F472905

General Info

Members Datasets Scaffolds Average Seq Length
655 236 655 217

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100606528|Ga0070659_1006065281
Length 218
Sequence MSRTLIIGDIHGCFDELSALLEVFKPEHEDRVVAVGDLTVKGPKSRDVLELFMADARFSSVIGNHDFALVKHYRHGHKLKASQARVFDQLRTNDDRYLKFLESLPFLLQVGESVVVHAGLRPGVELGSQSKDDLIELRTLGEDRTDRSGTPWYQEYVGPMAVFGHWPSSEPRRGQFALGIDSGCVYGYELTGYIPEYGEFLKVPALMAYAPSTSNVQT

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
207 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
208 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
209 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
215 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
224 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
225 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
226 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
227 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
228 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6662657 2162886011 Bacteria 929
2 JGI24030J14995_100098 3300001426 Unclassified 2046
3 JGI24034J14986_100037 3300001432 Bacteria 4793
4 JGI24748J21848_1000007 3300002074 Bacteria 208838
5 JGI24034J26672_10000002 3300002239 Bacteria 925353
6 JGI24742J22300_10002227 3300002244 Unclassified 3093
7 Ga0065714_10002198 3300005288 Bacteria 90565
8 Ga0065704_10091881 3300005289 Unclassified 2688
9 Ga0065704_10322250 3300005289 Unclassified 851
10 Ga0065712_10000119 3300005290 Bacteria 137052
11 Ga0065712_10098197 3300005290 Bacteria 2127
12 Ga0065712_10300032 3300005290 Bacteria 862
13 Ga0065715_10002770 3300005293 Bacteria 6344
14 Ga0065715_10021680 3300005293 Bacteria 1857
15 Ga0065715_10089354 3300005293 Bacteria 10947
16 Ga0065715_10091482 3300005293 Bacteria 5762
17 Ga0065715_10233599 3300005293 Bacteria 1225
18 Ga0065707_10087432 3300005295 Bacteria 5028
19 Ga0065707_10247255 3300005295 Bacteria 1136
20 Ga0065707_10275915 3300005295 Bacteria 1028
21 Ga0065707_10367904 3300005295 Bacteria 894
22 Ga0070676_10030711 3300005328 Unclassified 3066
23 Ga0070676_10322528 3300005328 Bacteria 1054
24 Ga0070676_10356902 3300005328 Unclassified 1006
25 Ga0070690_100028362 3300005330 Bacteria 3466
26 Ga0070690_100033304 3300005330 Bacteria 3224
27 Ga0070690_100046197 3300005330 Bacteria 2768
28 Ga0070690_100227703 3300005330 Bacteria 1309
29 Ga0070690_100317039 3300005330 Unclassified 1122
30 Ga0070670_100001298 3300005331 Bacteria 19897
31 Ga0070670_100054717 3300005331 Bacteria 3426
32 Ga0070670_100067484 3300005331 Unclassified 3069
33 Ga0070670_100297161 3300005331 Bacteria 1412
34 Ga0068869_100007326 3300005334 Bacteria 7038
35 Ga0068869_100050973 3300005334 Viruses 3002
36 Ga0068869_100070758 3300005334 Bacteria 2582
37 Ga0068869_100247901 3300005334 Unclassified 1421
38 Ga0068869_100304080 3300005334 Bacteria 1289
39 Ga0068869_100481406 3300005334 Bacteria 1033
40 Ga0070680_100004282 3300005336 Bacteria 10720
41 Ga0070680_100029267 3300005336 Unclassified 4424
42 Ga0070680_100403826 3300005336 Unclassified 1165
43 Ga0070682_100000521 3300005337 Bacteria 24093
44 Ga0070682_100006312 3300005337 Bacteria 6653
45 Ga0070682_100082304 3300005337 Bacteria 2086
46 Ga0070682_100168847 3300005337 Unclassified 1518
47 Ga0068868_100205647 3300005338 Bacteria 1643
48 Ga0070660_100151453 3300005339 Unclassified 1865
49 Ga0070689_100365371 3300005340 Bacteria 1213
50 Ga0070691_10361503 3300005341 Unclassified 809
51 Ga0070687_100001368 3300005343 Bacteria 8535
