658_10260782 | Ga0207658_102607822 | 210 |
| 26 | 3300026035 | Ga0207703_10031488 | Ga0207703_100314883 | 210 |
| 27 | 3300026095 | Ga0207676_10004331 | Ga0207676_100043314 | 210 |
| 28 | 3300026142 | Ga0207698_10104836 | Ga0207698_101048361 | 210 |
| 29 | 3300028381 | Ga0268264_10295645 | Ga0268264_102956451 | 210 |
| 30 | 3300005366 | Ga0070659_100606528 | Ga0070659_1006065281 | 212 |
| 31 | 3300005842 | Ga0068858_100022386 | Ga0068858_1000223862 | 212 |
| 32 | 3300005843 | Ga0068860_100236051 | Ga0068860_1002360512 | 212 |
| 33 | 3300007076 | Ga0075435_100209643 | Ga0075435_1002096432 | 212 |
| 34 | 3300009177 | Ga0105248_10083368 | Ga0105248_100833682 | 212 |
| 35 | 3300013306 | Ga0163162_10012958 | Ga0163162_100129582 | 212 |
| 36 | 3300013308 | Ga0157375_10187707 | Ga0157375_101877072 | 212 |
| 37 | 3300014325 | Ga0163163_10012225 | Ga0163163_100122252 | 212 |
| 38 | 3300014968 | Ga0157379_10180486 | Ga0157379_101804862 | 212 |
| 39 | 3300025941 | Ga0207711_10049505 | Ga0207711_100495052 | 212 |
| 40 | 3300026035 | Ga0207703_10091588 | Ga0207703_100915882 | 212 |
| 41 | 3300028381 | Ga0268264_10080869 | Ga0268264_100808692 | 212 |
| 42 | 3300050513 | nmdc:mga0rr50_109283_c1 | nmdc:mga0rr50_109283_c1_943_1581 | 212 |
| 43 | 3300005293 | Ga0065715_10021680 | Ga0065715_100216802 | 213 |
| 44 | 3300005331 | Ga0070670_100067484 | Ga0070670_1000674843 | 213 |
| 45 | 3300005336 | Ga0070680_100029267 | Ga0070680_1000292672 | 213 |
| 46 | 3300005337 | Ga0070682_100082304 | Ga0070682_1000823042 | 213 |
| 47 | 3300005339 | Ga0070660_100151453 | Ga0070660_1001514532 | 213 |
| 48 | 3300005344 | Ga0070661_100039632 | Ga0070661_1000396322 | 213 |
| 49 | 3300005366 | Ga0070659_100003236 | Ga0070659_1000032369 | 213 |
| 50 | 3300005438 | Ga0070701_10075517 | Ga0070701_100755172 | 213 |
| 51 | 3300005458 | Ga0070681_10000383 | Ga0070681_1000038312 | 213 |
| 52 | 3300005459 | Ga0068867_100002030 | Ga0068867_10000203010 | 213 |
| 53 | 3300005467 | Ga0070706_100000001 | Ga0070706_100000001270 | 213 |
| 54 | 3300005530 | Ga0070679_100068148 | Ga0070679_1000681482 | 213 |
| 55 | 3300005535 | Ga0070684_100768561 | Ga0070684_1007685611 | 213 |
| 56 | 3300005539 | Ga0068853_100020464 | Ga0068853_1000204642 | 213 |
| 57 | 3300005564 | Ga0070664_100025486 | Ga0070664_1000254863 | 213 |
| 58 | 3300005577 | Ga0068857_100026078 | Ga0068857_1000260782 | 213 |
| 59 | 3300005618 | Ga0068864_100002803 | Ga0068864_1000028031 | 213 |
| 60 | 3300009551 | Ga0105238_10618827 | Ga0105238_106188271 | 213 |
| 61 | 3300013307 | Ga0157372_10069140 | Ga0157372_100691402 | 213 |
| 62 | 3300014745 | Ga0157377_10022713 | Ga0157377_100227132 | 213 |
| 63 | 3300025910 | Ga0207684_10000286 | Ga0207684_1000028630 | 213 |
| 64 | 3300025912 | Ga0207707_10071957 | Ga0207707_100719571 | 213 |
| 65 | 3300025917 | Ga0207660_10463937 | Ga0207660_104639371 | 213 |
| 66 | 3300025920 | Ga0207649_10014254 | Ga0207649_100142542 | 213 |
| 67 | 3300025921 | Ga0207652_10136637 | Ga0207652_101366372 | 213 |
| 68 | 3300025925 | Ga0207650_10058628 | Ga0207650_100586282 | 213 |
| 69 | 3300025945 | Ga0207679_10050471 | Ga0207679_100504711 | 213 |
| 70 | 3300026041 | Ga0207639_10059425 | Ga0207639_100594252 | 213 |
| 71 | 3300026116 | Ga0207674_10001135 | Ga0207674_100011355 | 213 |
| 72 | 3300037418 | Ga0395900_0075407 | Ga0395900_0075407_1696_2337 | 213 |
| 73 | 3300037466 | Ga0395898_0068505 | Ga0395898_0068505_2161_2802 | 213 |
| 74 | 3300038443 | Ga0395901_0145592 | Ga0395901_0145592_547_1188 | 213 |
| 75 | 3300050512 | nmdc:mga0n895_820493_c1 | nmdc:mga0n895_820493_c1_198_839 | 213 |
| 76 | 3300005288 | Ga0065714_10002198 | Ga0065714_1000219833 | 214 |
| 77 | 3300005290 | Ga0065712_10000119 | Ga0065712_1000011930 | 214 |
| 78 | 3300005293 | Ga0065715_10089354 | Ga0065715_100893545 | 214 |
| 79 | 3300005330 | Ga0070690_100033304 | Ga0070690_1000333042 | 214 |
| 80 | 3300005331 | Ga0070670_100001298 | Ga0070670_1000012989 | 214 |
| 81 | 3300005334 | Ga0068869_100070758 | Ga0068869_1000707582 | 214 |
| 82 | 3300005334 | Ga0068869_100481406 | Ga0068869_1004814061 | 214 |
| 83 | 3300005341 | Ga0070691_10361503 | Ga0070691_103615031 | 214 |
| 84 | 3300005353 | Ga0070669_100014746 | Ga0070669_1000147462 | 214 |
| 85 | 3300005353 | Ga0070669_100133471 | Ga0070669_1001334711 | 214 |
| 86 | 3300005354 | Ga0070675_100524024 | Ga0070675_1005240241 | 214 |
| 87 | 3300005355 | Ga0070671_100232866 | Ga0070671_1002328662 | 214 |
| 88 | 3300005356 | Ga0070674_100084459 | Ga0070674_1000844591 | 214 |
| 89 | 3300005364 | Ga0070673_100031146 | Ga0070673_1000311462 | 214 |
| 90 | 3300005364 | Ga0070673_100032156 | Ga0070673_1000321563 | 214 |
| 91 | 3300005364 | Ga0070673_100177265 | Ga0070673_1001772652 | 214 |
| 92 | 3300005367 | Ga0070667_100075838 | Ga0070667_1000758382 | 214 |
| 93 | 3300005438 | Ga0070701_10067337 | Ga0070701_100673372 | 214 |
| 94 | 3300005440 | Ga0070705_100065375 | Ga0070705_1000653751 | 214 |
| 95 | 3300005445 | Ga0070708_100001024 | Ga0070708_1000010244 | 214 |
| 96 | 3300005456 | Ga0070678_100175863 | Ga0070678_1001758631 | 214 |
| 97 | 3300005457 | Ga0070662_100256599 | Ga0070662_1002565992 | 214 |
| 98 | 3300005457 | Ga0070662_100296969 | Ga0070662_1002969692 | 214 |
| 99 | 3300005467 | Ga0070706_100013408 | Ga0070706_1000134083 | 214 |
| 100 | 3300005468 | Ga0070707_100009936 | Ga0070707_1000099364 | 214 |
| 101 | 3300005471 | Ga0070698_100011527 | Ga0070698_1000115274 | 214 |
| 102 | 3300005471 | Ga0070698_100026115 | Ga0070698_1000261152 | 214 |
| 103 | 3300005518 | Ga0070699_100007970 | Ga0070699_1000079704 | 214 |
| 104 | 3300005518 | Ga0070699_100038258 | Ga0070699_1000382582 | 214 |
| 105 | 3300005536 | Ga0070697_100009933 | Ga0070697_1000099332 | 214 |
| 106 | 3300005536 | Ga0070697_100074800 | Ga0070697_1000748001 | 214 |
| 107 | 3300005539 | Ga0068853_100345488 | Ga0068853_1003454882 | 214 |