52 Ga0070687_100130872 3300005343 Bacteria 1448
53 Ga0070687_100298848 3300005343 Bacteria 1021
54 Ga0070687_100447059 3300005343 Unclassified 859
55 Ga0070661_100039632 3300005344 Unclassified 3433
56 Ga0070692_10043655 3300005345 Bacteria 2306
57 Ga0070692_10052574 3300005345 Bacteria 2122
58 Ga0070692_10376916 3300005345 Unclassified 889
59 Ga0070669_100014746 3300005353 Bacteria 5565
60 Ga0070669_100133471 3300005353 Bacteria 1907
61 Ga0070675_100254440 3300005354 Bacteria 1538
62 Ga0070675_100524024 3300005354 Unclassified 1069
63 Ga0070675_100613685 3300005354 Bacteria 987
64 Ga0070675_100753690 3300005354 Bacteria 888
65 Ga0070671_100063676 3300005355 Unclassified 3071
66 Ga0070671_100117814 3300005355 Bacteria 2233
67 Ga0070671_100232866 3300005355 Bacteria 1563
68 Ga0070674_100084459 3300005356 Bacteria 2277
69 Ga0070674_100377721 3300005356 Bacteria 1152
70 Ga0070673_100019174 3300005364 Bacteria 4908
71 Ga0070673_100031146 3300005364 Bacteria 4000
72 Ga0070673_100032156 3300005364 Bacteria 3946
73 Ga0070673_100060934 3300005364 Bacteria 2992
74 Ga0070673_100177265 3300005364 Bacteria 1823
75 Ga0070673_100343711 3300005364 Unclassified 1323
76 Ga0070673_100441298 3300005364 Unclassified 1170
77 Ga0070659_100003236 3300005366 Bacteria 11592
78 Ga0070659_100606528 3300005366 Bacteria 941
79 Ga0070667_100075838 3300005367 Bacteria 2871
80 Ga0070667_100308962 3300005367 Bacteria 1425
81 Ga0070703_10000049 3300005406 Bacteria 58073
82 Ga0070703_10024402 3300005406 Bacteria 1787
83 Ga0070701_10067337 3300005438 Bacteria 1905
84 Ga0070701_10075517 3300005438 Unclassified 1812
85 Ga0070705_100037158 3300005440 Bacteria 2744
86 Ga0070705_100044060 3300005440 Bacteria 2561
87 Ga0070705_100065375 3300005440 Bacteria 2177
88 Ga0070705_100320810 3300005440 Unclassified 1118
89 Ga0070705_100549702 3300005440 Unclassified 885
90 Ga0070700_100001165 3300005441 Bacteria 12994
91 Ga0070700_100072607 3300005441 Bacteria 2200
92 Ga0070700_100079056 3300005441 Bacteria 2119
93 Ga0070694_100009560 3300005444 Bacteria 5948
94 Ga0070694_100021942 3300005444 Bacteria 4087
95 Ga0070694_100025088 3300005444 Unclassified 3855
96 Ga0070694_100049054 3300005444 Bacteria 2842
97 Ga0070694_100170601 3300005444 Bacteria 1603
98 Ga0070694_100487308 3300005444 Unclassified 979
99 Ga0070708_100001024 3300005445 Bacteria 21275
100 Ga0070708_100045110 3300005445 Unclassified 3882
101 Ga0070678_100175863 3300005456 Bacteria 1748
102 Ga0070662_100256599 3300005457 Unclassified 1407
103 Ga0070662_100290627 3300005457 Bacteria 1325
104 Ga0070662_100296969 3300005457 Unclassified 1311
105 Ga0070662_100345919 3300005457 Unclassified 1217
106 Ga0070662_100581101 3300005457 Bacteria 941
107 Ga0070681_10000383 3300005458 Bacteria 35789
108 Ga0070681_10001279 3300005458 Bacteria 21955
109 Ga0068867_100002030 3300005459 Bacteria 14153
110 Ga0068867_100043408 3300005459 Bacteria 3292
111 Ga0068867_100047363 3300005459 Bacteria 3160
112 Ga0070706_100000001 3300005467 Bacteria 342302
113 Ga0070706_100003314 3300005467 Bacteria 15900
114 Ga0070706_100013408 3300005467 Bacteria 7577
115 Ga0070707_100003580 3300005468 Bacteria 14649
116 Ga0070707_100009936 3300005468 Bacteria 8856
117 Ga0070707_100693397 3300005468 Unclassified 981
118 Ga0070698_100011527 3300005471 Bacteria 9381
119 Ga0070698_100019886 3300005471 Bacteria 7042
120 Ga0070698_100026115 3300005471 Bacteria 6082
121 Ga0070698_100026461 3300005471 Bacteria 6039
122 Ga0070699_100007970 3300005518 Bacteria 9197