| 108 | 3300005546 | Ga0070696_100396663 | Ga0070696_1003966632 | 214 |
| 109 | 3300005547 | Ga0070693_100042517 | Ga0070693_1000425172 | 214 |
| 110 | 3300005549 | Ga0070704_100238957 | Ga0070704_1002389572 | 214 |
| 111 | 3300005564 | Ga0070664_100241183 | Ga0070664_1002411833 | 214 |
| 112 | 3300005577 | Ga0068857_100179938 | Ga0068857_1001799382 | 214 |
| 113 | 3300005578 | Ga0068854_100142830 | Ga0068854_1001428302 | 214 |
| 114 | 3300005614 | Ga0068856_100161748 | Ga0068856_1001617482 | 214 |
| 115 | 3300005615 | Ga0070702_100038912 | Ga0070702_1000389122 | 214 |
| 116 | 3300005617 | Ga0068859_100030949 | Ga0068859_1000309493 | 214 |
| 117 | 3300005617 | Ga0068859_100053437 | Ga0068859_1000534372 | 214 |
| 118 | 3300005618 | Ga0068864_100123535 | Ga0068864_1001235352 | 214 |
| 119 | 3300005718 | Ga0068866_10015098 | Ga0068866_100150982 | 214 |
| 120 | 3300005719 | Ga0068861_100015997 | Ga0068861_1000159973 | 214 |
| 121 | 3300005719 | Ga0068861_100059993 | Ga0068861_1000599932 | 214 |
| 122 | 3300005719 | Ga0068861_100302988 | Ga0068861_1003029882 | 214 |
| 123 | 3300005841 | Ga0068863_100068448 | Ga0068863_1000684482 | 214 |
| 124 | 3300005841 | Ga0068863_100075068 | Ga0068863_1000750682 | 214 |
| 125 | 3300005841 | Ga0068863_100515056 | Ga0068863_1005150562 | 214 |
| 126 | 3300006237 | Ga0097621_100008185 | Ga0097621_1000081854 | 214 |
| 127 | 3300006358 | Ga0068871_100009395 | Ga0068871_1000093953 | 214 |
| 128 | 3300006358 | Ga0068871_100600614 | Ga0068871_1006006142 | 214 |
| 129 | 3300006844 | Ga0075428_100906089 | Ga0075428_1009060891 | 214 |
| 130 | 3300006881 | Ga0068865_100030351 | Ga0068865_1000303512 | 214 |
| 131 | 3300006931 | Ga0097620_100030950 | Ga0097620_1000309503 | 214 |
| 132 | 3300006931 | Ga0097620_100053440 | Ga0097620_1000534402 | 214 |
| 133 | 3300006931 | Ga0097620_100302886 | Ga0097620_1003028862 | 214 |
| 134 | 3300009093 | Ga0105240_10063290 | Ga0105240_100632903 | 214 |
| 135 | 3300009094 | Ga0111539_10345936 | Ga0111539_103459362 | 214 |
| 136 | 3300009098 | Ga0105245_10015028 | Ga0105245_100150282 | 214 |
| 137 | 3300009101 | Ga0105247_10060962 | Ga0105247_100609622 | 214 |
| 138 | 3300009148 | Ga0105243_10003913 | Ga0105243_100039132 | 214 |
| 139 | 3300009176 | Ga0105242_10006988 | Ga0105242_100069883 | 214 |
| 140 | 3300009176 | Ga0105242_10114474 | Ga0105242_101144742 | 214 |
| 141 | 3300009177 | Ga0105248_10005805 | Ga0105248_100058055 | 214 |
| 142 | 3300009177 | Ga0105248_10032138 | Ga0105248_100321384 | 214 |
| 143 | 3300009553 | Ga0105249_10196432 | Ga0105249_101964322 | 214 |
| 144 | 3300009553 | Ga0105249_11332280 | Ga0105249_113322801 | 214 |
| 145 | 3300010375 | Ga0105239_11175605 | Ga0105239_111756051 | 214 |
| 146 | 3300013296 | Ga0157374_10082843 | Ga0157374_100828431 | 214 |
| 147 | 3300013296 | Ga0157374_10135832 | Ga0157374_101358322 | 214 |
| 148 | 3300013297 | Ga0157378_10013296 | Ga0157378_100132962 | 214 |
| 149 | 3300013297 | Ga0157378_10013817 | Ga0157378_100138176 | 214 |
| 150 | 3300013297 | Ga0157378_10019504 | Ga0157378_100195042 | 214 |
| 151 | 3300013306 | Ga0163162_10023010 | Ga0163162_100230104 | 214 |
| 152 | 3300013307 | Ga0157372_10045651 | Ga0157372_100456513 | 214 |
| 153 | 3300013308 | Ga0157375_10366866 | Ga0157375_103668662 | 214 |
| 154 | 3300014325 | Ga0163163_10008020 | Ga0163163_100080202 | 214 |
| 155 | 3300014325 | Ga0163163_10028251 | Ga0163163_100282512 | 214 |
| 156 | 3300014325 | Ga0163163_10048588 | Ga0163163_100485883 | 214 |
| 157 | 3300014745 | Ga0157377_10028162 | Ga0157377_100281622 | 214 |
| 158 | 3300014969 | Ga0157376_10030500 | Ga0157376_100305002 | 214 |
| 159 | 3300014969 | Ga0157376_10158248 | Ga0157376_101582482 | 214 |
| 160 | 3300017792 | Ga0163161_10026181 | Ga0163161_100261812 | 214 |
| 161 | 3300017792 | Ga0163161_10081320 | Ga0163161_100813201 | 214 |
| 162 | 3300025315 | Ga0207697_10005901 | Ga0207697_100059013 | 214 |
| 163 | 3300025900 | Ga0207710_10021224 | Ga0207710_100212243 | 214 |
| 164 | 3300025903 | Ga0207680_10076168 | Ga0207680_100761682 | 214 |
| 165 | 3300025910 | Ga0207684_10010256 | Ga0207684_100102565 | 214 |
| 166 | 3300025913 | Ga0207695_10104060 | Ga0207695_101040601 | 214 |
| 167 | 3300025922 | Ga0207646_10237350 | Ga0207646_102373502 | 214 |
| 168 | 3300025923 | Ga0207681_10001502 | Ga0207681_100015023 | 214 |
| 169 | 3300025923 | Ga0207681_10117473 | Ga0207681_101174731 | 214 |
| 170 | 3300025924 | Ga0207694_10001759 | Ga0207694_100017594 | 214 |
| 171 | 3300025925 | Ga0207650_10001407 | Ga0207650_100014073 | 214 |
| 172 | 3300025926 | Ga0207659_10549955 | Ga0207659_105499551 | 214 |
| 173 | 3300025931 | Ga0207644_10086786 | Ga0207644_100867862 | 214 |
| 174 | 3300025931 | Ga0207644_10102018 | Ga0207644_101020182 | 214 |
| 175 | 3300025934 | Ga0207686_10066174 | Ga0207686_100661741 | 214 |
| 176 | 3300025935 | Ga0207709_10016805 | Ga0207709_100168052 | 214 |
| 177 | 3300025935 | Ga0207709_10222440 | Ga0207709_102224402 | 214 |
| 178 | 3300025938 | Ga0207704_10012525 | Ga0207704_100125252 | 214 |
| 179 | 3300025941 | Ga0207711_10008138 | Ga0207711_100081385 | 214 |
| 180 | 3300025941 | Ga0207711_10045821 | Ga0207711_100458213 | 214 |
| 181 | 3300025941 | Ga0207711_10212800 | Ga0207711_102128002 | 214 |
| 182 | 3300025942 | Ga0207689_10001286 | Ga0207689_1000128622 | 214 |
| 183 | 3300025942 | Ga0207689_10158117 | Ga0207689_101581172 | 214 |
| 184 | 3300025945 | Ga0207679_10262907 | Ga0207679_102629072 | 214 |
| 185 | 3300025960 | Ga0207651_10031485 | Ga0207651_100314852 | 214 |
| 186 | 3300025960 | Ga0207651_10153369 | Ga0207651_101533693 | 214 |
| 187 | 3300025960 | Ga0207651_10563174 | Ga0207651_105631741 | 214 |
| 188 | 3300025981 | Ga0207640_10034507 | Ga0207640_100345072 | 214 |
| 189 | 3300026075 | Ga0207708_10105844 | Ga0207708_101058442 | 214 |
| 190 | 3300026088 | Ga0207641_10044300 | Ga0207641_100443003 | 214 |
| 191 | 3300026088 | Ga0207641_10198955 | Ga0207641_101989552 | 214 |
| 192 | 3300026089 | Ga0207648_10002250 | Ga0207648_100022508 | 214 |
| 193 | 3300026095 | Ga0207676_10109467 | Ga0207676_101094672 | 214 |
| 194 | 3300026116 | Ga0207674_10188958 | Ga0207674_101889582 | 214 |
| 195 | 3300026116 | Ga0207674_10216156 | Ga0207674_102161562 | 214 |
| 196 | 3300026118 | Ga0207675_100130908 | Ga0207675_1001309081 | 214 |
| 197 | 3300026118 | Ga0207675_100304308 | Ga0207675_1003043081 | 214 |
| 198 | 3300026121 | Ga0207683_10101495 | Ga0207683_101014951 | 214 |
| 199 | 3300028380 | Ga0268265_10222225 | Ga0268265_102222252 | 214 |
| 200 | 3300028380 | Ga0268265_10366611 | Ga0268265_103666112 | 214 |
| 201 | 3300035171 | Ga0373946_0254273 | Ga0373946_0254273_105_767 | 214 |
| 202 | 3300049660 | Ga0501216_007138 | Ga0501216_007138_89_733 | 214 |
| 203 | 3300049661 | Ga0501217_090744 | Ga0501217_090744_165_809 | 214 |
| 204 | 3300049668 | Ga0501233_018107 | Ga0501233_018107_617_1261 | 214 |
| 205 | 3300049679 | Ga0501249_005337 | Ga0501249_005337_312_956 | 214 |
| 206 | 3300049688 | Ga0501259_004049 | Ga0501259_004049_58_702 | 214 |
| 207 | 3300049690 | Ga0501261_030256 | Ga0501261_030256_99_743 | 214 |
| 208 | 3300049708 | Ga0501245_020460 | Ga0501245_020460_29_673 | 214 |
| 209 | 2162886011 | MRS1b_contig_6662657 | MRS1b_0032.00001500 | 215 |
| 210 | 3300001426 | JGI24030J14995_100098 | JGI24030J14995_1000982 | 215 |
| 211 | 3300002074 | JGI24748J21848_1000007 | JGI24748J21848_100000799 | 215 |
| 212 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_1000000283 | 215 |
| 213 | 3300002244 | JGI24742J22300_10002227 | JGI24742J22300_100022274 | 215 |
| 214 | 3300005289 | Ga0065704_10091881 | Ga0065704_100918811 | 215 |
| 215 | 3300005289 | Ga0065704_10322250 | Ga0065704_103222501 | 215 |
| 216 | 3300005290 | Ga0065712_10098197 | Ga0065712_100981972 | 215 |
| 217 | 3300005290 | Ga0065712_10300032 | Ga0065712_103000321 | 215 |
| 218 | 3300005293 | Ga0065715_10002770 | Ga0065715_100027705 | 215 |
| 219 | 3300005293 | Ga0065715_10091482 | Ga0065715_100914822 | 215 |
| 220 | 3300005295 | Ga0065707_10087432 | Ga0065707_100874322 | 215 |
| 221 | 3300005295 | Ga0065707_10247255 | Ga0065707_102472551 | 215 |
| 222 | 3300005295 | Ga0065707_10275915 | Ga0065707_102759152 | 215 |
| 223 | 3300005295 | Ga0065707_10367904 | Ga0065707_103679041 | 215 |
| 224 | 3300005328 | Ga0070676_10030711 | Ga0070676_100307114 | 215 |
| 225 | 3300005328 | Ga0070676_10322528 | Ga0070676_103225281 | 215 |
| 226 | 3300005328 | Ga0070676_10356902 | Ga0070676_103569022 | 215 |
| 227 | 3300005330 | Ga0070690_100028362 | Ga0070690_1000283622 | 215 |
| 228 | 3300005330 | Ga0070690_100046197 | Ga0070690_1000461972 | 215 |
| 229 | 3300005330 | Ga0070690_100227703 | Ga0070690_1002277032 | 215 |
| 230 | 3300005330 | Ga0070690_100317039 | Ga0070690_1003170392 | 215 |
| 231 | 3300005331 | Ga0070670_100054717 | Ga0070670_1000547173 | 215 |
| 232 | 3300005331 | Ga0070670_100297161 | Ga0070670_1002971611 | 215 |
| 233 | 3300005334 | Ga0068869_100007326 | Ga0068869_1000073265 | 215 |
| 234 | 3300005334 | Ga0068869_100247901 | Ga0068869_1002479012 | 215 |
| 235 | 3300005334 | Ga0068869_100304080 | Ga0068869_1003040802 | 215 |
| 236 | 3300005336 | Ga0070680_100004282 | Ga0070680_1000042823 | 215 |
| 237 | 3300005336 | Ga0070680_100403826 | Ga0070680_1004038261 | 215 |
| 238 | 3300005337 | Ga0070682_100000521 | Ga0070682_1000005218 | 215 |
| 239 | 3300005337 | Ga0070682_100006312 | Ga0070682_1000063123 | 215 |
| 240 | 3300005337 | Ga0070682_100168847 | Ga0070682_1001688472 | 215 |
| 241 | 3300005343 | Ga0070687_100001368 | Ga0070687_1000013683 | 215 |
| 242 | 3300005343 | Ga0070687_100130872 | Ga0070687_1001308722 | 215 |
| 243 | 3300005343 | Ga0070687_100298848 | Ga0070687_1002988481 | 215 |
| 244 | 3300005343 | Ga0070687_100447059 | Ga0070687_1004470591 | 215 |
| 245 | 3300005345 | Ga0070692_10043655 | Ga0070692_100436551 | 215 |
| 246 | 3300005345 | Ga0070692_10052574 | Ga0070692_100525743 | 215 |
| 247 | 3300005345 | Ga0070692_10376916 | Ga0070692_103769161 | 215 |
| 248 | 3300005354 | Ga0070675_100254440 | Ga0070675_1002544402 | 215 |
| 249 | 3300005354 | Ga0070675_100613685 | Ga0070675_1006136852 | 215 |
| 250 | 3300005354 | Ga0070675_100753690 | Ga0070675_1007536902 | 215 |
| 251 | 3300005355 | Ga0070671_100063676 | Ga0070671_1000636764 | 215 |
| 252 | 3300005356 | Ga0070674_100377721 | Ga0070674_1003777211 | 215 |
| 253 | 3300005364 | Ga0070673_100019174 | Ga0070673_1000191744 | 215 |
| 254 | 3300005364 | Ga0070673_100060934 | Ga0070673_1000609343 | 215 |
| 255 | 3300005364 | Ga0070673_100343711 | Ga0070673_1003437112 | 215 |
| 256 | 3300005364 | Ga0070673_100441298 | Ga0070673_1004412981 | 215 |
| 257 | 3300005406 | Ga0070703_10000049 | Ga0070703_1000004943 | 215 |
| 258 | 3300005406 | Ga0070703_10024402 | Ga0070703_100244022 | 215 |
| 259 | 3300005440 | Ga0070705_100037158 | Ga0070705_1000371583 | 215 |
| 260 | 3300005440 | Ga0070705_100044060 | Ga0070705_1000440603 | 215 |
| 261 | 3300005440 | Ga0070705_100320810 | Ga0070705_1003208101 | 215 |
| 262 | 3300005440 | Ga0070705_100549702 | Ga0070705_1005497022 | 215 |
| 263 | 3300005441 | Ga0070700_100001165 | Ga0070700_1000011652 | 215 |
| 264 | 3300005441 | Ga0070700_100072607 | Ga0070700_1000726072 | 215 |
| 265 | 3300005441 | Ga0070700_100079056 | Ga0070700_1000790561 | 215 |
| 266 | 3300005444 | Ga0070694_100009560 | Ga0070694_1000095603 | 215 |
| 267 | 3300005444 | Ga0070694_100021942 | Ga0070694_1000219425 | 215 |
| 268 | 3300005444 | Ga0070694_100025088 | Ga0070694_1000250882 | 215 |
| 269 | 3300005444 | Ga0070694_100049054 | Ga0070694_1000490542 | 215 |
| 270 | 3300005444 | Ga0070694_100170601 | Ga0070694_1001706012 | 215 |
| 271 | 3300005444 | Ga0070694_100487308 | Ga0070694_1004873081 | 215 |
| 272 | 3300005445 | Ga0070708_100045110 | Ga0070708_1000451103 | 215 |
| 273 | 3300005457 | Ga0070662_100290627 | Ga0070662_1002906272 | 215 |