123 Ga0070699_100010521 3300005518 Bacteria 8003
124 Ga0070699_100038258 3300005518 Bacteria 4153
125 Ga0070699_100048193 3300005518 Bacteria 3687
126 Ga0070699_100070986 3300005518 Unclassified 3028
127 Ga0070699_100092479 3300005518 Bacteria 2646
128 Ga0070699_100433750 3300005518 Bacteria 1190
129 Ga0070699_100600418 3300005518 Bacteria 1003
130 Ga0070699_100763800 3300005518 Unclassified 884
131 Ga0070699_100991659 3300005518 Unclassified 770
132 Ga0070679_100002107 3300005530 Bacteria 17921
133 Ga0070679_100068148 3300005530 Unclassified 3549
134 Ga0070684_100768561 3300005535 Unclassified 900
135 Ga0070697_100000438 3300005536 Bacteria 31877
136 Ga0070697_100002186 3300005536 Bacteria 15001
137 Ga0070697_100009933 3300005536 Bacteria 7423
138 Ga0070697_100074800 3300005536 Bacteria 2784
139 Ga0070697_100094787 3300005536 Bacteria 2474
140 Ga0070697_100230167 3300005536 Unclassified 1581
141 Ga0070697_100716426 3300005536 Unclassified 883
142 Ga0070697_100967023 3300005536 Bacteria 756
143 Ga0068853_100020464 3300005539 Bacteria 5502
144 Ga0068853_100345488 3300005539 Bacteria 1383
145 Ga0070672_100412207 3300005543 Bacteria 1159
146 Ga0070672_100438337 3300005543 Bacteria 1124
147 Ga0070686_100001507 3300005544 Bacteria 13100
148 Ga0070686_100049648 3300005544 Bacteria 2663
149 Ga0070686_100156706 3300005544 Bacteria 1600
150 Ga0070686_100219885 3300005544 Bacteria 1372
151 Ga0070695_100042394 3300005545 Bacteria 2889
152 Ga0070695_100071804 3300005545 Bacteria 2268
153 Ga0070695_100076985 3300005545 Bacteria 2197
154 Ga0070695_100107704 3300005545 Bacteria 1886
155 Ga0070695_100137801 3300005545 Bacteria 1689
156 Ga0070695_100412779 3300005545 Bacteria 1026
157 Ga0070695_100641558 3300005545 Unclassified 838
158 Ga0070696_100029427 3300005546 Bacteria 3754
159 Ga0070696_100040019 3300005546 Bacteria 3236
160 Ga0070696_100040419 3300005546 Unclassified 3220
161 Ga0070696_100041611 3300005546 Bacteria 3174
162 Ga0070696_100082236 3300005546 Bacteria 2283
163 Ga0070696_100281601 3300005546 Bacteria 1268
164 Ga0070696_100311083 3300005546 Unclassified 1209
165 Ga0070696_100396663 3300005546 Unclassified 1078
166 Ga0070696_100649982 3300005546 Unclassified 855
167 Ga0070693_100042517 3300005547 Bacteria 2560
168 Ga0070693_100074871 3300005547 Bacteria 2003
169 Ga0070693_100103332 3300005547 Bacteria 1740
170 Ga0070693_100237665 3300005547 Unclassified 1202
171 Ga0070693_100433314 3300005547 Archaea 919
172 Ga0070693_100458543 3300005547 Unclassified 896
173 Ga0070704_100003983 3300005549 Bacteria 8517
174 Ga0070704_100039745 3300005549 Unclassified 3232
175 Ga0070704_100064854 3300005549 Bacteria 2627
176 Ga0070704_100238957 3300005549 Unclassified 1486
177 Ga0068855_100748904 3300005563 Bacteria 1042
178 Ga0070664_100025486 3300005564 Unclassified 4902
179 Ga0070664_100209453 3300005564 Bacteria 1742
180 Ga0070664_100241183 3300005564 Bacteria 1623
181 Ga0070664_100666061 3300005564 Bacteria 968
182 Ga0068857_100026078 3300005577 Bacteria 5148
183 Ga0068857_100166074 3300005577 Unclassified 2004
184 Ga0068857_100179938 3300005577 Bacteria 1924
185 Ga0068854_100091220 3300005578 Unclassified 2267
186 Ga0068854_100142830 3300005578 Bacteria 1839
187 Ga0068856_100161748 3300005614 Bacteria 2249
188 Ga0070702_100022160 3300005615 Bacteria 3354
189 Ga0070702_100038912 3300005615 Bacteria 2652
190 Ga0068852_100921477 3300005616 Bacteria 891
191 Ga0068859_100004986 3300005617 Bacteria 13486
192 Ga0068859_100007834 3300005617 Bacteria 10840