| 274 | 3300005457 | Ga0070662_100345919 | Ga0070662_1003459192 | 215 |
| 275 | 3300005457 | Ga0070662_100581101 | Ga0070662_1005811011 | 215 |
| 276 | 3300005458 | Ga0070681_10001279 | Ga0070681_1000127914 | 215 |
| 277 | 3300005459 | Ga0068867_100043408 | Ga0068867_1000434083 | 215 |
| 278 | 3300005459 | Ga0068867_100047363 | Ga0068867_1000473632 | 215 |
| 279 | 3300005467 | Ga0070706_100003314 | Ga0070706_10000331412 | 215 |
| 280 | 3300005468 | Ga0070707_100003580 | Ga0070707_1000035806 | 215 |
| 281 | 3300005468 | Ga0070707_100693397 | Ga0070707_1006933971 | 215 |
| 282 | 3300005471 | Ga0070698_100019886 | Ga0070698_1000198861 | 215 |
| 283 | 3300005471 | Ga0070698_100026461 | Ga0070698_1000264615 | 215 |
| 284 | 3300005518 | Ga0070699_100010521 | Ga0070699_1000105218 | 215 |
| 285 | 3300005518 | Ga0070699_100048193 | Ga0070699_1000481932 | 215 |
| 286 | 3300005518 | Ga0070699_100070986 | Ga0070699_1000709864 | 215 |
| 287 | 3300005518 | Ga0070699_100092479 | Ga0070699_1000924794 | 215 |
| 288 | 3300005518 | Ga0070699_100433750 | Ga0070699_1004337502 | 215 |
| 289 | 3300005518 | Ga0070699_100600418 | Ga0070699_1006004181 | 215 |
| 290 | 3300005518 | Ga0070699_100763800 | Ga0070699_1007638001 | 215 |
| 291 | 3300005518 | Ga0070699_100991659 | Ga0070699_1009916591 | 215 |
| 292 | 3300005530 | Ga0070679_100002107 | Ga0070679_1000021076 | 215 |
| 293 | 3300005536 | Ga0070697_100000438 | Ga0070697_1000004389 | 215 |
| 294 | 3300005536 | Ga0070697_100002186 | Ga0070697_10000218612 | 215 |
| 295 | 3300005536 | Ga0070697_100094787 | Ga0070697_1000947871 | 215 |
| 296 | 3300005536 | Ga0070697_100230167 | Ga0070697_1002301672 | 215 |
| 297 | 3300005536 | Ga0070697_100716426 | Ga0070697_1007164261 | 215 |
| 298 | 3300005536 | Ga0070697_100967023 | Ga0070697_1009670231 | 215 |
| 299 | 3300005543 | Ga0070672_100412207 | Ga0070672_1004122071 | 215 |
| 300 | 3300005543 | Ga0070672_100438337 | Ga0070672_1004383372 | 215 |
| 301 | 3300005544 | Ga0070686_100001507 | Ga0070686_1000015077 | 215 |
| 302 | 3300005544 | Ga0070686_100049648 | Ga0070686_1000496481 | 215 |
| 303 | 3300005544 | Ga0070686_100156706 | Ga0070686_1001567063 | 215 |
| 304 | 3300005544 | Ga0070686_100219885 | Ga0070686_1002198852 | 215 |
| 305 | 3300005545 | Ga0070695_100042394 | Ga0070695_1000423941 | 215 |
| 306 | 3300005545 | Ga0070695_100071804 | Ga0070695_1000718042 | 215 |
| 307 | 3300005545 | Ga0070695_100076985 | Ga0070695_1000769851 | 215 |
| 308 | 3300005545 | Ga0070695_100107704 | Ga0070695_1001077043 | 215 |
| 309 | 3300005545 | Ga0070695_100137801 | Ga0070695_1001378012 | 215 |
| 310 | 3300005545 | Ga0070695_100412779 | Ga0070695_1004127792 | 215 |
| 311 | 3300005545 | Ga0070695_100641558 | Ga0070695_1006415581 | 215 |
| 312 | 3300005546 | Ga0070696_100029427 | Ga0070696_1000294271 | 215 |
| 313 | 3300005546 | Ga0070696_100040019 | Ga0070696_1000400194 | 215 |
| 314 | 3300005546 | Ga0070696_100040419 | Ga0070696_1000404194 | 215 |
| 315 | 3300005546 | Ga0070696_100041611 | Ga0070696_1000416112 | 215 |
| 316 | 3300005546 | Ga0070696_100082236 | Ga0070696_1000822361 | 215 |
| 317 | 3300005546 | Ga0070696_100281601 | Ga0070696_1002816012 | 215 |
| 318 | 3300005546 | Ga0070696_100311083 | Ga0070696_1003110831 | 215 |
| 319 | 3300005546 | Ga0070696_100649982 | Ga0070696_1006499821 | 215 |
| 320 | 3300005547 | Ga0070693_100074871 | Ga0070693_1000748711 | 215 |
| 321 | 3300005547 | Ga0070693_100103332 | Ga0070693_1001033322 | 215 |
| 322 | 3300005547 | Ga0070693_100237665 | Ga0070693_1002376651 | 215 |
| 323 | 3300005547 | Ga0070693_100433314 | Ga0070693_1004333141 | 215 |
| 324 | 3300005547 | Ga0070693_100458543 | Ga0070693_1004585431 | 215 |
| 325 | 3300005549 | Ga0070704_100003983 | Ga0070704_1000039836 | 215 |
| 326 | 3300005549 | Ga0070704_100039745 | Ga0070704_1000397453 | 215 |
| 327 | 3300005549 | Ga0070704_100064854 | Ga0070704_1000648543 | 215 |
| 328 | 3300005563 | Ga0068855_100748904 | Ga0068855_1007489042 | 215 |
| 329 | 3300005564 | Ga0070664_100666061 | Ga0070664_1006660611 | 215 |
| 330 | 3300005577 | Ga0068857_100166074 | Ga0068857_1001660742 | 215 |
| 331 | 3300005578 | Ga0068854_100091220 | Ga0068854_1000912204 | 215 |
| 332 | 3300005615 | Ga0070702_100022160 | Ga0070702_1000221601 | 215 |
| 333 | 3300005617 | Ga0068859_100007834 | Ga0068859_1000078345 | 215 |
| 334 | 3300005617 | Ga0068859_100043818 | Ga0068859_1000438181 | 215 |
| 335 | 3300005617 | Ga0068859_100070457 | Ga0068859_1000704573 | 215 |
| 336 | 3300005617 | Ga0068859_100291040 | Ga0068859_1002910402 | 215 |
| 337 | 3300005617 | Ga0068859_100325190 | Ga0068859_1003251902 | 215 |
| 338 | 3300005617 | Ga0068859_100429032 | Ga0068859_1004290322 | 215 |
| 339 | 3300005617 | Ga0068859_100512795 | Ga0068859_1005127951 | 215 |
| 340 | 3300005618 | Ga0068864_100067259 | Ga0068864_1000672594 | 215 |
| 341 | 3300005618 | Ga0068864_100168970 | Ga0068864_1001689703 | 215 |
| 342 | 3300005618 | Ga0068864_100352024 | Ga0068864_1003520242 | 215 |
| 343 | 3300005618 | Ga0068864_100536228 | Ga0068864_1005362281 | 215 |
| 344 | 3300005718 | Ga0068866_10121782 | Ga0068866_101217822 | 215 |
| 345 | 3300005719 | Ga0068861_100017383 | Ga0068861_1000173833 | 215 |
| 346 | 3300005719 | Ga0068861_100125852 | Ga0068861_1001258523 | 215 |
| 347 | 3300005719 | Ga0068861_100456270 | Ga0068861_1004562701 | 215 |
| 348 | 3300005719 | Ga0068861_100668036 | Ga0068861_1006680361 | 215 |
| 349 | 3300005719 | Ga0068861_101145717 | Ga0068861_1011457171 | 215 |
| 350 | 3300005834 | Ga0068851_10001177 | Ga0068851_100011774 | 215 |
| 351 | 3300005840 | Ga0068870_10082607 | Ga0068870_100826072 | 215 |
| 352 | 3300005840 | Ga0068870_10249820 | Ga0068870_102498202 | 215 |
| 353 | 3300005840 | Ga0068870_10288525 | Ga0068870_102885252 | 215 |
| 354 | 3300005840 | Ga0068870_10476098 | Ga0068870_104760981 | 215 |
| 355 | 3300005841 | Ga0068863_100679330 | Ga0068863_1006793302 | 215 |
| 356 | 3300005842 | Ga0068858_100001261 | Ga0068858_1000012617 | 215 |
| 357 | 3300005842 | Ga0068858_100230639 | Ga0068858_1002306392 | 215 |
| 358 | 3300005842 | Ga0068858_100356497 | Ga0068858_1003564972 | 215 |
| 359 | 3300005842 | Ga0068858_100473940 | Ga0068858_1004739401 | 215 |
| 360 | 3300005843 | Ga0068860_100303500 | Ga0068860_1003035002 | 215 |
| 361 | 3300005843 | Ga0068860_101417076 | Ga0068860_1014170761 | 215 |
| 362 | 3300005844 | Ga0068862_100029025 | Ga0068862_1000290254 | 215 |
| 363 | 3300005844 | Ga0068862_100238054 | Ga0068862_1002380542 | 215 |
| 364 | 3300005844 | Ga0068862_100599792 | Ga0068862_1005997921 | 215 |
| 365 | 3300005985 | Ga0081539_10000898 | Ga0081539_100008988 | 215 |
| 366 | 3300006358 | Ga0068871_100559521 | Ga0068871_1005595212 | 215 |
| 367 | 3300006844 | Ga0075428_100306290 | Ga0075428_1003062903 | 215 |
| 368 | 3300006844 | Ga0075428_100342300 | Ga0075428_1003423002 | 215 |
| 369 | 3300006844 | Ga0075428_100864419 | Ga0075428_1008644191 | 215 |
| 370 | 3300006846 | Ga0075430_100226825 | Ga0075430_1002268252 | 215 |
| 371 | 3300006846 | Ga0075430_100250246 | Ga0075430_1002502462 | 215 |
| 372 | 3300006846 | Ga0075430_100436073 | Ga0075430_1004360731 | 215 |
| 373 | 3300006847 | Ga0075431_100005951 | Ga0075431_1000059518 | 215 |
| 374 | 3300006847 | Ga0075431_100108057 | Ga0075431_1001080572 | 215 |
| 375 | 3300006847 | Ga0075431_100128547 | Ga0075431_1001285473 | 215 |
| 376 | 3300006852 | Ga0075433_10020523 | Ga0075433_100205232 | 215 |
| 377 | 3300006852 | Ga0075433_10028353 | Ga0075433_100283533 | 215 |
| 378 | 3300006852 | Ga0075433_10053421 | Ga0075433_100534212 | 215 |
| 379 | 3300006852 | Ga0075433_10072374 | Ga0075433_100723742 | 215 |
| 380 | 3300006852 | Ga0075433_10089846 | Ga0075433_100898463 | 215 |
| 381 | 3300006852 | Ga0075433_10139844 | Ga0075433_101398441 | 215 |
| 382 | 3300006852 | Ga0075433_10610270 | Ga0075433_106102701 | 215 |
| 383 | 3300006871 | Ga0075434_100018537 | Ga0075434_1000185377 | 215 |
| 384 | 3300006871 | Ga0075434_100028680 | Ga0075434_1000286803 | 215 |
| 385 | 3300006871 | Ga0075434_100106418 | Ga0075434_1001064183 | 215 |
| 386 | 3300006871 | Ga0075434_101278631 | Ga0075434_1012786311 | 215 |
| 387 | 3300006880 | Ga0075429_100040092 | Ga0075429_1000400922 | 215 |
| 388 | 3300006880 | Ga0075429_100091303 | Ga0075429_1000913032 | 215 |
| 389 | 3300006914 | Ga0075436_100008947 | Ga0075436_1000089476 | 215 |
| 390 | 3300006931 | Ga0097620_100007834 | Ga0097620_1000078345 | 215 |
| 391 | 3300006931 | Ga0097620_100043818 | Ga0097620_1000438181 | 215 |
| 392 | 3300006931 | Ga0097620_100070455 | Ga0097620_1000704552 | 215 |
| 393 | 3300006931 | Ga0097620_100291033 | Ga0097620_1002910332 | 215 |
| 394 | 3300006931 | Ga0097620_100325194 | Ga0097620_1003251942 | 215 |
| 395 | 3300006931 | Ga0097620_100429000 | Ga0097620_1004290001 | 215 |
| 396 | 3300006931 | Ga0097620_100512794 | Ga0097620_1005127942 | 215 |
| 397 | 3300007076 | Ga0075435_100209617 | Ga0075435_1002096173 | 215 |
| 398 | 3300007265 | Ga0099794_10144467 | Ga0099794_101444671 | 215 |
| 399 | 3300007788 | Ga0099795_10187434 | Ga0099795_101874341 | 215 |
| 400 | 3300009094 | Ga0111539_10004471 | Ga0111539_1000447115 | 215 |
| 401 | 3300009094 | Ga0111539_10061895 | Ga0111539_100618954 | 215 |
| 402 | 3300009094 | Ga0111539_10178567 | Ga0111539_101785673 | 215 |
| 403 | 3300009094 | Ga0111539_10251650 | Ga0111539_102516502 | 215 |
| 404 | 3300009098 | Ga0105245_10803055 | Ga0105245_108030551 | 215 |
| 405 | 3300009098 | Ga0105245_10998986 | Ga0105245_109989861 | 215 |
| 406 | 3300009098 | Ga0105245_11151096 | Ga0105245_111510961 | 215 |
| 407 | 3300009101 | Ga0105247_10000001 | Ga0105247_10000001555 | 215 |
| 408 | 3300009101 | Ga0105247_10327482 | Ga0105247_103274821 | 215 |
| 409 | 3300009147 | Ga0114129_10003333 | Ga0114129_1000333311 | 215 |
| 410 | 3300009147 | Ga0114129_10038702 | Ga0114129_100387021 | 215 |
| 411 | 3300009147 | Ga0114129_10061731 | Ga0114129_100617314 | 215 |
| 412 | 3300009147 | Ga0114129_10131197 | Ga0114129_101311973 | 215 |
| 413 | 3300009147 | Ga0114129_10232270 | Ga0114129_102322702 | 215 |
| 414 | 3300009147 | Ga0114129_10386533 | Ga0114129_103865331 | 215 |
| 415 | 3300009147 | Ga0114129_10703202 | Ga0114129_107032022 | 215 |
| 416 | 3300009147 | Ga0114129_11005074 | Ga0114129_110050741 | 215 |
| 417 | 3300009147 | Ga0114129_11007422 | Ga0114129_110074222 | 215 |
| 418 | 3300009147 | Ga0114129_11136260 | Ga0114129_111362602 | 215 |
| 419 | 3300009148 | Ga0105243_10000124 | Ga0105243_1000012460 | 215 |
| 420 | 3300009148 | Ga0105243_10000436 | Ga0105243_1000043630 | 215 |
| 421 | 3300009148 | Ga0105243_10049750 | Ga0105243_100497504 | 215 |
| 422 | 3300009148 | Ga0105243_10114163 | Ga0105243_101141633 | 215 |
| 423 | 3300009148 | Ga0105243_10383468 | Ga0105243_103834681 | 215 |
| 424 | 3300009148 | Ga0105243_10625560 | Ga0105243_106255601 | 215 |
| 425 | 3300009174 | Ga0105241_10071258 | Ga0105241_100712583 | 215 |
| 426 | 3300009174 | Ga0105241_10250662 | Ga0105241_102506621 | 215 |
| 427 | 3300009174 | Ga0105241_10529459 | Ga0105241_105294591 | 215 |
| 428 | 3300009176 | Ga0105242_10000021 | Ga0105242_1000002195 | 215 |
| 429 | 3300009176 | Ga0105242_10271146 | Ga0105242_102711462 | 215 |
| 430 | 3300009176 | Ga0105242_10841082 | Ga0105242_108410821 | 215 |
| 431 | 3300009177 | Ga0105248_10069315 | Ga0105248_100693152 | 215 |
| 432 | 3300009545 | Ga0105237_10006578 | Ga0105237_100065782 | 215 |
| 433 | 3300009545 | Ga0105237_10039930 | Ga0105237_100399302 | 215 |
| 434 | 3300009553 | Ga0105249_10042347 | Ga0105249_100423473 | 215 |
| 435 | 3300009553 | Ga0105249_10174569 | Ga0105249_101745692 | 215 |
| 436 | 3300009553 | Ga0105249_10225350 | Ga0105249_102253502 | 215 |
| 437 | 3300009553 | Ga0105249_10538463 | Ga0105249_105384632 | 215 |
| 438 | 3300009553 | Ga0105249_10595220 | Ga0105249_105952201 | 215 |