193 Ga0068859_100030949 3300005617 Bacteria 5370
194 Ga0068859_100043818 3300005617 Bacteria 4497
195 Ga0068859_100053437 3300005617 Bacteria 4063
196 Ga0068859_100070457 3300005617 Bacteria 3532
197 Ga0068859_100291040 3300005617 Bacteria 1726
198 Ga0068859_100325190 3300005617 Bacteria 1632
199 Ga0068859_100429032 3300005617 Unclassified 1418
200 Ga0068859_100512795 3300005617 Archaea 1294
201 Ga0068859_100925601 3300005617 Unclassified 956
202 Ga0068864_100002803 3300005618 Bacteria 14392
203 Ga0068864_100046763 3300005618 Bacteria 3714
204 Ga0068864_100067259 3300005618 Bacteria 3111
205 Ga0068864_100123535 3300005618 Bacteria 2317
206 Ga0068864_100168970 3300005618 Unclassified 1993
207 Ga0068864_100352024 3300005618 Bacteria 1390
208 Ga0068864_100536228 3300005618 Bacteria 1130
209 Ga0068866_10015098 3300005718 Bacteria 3425
210 Ga0068866_10121782 3300005718 Bacteria 1471
211 Ga0068861_100015997 3300005719 Bacteria 5297
212 Ga0068861_100017383 3300005719 Bacteria 5104
213 Ga0068861_100059993 3300005719 Unclassified 2914
214 Ga0068861_100125852 3300005719 Bacteria 2073
215 Ga0068861_100302988 3300005719 Unclassified 1385
216 Ga0068861_100456270 3300005719 Bacteria 1146
217 Ga0068861_100668036 3300005719 Unclassified 962
218 Ga0068861_101145717 3300005719 Unclassified 749
219 Ga0068851_10001177 3300005834 Bacteria 11357
220 Ga0068870_10082607 3300005840 Bacteria 1779
221 Ga0068870_10249820 3300005840 Bacteria 1099
222 Ga0068870_10288525 3300005840 Bacteria 1031
223 Ga0068870_10476098 3300005840 Bacteria 828
224 Ga0068863_100068448 3300005841 Bacteria 3358
225 Ga0068863_100075068 3300005841 Bacteria 3199
226 Ga0068863_100515056 3300005841 Unclassified 1179
227 Ga0068863_100679330 3300005841 Unclassified 1022
228 Ga0068858_100001261 3300005842 Bacteria 26203
229 Ga0068858_100022386 3300005842 Bacteria 5900
230 Ga0068858_100041574 3300005842 Unclassified 4261
231 Ga0068858_100230639 3300005842 Bacteria 1755
232 Ga0068858_100356497 3300005842 Bacteria 1401
233 Ga0068858_100473940 3300005842 Bacteria 1208
234 Ga0068860_100236051 3300005843 Bacteria 1778
235 Ga0068860_100303500 3300005843 Bacteria 1564
236 Ga0068860_101417076 3300005843 Bacteria 716
237 Ga0068862_100029025 3300005844 Bacteria 4660
238 Ga0068862_100238054 3300005844 Unclassified 1654
239 Ga0068862_100599792 3300005844 Bacteria 1057
240 Ga0081539_10000898 3300005985 Bacteria 56680
241 Ga0097621_100008185 3300006237 Bacteria 7520
242 Ga0068871_100002467 3300006358 Bacteria 12633
243 Ga0068871_100009395 3300006358 Bacteria 7083
244 Ga0068871_100559521 3300006358 Unclassified 1036
245 Ga0068871_100600614 3300006358 Bacteria 1001
246 Ga0075428_100306290 3300006844 Unclassified 1708
247 Ga0075428_100342300 3300006844 Bacteria 1605
248 Ga0075428_100864419 3300006844 Bacteria 960
249 Ga0075428_100906089 3300006844 Bacteria 935
250 Ga0075430_100226825 3300006846 Bacteria 1549
251 Ga0075430_100250246 3300006846 Bacteria 1468
252 Ga0075430_100436073 3300006846 Bacteria 1081
253 Ga0075431_100005951 3300006847 Bacteria 12072
254 Ga0075431_100108057 3300006847 Bacteria 2871
255 Ga0075431_100128547 3300006847 Bacteria 2614
256 Ga0075433_10020523 3300006852 Bacteria 5527
257 Ga0075433_10028353 3300006852 Bacteria 4759
258 Ga0075433_10053421 3300006852 Bacteria 3522
259 Ga0075433_10072374 3300006852 Bacteria 3030
260 Ga0075433_10089846 3300006852 Bacteria 2715
261 Ga0075433_10139844 3300006852 Unclassified 2152
262 Ga0075433_10610270 3300006852 Bacteria 958
263 Ga0075434_100018537 3300006871 Bacteria 6725