| 439 | 3300009553 | Ga0105249_10597823 | Ga0105249_105978232 | 215 |
| 440 | 3300010159 | Ga0099796_10070306 | Ga0099796_100703061 | 215 |
| 441 | 3300010375 | Ga0105239_10043879 | Ga0105239_100438795 | 215 |
| 442 | 3300010375 | Ga0105239_10090240 | Ga0105239_100902403 | 215 |
| 443 | 3300010375 | Ga0105239_11057616 | Ga0105239_110576161 | 215 |
| 444 | 3300011119 | Ga0105246_10163841 | Ga0105246_101638412 | 215 |
| 445 | 3300011119 | Ga0105246_10190435 | Ga0105246_101904352 | 215 |
| 446 | 3300011119 | Ga0105246_10400791 | Ga0105246_104007911 | 215 |
| 447 | 3300013100 | Ga0157373_10238865 | Ga0157373_102388652 | 215 |
| 448 | 3300013297 | Ga0157378_10000379 | Ga0157378_100003793 | 215 |
| 449 | 3300013297 | Ga0157378_10013290 | Ga0157378_100132906 | 215 |
| 450 | 3300013297 | Ga0157378_10019839 | Ga0157378_100198393 | 215 |
| 451 | 3300013297 | Ga0157378_10064345 | Ga0157378_100643453 | 215 |
| 452 | 3300013297 | Ga0157378_10094716 | Ga0157378_100947162 | 215 |
| 453 | 3300013297 | Ga0157378_10131278 | Ga0157378_101312784 | 215 |
| 454 | 3300013297 | Ga0157378_10390138 | Ga0157378_103901382 | 215 |
| 455 | 3300013297 | Ga0157378_10480197 | Ga0157378_104801972 | 215 |
| 456 | 3300013306 | Ga0163162_10016077 | Ga0163162_100160776 | 215 |
| 457 | 3300013306 | Ga0163162_10164920 | Ga0163162_101649203 | 215 |
| 458 | 3300013306 | Ga0163162_10279213 | Ga0163162_102792131 | 215 |
| 459 | 3300013306 | Ga0163162_11009000 | Ga0163162_110090001 | 215 |
| 460 | 3300013307 | Ga0157372_10115325 | Ga0157372_101153252 | 215 |
| 461 | 3300013308 | Ga0157375_10007377 | Ga0157375_100073778 | 215 |
| 462 | 3300013308 | Ga0157375_10021696 | Ga0157375_100216964 | 215 |
| 463 | 3300013308 | Ga0157375_10114446 | Ga0157375_101144462 | 215 |
| 464 | 3300014325 | Ga0163163_10115085 | Ga0163163_101150852 | 215 |
| 465 | 3300014325 | Ga0163163_11073599 | Ga0163163_110735991 | 215 |
| 466 | 3300014326 | Ga0157380_10001291 | Ga0157380_100012915 | 215 |
| 467 | 3300014326 | Ga0157380_10001861 | Ga0157380_1000186113 | 215 |
| 468 | 3300014326 | Ga0157380_10031640 | Ga0157380_100316403 | 215 |
| 469 | 3300014326 | Ga0157380_10081331 | Ga0157380_100813314 | 215 |
| 470 | 3300014326 | Ga0157380_10212352 | Ga0157380_102123522 | 215 |
| 471 | 3300014326 | Ga0157380_10361450 | Ga0157380_103614501 | 215 |
| 472 | 3300014745 | Ga0157377_10216200 | Ga0157377_102162002 | 215 |
| 473 | 3300014968 | Ga0157379_10266429 | Ga0157379_102664292 | 215 |
| 474 | 3300014968 | Ga0157379_10499591 | Ga0157379_104995912 | 215 |
| 475 | 3300014968 | Ga0157379_10862066 | Ga0157379_108620662 | 215 |
| 476 | 3300021384 | Ga0213876_10083750 | Ga0213876_100837502 | 215 |
| 477 | 3300025321 | Ga0207656_10019923 | Ga0207656_100199231 | 215 |
| 478 | 3300025885 | Ga0207653_10000163 | Ga0207653_100001636 | 215 |
| 479 | 3300025885 | Ga0207653_10000825 | Ga0207653_100008258 | 215 |
| 480 | 3300025885 | Ga0207653_10032887 | Ga0207653_100328871 | 215 |
| 481 | 3300025885 | Ga0207653_10054182 | Ga0207653_100541822 | 215 |
| 482 | 3300025893 | Ga0207682_10129840 | Ga0207682_101298402 | 215 |
| 483 | 3300025899 | Ga0207642_10033642 | Ga0207642_100336422 | 215 |
| 484 | 3300025900 | Ga0207710_10000003 | Ga0207710_1000000380 | 215 |
| 485 | 3300025901 | Ga0207688_10041601 | Ga0207688_100416013 | 215 |
| 486 | 3300025904 | Ga0207647_10141864 | Ga0207647_101418642 | 215 |
| 487 | 3300025906 | Ga0207699_10369802 | Ga0207699_103698022 | 215 |
| 488 | 3300025907 | Ga0207645_10067496 | Ga0207645_100674962 | 215 |
| 489 | 3300025907 | Ga0207645_10234079 | Ga0207645_102340792 | 215 |
| 490 | 3300025907 | Ga0207645_10297052 | Ga0207645_102970521 | 215 |
| 491 | 3300025908 | Ga0207643_10025868 | Ga0207643_100258684 | 215 |
| 492 | 3300025908 | Ga0207643_10239787 | Ga0207643_102397872 | 215 |
| 493 | 3300025910 | Ga0207684_10016170 | Ga0207684_100161702 | 215 |
| 494 | 3300025910 | Ga0207684_10030630 | Ga0207684_100306302 | 215 |
| 495 | 3300025911 | Ga0207654_10021362 | Ga0207654_100213624 | 215 |
| 496 | 3300025911 | Ga0207654_10456738 | Ga0207654_104567381 | 215 |
| 497 | 3300025912 | Ga0207707_10000080 | Ga0207707_1000008085 | 215 |
| 498 | 3300025914 | Ga0207671_10009947 | Ga0207671_100099473 | 215 |
| 499 | 3300025914 | Ga0207671_10217838 | Ga0207671_102178381 | 215 |
| 500 | 3300025917 | Ga0207660_10026610 | Ga0207660_100266103 | 215 |
| 501 | 3300025917 | Ga0207660_10137816 | Ga0207660_101378162 | 215 |
| 502 | 3300025918 | Ga0207662_10006191 | Ga0207662_100061913 | 215 |
| 503 | 3300025918 | Ga0207662_10146668 | Ga0207662_101466682 | 215 |
| 504 | 3300025918 | Ga0207662_10238991 | Ga0207662_102389912 | 215 |
| 505 | 3300025918 | Ga0207662_10470207 | Ga0207662_104702072 | 215 |
| 506 | 3300025921 | Ga0207652_10001974 | Ga0207652_100019749 | 215 |
| 507 | 3300025922 | Ga0207646_10006373 | Ga0207646_100063735 | 215 |
| 508 | 3300025922 | Ga0207646_10008262 | Ga0207646_100082626 | 215 |
| 509 | 3300025923 | Ga0207681_10302511 | Ga0207681_103025112 | 215 |
| 510 | 3300025925 | Ga0207650_10084552 | Ga0207650_100845522 | 215 |
| 511 | 3300025925 | Ga0207650_10129684 | Ga0207650_101296842 | 215 |
| 512 | 3300025925 | Ga0207650_10511585 | Ga0207650_105115852 | 215 |
| 513 | 3300025926 | Ga0207659_10249843 | Ga0207659_102498432 | 215 |
| 514 | 3300025926 | Ga0207659_10276841 | Ga0207659_102768412 | 215 |
| 515 | 3300025926 | Ga0207659_10724219 | Ga0207659_107242191 | 215 |
| 516 | 3300025927 | Ga0207687_10127494 | Ga0207687_101274943 | 215 |
| 517 | 3300025931 | Ga0207644_10006884 | Ga0207644_100068842 | 215 |
| 518 | 3300025931 | Ga0207644_10557494 | Ga0207644_105574941 | 215 |
| 519 | 3300025933 | Ga0207706_10598342 | Ga0207706_105983422 | 215 |
| 520 | 3300025933 | Ga0207706_10905139 | Ga0207706_109051391 | 215 |
| 521 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003124 | 215 |
| 522 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017183 | 215 |
| 523 | 3300025935 | Ga0207709_10001413 | Ga0207709_100014139 | 215 |
| 524 | 3300025935 | Ga0207709_10187682 | Ga0207709_101876822 | 215 |
| 525 | 3300025935 | Ga0207709_10373106 | Ga0207709_103731061 | 215 |
| 526 | 3300025939 | Ga0207665_10026931 | Ga0207665_100269312 | 215 |
| 527 | 3300025940 | Ga0207691_10568557 | Ga0207691_105685571 | 215 |
| 528 | 3300025941 | Ga0207711_10255711 | Ga0207711_102557112 | 215 |
| 529 | 3300025942 | Ga0207689_10184606 | Ga0207689_101846061 | 215 |
| 530 | 3300025942 | Ga0207689_10233449 | Ga0207689_102334492 | 215 |
| 531 | 3300025942 | Ga0207689_10325268 | Ga0207689_103252682 | 215 |
| 532 | 3300025942 | Ga0207689_10346251 | Ga0207689_103462512 | 215 |
| 533 | 3300025960 | Ga0207651_10020599 | Ga0207651_100205993 | 215 |
| 534 | 3300025960 | Ga0207651_10166053 | Ga0207651_101660532 | 215 |
| 535 | 3300025960 | Ga0207651_10577924 | Ga0207651_105779241 | 215 |
| 536 | 3300025961 | Ga0207712_10000180 | Ga0207712_1000018019 | 215 |
| 537 | 3300025961 | Ga0207712_10058094 | Ga0207712_100580943 | 215 |
| 538 | 3300025961 | Ga0207712_10360001 | Ga0207712_103600012 | 215 |
| 539 | 3300025972 | Ga0207668_10014287 | Ga0207668_100142875 | 215 |
| 540 | 3300025981 | Ga0207640_10590791 | Ga0207640_105907911 | 215 |
| 541 | 3300025981 | Ga0207640_10675190 | Ga0207640_106751901 | 215 |
| 542 | 3300025986 | Ga0207658_10376053 | Ga0207658_103760532 | 215 |
| 543 | 3300026023 | Ga0207677_10111181 | Ga0207677_101111812 | 215 |
| 544 | 3300026035 | Ga0207703_10002069 | Ga0207703_100020698 | 215 |
| 545 | 3300026035 | Ga0207703_10038722 | Ga0207703_100387222 | 215 |
| 546 | 3300026035 | Ga0207703_10553963 | Ga0207703_105539631 | 215 |
| 547 | 3300026035 | Ga0207703_10658530 | Ga0207703_106585302 | 215 |
| 548 | 3300026075 | Ga0207708_10001124 | Ga0207708_1000112417 | 215 |
| 549 | 3300026075 | Ga0207708_10035790 | Ga0207708_100357903 | 215 |
| 550 | 3300026075 | Ga0207708_10718931 | Ga0207708_107189311 | 215 |
| 551 | 3300026078 | Ga0207702_10024513 | Ga0207702_100245134 | 215 |
| 552 | 3300026089 | Ga0207648_10060567 | Ga0207648_100605673 | 215 |
| 553 | 3300026089 | Ga0207648_10240070 | Ga0207648_102400702 | 215 |
| 554 | 3300026089 | Ga0207648_10704928 | Ga0207648_107049281 | 215 |
| 555 | 3300026095 | Ga0207676_10243392 | Ga0207676_102433922 | 215 |
| 556 | 3300026095 | Ga0207676_10506852 | Ga0207676_105068522 | 215 |
| 557 | 3300026095 | Ga0207676_10674053 | Ga0207676_106740531 | 215 |
| 558 | 3300026095 | Ga0207676_10818931 | Ga0207676_108189311 | 215 |
| 559 | 3300026116 | Ga0207674_10059514 | Ga0207674_100595143 | 215 |
| 560 | 3300026118 | Ga0207675_100003630 | Ga0207675_1000036306 | 215 |
| 561 | 3300026118 | Ga0207675_100135208 | Ga0207675_1001352082 | 215 |
| 562 | 3300026118 | Ga0207675_100446645 | Ga0207675_1004466452 | 215 |
| 563 | 3300026118 | Ga0207675_101161577 | Ga0207675_1011615771 | 215 |
| 564 | 3300026121 | Ga0207683_10354861 | Ga0207683_103548611 | 215 |
| 565 | 3300027907 | Ga0207428_10002796 | Ga0207428_100027964 | 215 |
| 566 | 3300027907 | Ga0207428_10035987 | Ga0207428_100359873 | 215 |
| 567 | 3300027907 | Ga0207428_10247785 | Ga0207428_102477851 | 215 |
| 568 | 3300028380 | Ga0268265_10029493 | Ga0268265_100294933 | 215 |
| 569 | 3300028380 | Ga0268265_10185530 | Ga0268265_101855302 | 215 |
| 570 | 3300028380 | Ga0268265_10258243 | Ga0268265_102582432 | 215 |
| 571 | 3300028381 | Ga0268264_10330647 | Ga0268264_103306472 | 215 |
| 572 | 3300028381 | Ga0268264_10424031 | Ga0268264_104240312 | 215 |
| 573 | 3300030733 | Ga0314311_1222542 | Ga0314311_12225423 | 215 |
| 574 | 3300031548 | Ga0307408_100317938 | Ga0307408_1003179382 | 215 |
| 575 | 3300031548 | Ga0307408_100769980 | Ga0307408_1007699801 | 215 |
| 576 | 3300031731 | Ga0307405_10128925 | Ga0307405_101289252 | 215 |
| 577 | 3300031731 | Ga0307405_10240397 | Ga0307405_102403972 | 215 |
| 578 | 3300031901 | Ga0307406_10209501 | Ga0307406_102095012 | 215 |
| 579 | 3300031901 | Ga0307406_10694595 | Ga0307406_106945951 | 215 |
| 580 | 3300031911 | Ga0307412_10133627 | Ga0307412_101336272 | 215 |
| 581 | 3300032002 | Ga0307416_100070396 | Ga0307416_1000703965 | 215 |
| 582 | 3300032002 | Ga0307416_100180972 | Ga0307416_1001809722 | 215 |
| 583 | 3300032004 | Ga0307414_10692211 | Ga0307414_106922111 | 215 |
| 584 | 3300032005 | Ga0307411_10349869 | Ga0307411_103498692 | 215 |
| 585 | 3300032126 | Ga0307415_100218038 | Ga0307415_1002180383 | 215 |
| 586 | 3300038996 | Ga0242420_001536 | Ga0242420_001536_119_775 | 215 |
| 587 | 3300038996 | Ga0242420_010818 | Ga0242420_010818_657_1304 | 215 |
| 588 | 3300039437 | Ga0436365_0394125 | Ga0436365_0394125_2543_3235 | 215 |
| 589 | 3300041999 | Ga0439433_0092665 | Ga0439433_0092665_84_731 | 215 |
| 590 | 3300042876 | Ga0451577_0291501 | Ga0451577_0291501_407_1063 | 215 |
| 591 | 3300044673 | Ga0453683_0030304 | Ga0453683_0030304_707_1363 | 215 |
| 592 | 3300045051 | Ga0451576_0696384 | Ga0451576_0696384_64_711 | 215 |
| 593 | 3300045051 | Ga0451576_0699737 | Ga0451576_0699737_170_817 | 215 |
| 594 | 3300046512 | Ga0495610_0048285 | Ga0495610_0048285_631_1278 | 215 |
| 595 | 3300046525 | Ga0495663_0000122 | Ga0495663_0000122_13524_14171 | 215 |
| 596 | 3300046537 | Ga0495598_0001729 | Ga0495598_0001729_2454_3101 | 215 |
| 597 | 3300046537 | Ga0495598_0004536 | Ga0495598_0004536_2225_2872 | 215 |
| 598 | 3300046539 | Ga0495621_0037742 | Ga0495621_0037742_291_938 | 215 |
| 599 | 3300046664 | Ga0495659_0004579 | Ga0495659_0004579_1916_2563 | 215 |
| 600 | 3300047318 | Ga0495636_0207908 | Ga0495636_0207908_35_691 | 215 |
| 601 | 3300048905 | Ga0496102_0866998 | Ga0496102_0866998_18_665 | 215 |
| 602 | 3300048907 | Ga0496104_0734661 | Ga0496104_0734661_24_671 | 215 |
| 603 | 3300048909 | Ga0496106_0014031 | Ga0496106_0014031_3221_3877 | 215 |
| 604 | 3300048909 | Ga0496106_0127452 | Ga0496106_0127452_1250_1897 | 215 |