264 Ga0075434_100028680 3300006871 Bacteria 5472
265 Ga0075434_100106418 3300006871 Bacteria 2815
266 Ga0075434_101278631 3300006871 Unclassified 745
267 Ga0075429_100040092 3300006880 Bacteria 4077
268 Ga0075429_100091303 3300006880 Bacteria 2657
269 Ga0068865_100030351 3300006881 Bacteria 3595
270 Ga0075436_100008947 3300006914 Bacteria 6854
271 Ga0097620_100004986 3300006931 Bacteria 13486
272 Ga0097620_100007834 3300006931 Bacteria 10840
273 Ga0097620_100030950 3300006931 Bacteria 5370
274 Ga0097620_100043818 3300006931 Bacteria 4497
275 Ga0097620_100053440 3300006931 Bacteria 4063
276 Ga0097620_100070455 3300006931 Bacteria 3532
277 Ga0097620_100291033 3300006931 Bacteria 1726
278 Ga0097620_100302886 3300006931 Unclassified 1692
279 Ga0097620_100325194 3300006931 Bacteria 1632
280 Ga0097620_100429000 3300006931 Unclassified 1418
281 Ga0097620_100512794 3300006931 Archaea 1294
282 Ga0097620_100925707 3300006931 Unclassified 956
283 Ga0075435_100209617 3300007076 Bacteria 1653
284 Ga0075435_100209643 3300007076 Bacteria 1653
285 Ga0099794_10144467 3300007265 Bacteria 1206
286 Ga0099795_10187434 3300007788 Bacteria 867
287 Ga0105240_10063290 3300009093 Bacteria 4602
288 Ga0111539_10004471 3300009094 Bacteria 18282
289 Ga0111539_10061895 3300009094 Unclassified 4433
290 Ga0111539_10178567 3300009094 Unclassified 2480
291 Ga0111539_10251650 3300009094 Bacteria 2057
292 Ga0111539_10345936 3300009094 Unclassified 1731
293 Ga0105245_10015028 3300009098 Bacteria 6746
294 Ga0105245_10803055 3300009098 Bacteria 979
295 Ga0105245_10998986 3300009098 Unclassified 881
296 Ga0105245_11151096 3300009098 Bacteria 823
297 Ga0105247_10000001 3300009101 Bacteria 739726
298 Ga0105247_10060962 3300009101 Bacteria 2339
299 Ga0105247_10327482 3300009101 Unclassified 1071
300 Ga0114129_10003333 3300009147 Bacteria 22577
301 Ga0114129_10038702 3300009147 Bacteria 6725
302 Ga0114129_10061731 3300009147 Bacteria 5238
303 Ga0114129_10131197 3300009147 Bacteria 3441
304 Ga0114129_10232270 3300009147 Bacteria 2484
305 Ga0114129_10386533 3300009147 Bacteria 1847
306 Ga0114129_10703202 3300009147 Bacteria 1299
307 Ga0114129_11005074 3300009147 Unclassified 1050
308 Ga0114129_11007422 3300009147 Bacteria 1049
309 Ga0114129_11136260 3300009147 Unclassified 976
310 Ga0105243_10000124 3300009148 Bacteria 87031
311 Ga0105243_10000436 3300009148 Bacteria 43715
312 Ga0105243_10003913 3300009148 Bacteria 11886
313 Ga0105243_10049750 3300009148 Bacteria 3308
314 Ga0105243_10114163 3300009148 Bacteria 2266
315 Ga0105243_10383468 3300009148 Bacteria 1301
316 Ga0105243_10625560 3300009148 Bacteria 1040
317 Ga0105241_10071258 3300009174 Bacteria 2698
318 Ga0105241_10250662 3300009174 Bacteria 1501
319 Ga0105241_10529459 3300009174 Unclassified 1055
320 Ga0105242_10000021 3300009176 Bacteria 115541
321 Ga0105242_10006988 3300009176 Bacteria 8713
322 Ga0105242_10114474 3300009176 Bacteria 2305
323 Ga0105242_10271146 3300009176 Unclassified 1537
324 Ga0105242_10841082 3300009176 Bacteria 912
325 Ga0105248_10005805 3300009177 Bacteria 13569
326 Ga0105248_10032138 3300009177 Bacteria 5865
327 Ga0105248_10069315 3300009177 Bacteria 3959
328 Ga0105248_10083368 3300009177 Unclassified 3596
329 Ga0105237_10006578 3300009545 Bacteria 12857
330 Ga0105237_10039930 3300009545 Bacteria 4734
331 Ga0105238_10618827 3300009551 Bacteria 1091
332 Ga0105249_10042347 3300009553 Bacteria 4141
333 Ga0105249_10174569 3300009553 Unclassified 2086
334 Ga0105249_10196432 3300009553 Bacteria 1972
335 Ga0105249_10225350 3300009553 Bacteria 1847
336 Ga0105249_10538463 3300009553 Bacteria 1217
337 Ga0105249_10595220 3300009553 Bacteria 1160
338 Ga0105249_10597823 3300009553 Bacteria 1158
339 Ga0105249_11332280 3300009553 Unclassified 790
340 Ga0099796_10070306 3300010159 Unclassified 1262
341 Ga0105239_10043879 3300010375 Bacteria 4903
342 Ga0105239_10090240 3300010375 Unclassified 3381
343 Ga0105239_11057616 3300010375 Bacteria 934
344 Ga0105239_11175605 3300010375 Unclassified 884
345 Ga0105246_10163841 3300011119 Archaea 1696
346 Ga0105246_10190435 3300011119 Unclassified 1587
347 Ga0105246_10400791 3300011119 Bacteria 1139
348 Ga0157373_10238865 3300013100 Bacteria 1284
349 Ga0157374_10082843 3300013296 Bacteria 3046
350 Ga0157374_10135832 3300013296 Bacteria 2384
351 Ga0157378_10000379 3300013297 Bacteria 43998
352 Ga0157378_10013290 3300013297 Bacteria 7199
353 Ga0157378_10013296 3300013297 Bacteria 7197
354 Ga0157378_10013817 3300013297 Bacteria 7060
355 Ga0157378_10019504 3300013297 Bacteria 5962
356 Ga0157378_10019839 3300013297 Bacteria 5910
357 Ga0157378_10064345 3300013297 Bacteria 3280
358 Ga0157378_10094716 3300013297 Bacteria 2719
359 Ga0157378_10131278 3300013297 Bacteria 2319
360 Ga0157378_10390138 3300013297 Bacteria 1369
361 Ga0157378_10480197 3300013297 Unclassified 1238
362 Ga0163162_10012958 3300013306 Bacteria 8138
363 Ga0163162_10016077 3300013306 Bacteria 7315
364 Ga0163162_10023010 3300013306 Bacteria 6145
365 Ga0163162_10164920 3300013306 Unclassified 2339
366 Ga0163162_10279213 3300013306 Bacteria 1802
367 Ga0163162_11009000 3300013306 Bacteria 941
368 Ga0157372_10045651 3300013307 Bacteria 4861
369 Ga0157372_10069140 3300013307 Unclassified 3972
370 Ga0157372_10115325 3300013307 Bacteria 3080
371 Ga0157375_10007377 3300013308 Bacteria 9625
372 Ga0157375_10021696 3300013308 Bacteria 5895
373 Ga0157375_10114446 3300013308 Unclassified 2799
374 Ga0157375_10187707 3300013308 Unclassified 2221
375 Ga0157375_10366866 3300013308 Bacteria 1606
376 Ga0163163_10008020 3300014325 Bacteria 9349
377 Ga0163163_10012225 3300014325 Bacteria 7814
378 Ga0163163_10028251 3300014325 Bacteria 5384
379 Ga0163163_10048588 3300014325 Bacteria 4173
380 Ga0163163_10115085 3300014325 Bacteria 2721
381 Ga0163163_11073599 3300014325 Unclassified 868
382 Ga0157380_10001291 3300014326 Bacteria 16301
383 Ga0157380_10001861 3300014326 Bacteria 13957
384 Ga0157380_10031640 3300014326 Bacteria 4064
385 Ga0157380_10081331 3300014326 Bacteria 2649
386 Ga0157380_10212352 3300014326 Unclassified 1725
387 Ga0157380_10361450 3300014326 Unclassified 1362
388 Ga0157377_10022713 3300014745 Bacteria 3317
389 Ga0157377_10028162 3300014745 Bacteria 3022
390 Ga0157377_10216200 3300014745 Unclassified 1225
391 Ga0157379_10180486 3300014968 Unclassified 1907
392 Ga0157379_10266429 3300014968 Unclassified 1557
393 Ga0157379_10499591 3300014968 Bacteria 1127
394 Ga0157379_10862066 3300014968 Bacteria 857
395 Ga0157376_10030500 3300014969 Bacteria 4306
396 Ga0157376_10158248 3300014969 Bacteria 2051
397 Ga0163161_10026181 3300017792 Unclassified 4132
398 Ga0163161_10081320 3300017792 Bacteria 2385
399 Ga0213876_10083750 3300021384 Bacteria 1687
400 Ga0207672_1000795 3300025223 Unclassified 3367
401 Ga0207697_10005901 3300025315 Bacteria 5624
402 Ga0207656_10019923 3300025321 Bacteria 2658
403 Ga0207653_10000163 3300025885 Bacteria 47337
404 Ga0207653_10000825 3300025885 Bacteria 10338
405 Ga0207653_10032887 3300025885 Bacteria 1679
406 Ga0207653_10054182 3300025885 Bacteria 1341
407 Ga0207682_10129840 3300025893 Bacteria 1124
408 Ga0207642_10033642 3300025899 Bacteria 2171
409 Ga0207710_10000003 3300025900 Bacteria 1071597
410 Ga0207710_10021224 3300025900 Bacteria 2781
411 Ga0207688_10041601 3300025901 Bacteria 2557
412 Ga0207680_10076168 3300025903 Bacteria 2094
413 Ga0207647_10141864 3300025904 Unclassified 1408
414 Ga0207699_10369802 3300025906 Bacteria 1016
415 Ga0207645_10067496 3300025907 Bacteria 2286
416 Ga0207645_10234079 3300025907 Bacteria 1213
417 Ga0207645_10297052 3300025907 Bacteria 1075
418 Ga0207643_10025868 3300025908 Unclassified 3246
419 Ga0207643_10239787 3300025908 Bacteria 1114
420 Ga0207684_10000286 3300025910 Bacteria 72634
421 Ga0207684_10010256 3300025910 Bacteria 8247
422 Ga0207684_10016170 3300025910 Bacteria 6411
423 Ga0207684_10030630 3300025910 Unclassified 4579
424 Ga0207654_10021362 3300025911 Bacteria 3442
425 Ga0207654_10456738 3300025911 Unclassified 896
426 Ga0207707_10000080 3300025912 Bacteria 96693
427 Ga0207707_10071957 3300025912 Bacteria 3014
428 Ga0207695_10104060 3300025913 Bacteria 2829
429 Ga0207671_10009947 3300025914 Bacteria 7903
430 Ga0207671_10217838 3300025914 Bacteria 1495
431 Ga0207660_10026610 3300025917 Bacteria 3940
432 Ga0207660_10137816 3300025917 Bacteria 1863
433 Ga0207660_10463937 3300025917 Unclassified 1025
434 Ga0207662_10006191 3300025918 Bacteria 6442
435 Ga0207662_10146668 3300025918 Bacteria 1498
436 Ga0207662_10238991 3300025918 Bacteria 1188
437 Ga0207662_10470207 3300025918 Bacteria 862
438 Ga0207649_10014254 3300025920 Unclassified 4448
439 Ga0207652_10001974 3300025921 Bacteria 17736
440 Ga0207652_10136637 3300025921 Unclassified 2189
441 Ga0207646_10006373 3300025922 Bacteria 12204
442 Ga0207646_10008262 3300025922 Bacteria 10449
443 Ga0207646_10196853 3300025922 Unclassified 1820
444 Ga0207646_10237350 3300025922 Bacteria 1647
445 Ga0207681_10001502 3300025923 Bacteria 15046
446 Ga0207681_10117473 3300025923 Bacteria 1945
447 Ga0207681_10302511 3300025923 Bacteria 1266
448 Ga0207694_10001759 3300025924 Bacteria 18159
449 Ga0207650_10001407 3300025925 Bacteria 17349
450 Ga0207650_10058628 3300025925 Bacteria 2867
451 Ga0207650_10084552 3300025925 Bacteria 2412
452 Ga0207650_10129684 3300025925 Bacteria 1972
453 Ga0207650_10511585 3300025925 Bacteria 1004
454 Ga0207659_10249843 3300025926 Bacteria 1439
455 Ga0207659_10276841 3300025926 Bacteria 1371
456 Ga0207659_10549955 3300025926 Unclassified 981
457 Ga0207659_10724219 3300025926 Bacteria 852
458 Ga0207687_10127494 3300025927 Bacteria 1913
459 Ga0207644_10006884 3300025931 Bacteria 7401
460 Ga0207644_10086786 3300025931 Unclassified 2324
461 Ga0207644_10102018 3300025931 Bacteria 2157
462 Ga0207644_10557494 3300025931 Unclassified 949
463 Ga0207706_10598342 3300025933 Bacteria 947
464 Ga0207706_10905139 3300025933 Unclassified 745
465 Ga0207686_10000003 3300025934 Bacteria 376934
466 Ga0207686_10066174 3300025934 Bacteria 2307
467 Ga0207709_10000017 3300025935 Bacteria 470753
468 Ga0207709_10001413 3300025935 Bacteria 16815
469 Ga0207709_10016805 3300025935 Bacteria 4076
470 Ga0207709_10187682 3300025935 Unclassified 1465
471 Ga0207709_10222440 3300025935 Bacteria 1362
472 Ga0207709_10373106 3300025935 Bacteria 1083
473 Ga0207670_10294525 3300025936 Bacteria 1269
474 Ga0207704_10012525 3300025938 Bacteria 4211
475 Ga0207665_10026931 3300025939 Bacteria 3798
476 Ga0207691_10568557 3300025940 Bacteria 961
477 Ga0207711_10008138 3300025941 Bacteria 8776
478 Ga0207711_10045821 3300025941 Bacteria 3736
479 Ga0207711_10049505 3300025941 Bacteria 3597
480 Ga0207711_10093311 3300025941 Unclassified 2651
481 Ga0207711_10212800 3300025941 Bacteria 1766
482 Ga0207711_10255711 3300025941 Bacteria 1609
483 Ga0207689_10001286 3300025942 Bacteria 24193
484 Ga0207689_10016417 3300025942 Bacteria 6268
485 Ga0207689_10158117 3300025942 Bacteria 1868
486 Ga0207689_10184606 3300025942 Bacteria 1720
487 Ga0207689_10233449 3300025942 Unclassified 1520
488 Ga0207689_10325268 3300025942 Unclassified 1276
489 Ga0207689_10346251 3300025942 Bacteria 1235
490 Ga0207679_10050471 3300025945 Unclassified 3040
491 Ga0207679_10262907 3300025945 Bacteria 1472
492 Ga0207679_10429087 3300025945 Bacteria 1168
493 Ga0207651_10020599 3300025960 Unclassified 3985
494 Ga0207651_10031485 3300025960 Bacteria 3392
495 Ga0207651_10120501 3300025960 Unclassified 1989
496 Ga0207651_10153369 3300025960 Bacteria 1796
497 Ga0207651_10166053 3300025960 Unclassified 1736
498 Ga0207651_10563174 3300025960 Bacteria 992
499 Ga0207651_10577924 3300025960 Unclassified 980
500 Ga0207712_10000180 3300025961 Bacteria 65420
501 Ga0207712_10058094 3300025961 Bacteria 2732
502 Ga0207712_10360001 3300025961 Bacteria 1212
503 Ga0207668_10014287 3300025972 Bacteria 4913
504 Ga0207640_10034507 3300025981 Bacteria 3158
505 Ga0207640_10590791 3300025981 Bacteria 939
506 Ga0207640_10675190 3300025981 Bacteria 883
507 Ga0207658_10260782 3300025986 Bacteria 1477
508 Ga0207658_10376053 3300025986 Bacteria 1243
509 Ga0207677_10111181 3300026023 Bacteria 2041
510 Ga0207703_10002069 3300026035 Bacteria 17649
511 Ga0207703_10031488 3300026035 Unclassified 4194
512 Ga0207703_10038722 3300026035 Bacteria 3807
513 Ga0207703_10091588 3300026035 Unclassified 2558
514 Ga0207703_10553963 3300026035 Bacteria 1084
515 Ga0207703_10658530 3300026035 Unclassified 994
516 Ga0207639_10059425 3300026041 Unclassified 2945
517 Ga0207708_10001124 3300026075 Bacteria 20108
518 Ga0207708_10035790 3300026075 Bacteria 3778
519 Ga0207708_10105844 3300026075 Unclassified 2181
520 Ga0207708_10718931 3300026075 Unclassified 855
521 Ga0207702_10024513 3300026078 Bacteria 5006
522 Ga0207641_10044300 3300026088 Unclassified 3742
523 Ga0207641_10198955 3300026088 Bacteria 1846
524 Ga0207648_10002250 3300026089 Bacteria 20862
525 Ga0207648_10060567 3300026089 Bacteria 3301
526 Ga0207648_10240070 3300026089 Bacteria 1613
527 Ga0207648_10704928 3300026089 Bacteria 935
528 Ga0207676_10004331 3300026095 Bacteria 10041
529 Ga0207676_10109467 3300026095 Bacteria 2308
530 Ga0207676_10243392 3300026095 Bacteria 1615
531 Ga0207676_10506852 3300026095 Bacteria 1147
532 Ga0207676_10674053 3300026095 Bacteria 1000
533 Ga0207676_10818931 3300026095 Unclassified 909
534 Ga0207674_10001135 3300026116 Bacteria 34563
535 Ga0207674_10059514 3300026116 Bacteria 3865
536 Ga0207674_10188958 3300026116 Unclassified 2010
537 Ga0207674_10216156 3300026116 Bacteria 1865
538 Ga0207674_10226575 3300026116 Bacteria 1817
539 Ga0207675_100003630 3300026118 Bacteria 15046
540 Ga0207675_100130908 3300026118 Bacteria 2379
541 Ga0207675_100135208 3300026118 Bacteria 2339
542 Ga0207675_100304308 3300026118 Unclassified 1553
543 Ga0207675_100446645 3300026118 Unclassified 1281
544 Ga0207675_101161577 3300026118 Unclassified 792
545 Ga0207683_10101495 3300026121 Bacteria 2569
546 Ga0207683_10354861 3300026121 Bacteria 1346
547 Ga0207698_10104836 3300026142 Bacteria 2354