| 605 | 3300048909 | Ga0496106_0136244 | Ga0496106_0136244_223_870 | 215 |
| 606 | 3300048910 | Ga0496107_0253773 | Ga0496107_0253773_149_796 | 215 |
| 607 | 3300048911 | Ga0496108_0388182 | Ga0496108_0388182_76_723 | 215 |
| 608 | 3300048915 | Ga0496112_0598222 | Ga0496112_0598222_258_905 | 215 |
| 609 | 3300049514 | Ga0501291_019026 | Ga0501291_019026_86_733 | 215 |
| 610 | 3300049518 | Ga0501295_042387 | Ga0501295_042387_172_819 | 215 |
| 611 | 3300049522 | Ga0501299_051604 | Ga0501299_051604_159_806 | 215 |
| 612 | 3300049523 | Ga0501300_012663 | Ga0501300_012663_286_933 | 215 |
| 613 | 3300049588 | Ga0501072_0523912 | Ga0501072_0523912_243_890 | 215 |
| 614 | 3300049591 | Ga0501075_0319470 | Ga0501075_0319470_164_811 | 215 |
| 615 | 3300049653 | Ga0501206_009937 | Ga0501206_009937_38_685 | 215 |
| 616 | 3300049654 | Ga0501207_008145 | Ga0501207_008145_259_906 | 215 |
| 617 | 3300049655 | Ga0501208_005920 | Ga0501208_005920_399_1046 | 215 |
| 618 | 3300049661 | Ga0501217_014045 | Ga0501217_014045_410_1057 | 215 |
| 619 | 3300049675 | Ga0501243_006435 | Ga0501243_006435_1021_1668 | 215 |
| 620 | 3300049705 | Ga0501225_0013604 | Ga0501225_0013604_260_907 | 215 |
| 621 | 3300049707 | Ga0501234_027812 | Ga0501234_027812_177_824 | 215 |
| 622 | 3300049769 | Ga0501272_006159 | Ga0501272_006159_323_970 | 215 |
| 623 | 3300049770 | Ga0501273_010836 | Ga0501273_010836_166_813 | 215 |
| 624 | 3300049776 | Ga0501280_007910 | Ga0501280_007910_120_767 | 215 |
| 625 | 3300049851 | Ga0501212_001102 | Ga0501212_001102_570_1217 | 215 |
| 626 | 3300050507 | nmdc:mga05p37_114743_c1 | nmdc:mga05p37_114743_c1_2599_3246 | 215 |
| 627 | 3300050507 | nmdc:mga05p37_1192297_c1 | nmdc:mga05p37_1192297_c1_19_666 | 215 |
| 628 | 3300050507 | nmdc:mga05p37_124133_c1 | nmdc:mga05p37_124133_c1_2353_3000 | 215 |
| 629 | 3300050507 | nmdc:mga05p37_147370_c1 | nmdc:mga05p37_147370_c1_221_868 | 215 |
| 630 | 3300050507 | nmdc:mga05p37_14770_c1 | nmdc:mga05p37_14770_c1_4859_5512 | 215 |
| 631 | 3300050507 | nmdc:mga05p37_241878_c1 | nmdc:mga05p37_241878_c1_1474_2130 | 215 |
| 632 | 3300050507 | nmdc:mga05p37_26820_c1 | nmdc:mga05p37_26820_c1_2375_3022 | 215 |
| 633 | 3300050507 | nmdc:mga05p37_59851_c1 | nmdc:mga05p37_59851_c1_1906_2562 | 215 |
| 634 | 3300050507 | nmdc:mga05p37_801592_c1 | nmdc:mga05p37_801592_c1_193_840 | 215 |
| 635 | 3300050507 | nmdc:mga05p37_844989_c1 | nmdc:mga05p37_844989_c1_47_694 | 215 |
| 636 | 3300050507 | nmdc:mga05p37_9803_c1 | nmdc:mga05p37_9803_c1_4784_5479 | 215 |
| 637 | 3300050508 | nmdc:mga09592_171380_c1 | nmdc:mga09592_171380_c1_892_1539 | 215 |
| 638 | 3300050508 | nmdc:mga09592_86211_c1 | nmdc:mga09592_86211_c1_1199_1846 | 215 |
| 639 | 3300050509 | nmdc:mga0qj67_412595_c1 | nmdc:mga0qj67_412595_c1_135_782 | 215 |
| 640 | 3300050510 | nmdc:mga06r32_109410_c1 | nmdc:mga06r32_109410_c1_391_1038 | 215 |
| 641 | 3300050511 | nmdc:mga08y16_3098_c1 | nmdc:mga08y16_3098_c1_11902_12549 | 215 |
| 642 | 3300050511 | nmdc:mga08y16_397058_c1 | nmdc:mga08y16_397058_c1_165_812 | 215 |
| 643 | 3300050512 | nmdc:mga0n895_127529_c1 | nmdc:mga0n895_127529_c1_1879_2526 | 215 |
| 644 | 3300050512 | nmdc:mga0n895_180966_c1 | nmdc:mga0n895_180966_c1_763_1410 | 215 |
| 645 | 3300050512 | nmdc:mga0n895_192108_c1 | nmdc:mga0n895_192108_c1_548_1204 | 215 |
| 646 | 3300050512 | nmdc:mga0n895_509276_c1 | nmdc:mga0n895_509276_c1_479_1126 | 215 |
| 647 | 3300050512 | nmdc:mga0n895_71066_c1 | nmdc:mga0n895_71066_c1_2713_3369 | 215 |
| 648 | 3300050513 | nmdc:mga0rr50_229844_c1 | nmdc:mga0rr50_229844_c1_380_1027 | 215 |
| 649 | 3300050515 | nmdc:mga0a205_123017_c1 | nmdc:mga0a205_123017_c1_214_861 | 215 |
| 650 | 3300050515 | nmdc:mga0a205_219490_c1 | nmdc:mga0a205_219490_c1_243_938 | 215 |
| 651 | 3300050515 | nmdc:mga0a205_220467_c1 | nmdc:mga0a205_220467_c1_890_1537 | 215 |
| 652 | 3300050515 | nmdc:mga0a205_357291_c1 | nmdc:mga0a205_357291_c1_528_1184 | 215 |
| 653 | 3300050515 | nmdc:mga0a205_40562_c1 | nmdc:mga0a205_40562_c1_945_1601 | 215 |
| 654 | 3300050515 | nmdc:mga0a205_6769_c2 | nmdc:mga0a205_6769_c2_4957_5604 | 215 |
| 655 | 3300050515 | nmdc:mga0a205_709314_c1 | nmdc:mga0a205_709314_c1_43_690 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dfj-assembly1.cif.gz_B | crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a | 0.873 | 5 | 208 |
| 2qjc-assembly1.cif.gz_A | crystal structure of a putative diadenosine tetraphosphatase | 0.8728 | 1 | 208 |
| 4j6o-assembly2.cif.gz_B | crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp | 0.866 | 3 | 215 |
| 4j6o-assembly2.cif.gz_B | crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp | 0.8546 | 3 | 215 |
| 2qjc-assembly1.cif.gz_A | crystal structure of a putative diadenosine tetraphosphatase | 0.8417 | 1 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dfjA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8751 | 5 | 208 | 3.60.21.10 |
| af_A4I019_330_570_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.868 | 2 | 208 | 3.60.21.10 |
| 4j6oB00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8613 | 3 | 215 | 3.60.21.10 |
| 4j6oB00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.85 | 3 | 215 | 3.60.21.10 |
| 2qjcA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8477 | 1 | 208 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8SG51-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9976 | 5 | 102 |
GO:0005737
GO:0016791 |
| AF-A0A7V9HZ02-F1-model_v4 | Metallophosphoesterase | 0.993 | 1 | 215 |
GO:0005737
GO:0016791 |
| AF-A0A2V8RET4-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9927 | 2 | 215 |
GO:0005737
GO:0016791 |
| AF-A0A2V8LIR4-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9908 | 3 | 215 |
GO:0005737
GO:0016791 |
| AF-A0A2V8RET4-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9835 | 2 | 215 |
GO:0005737
GO:0016791 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar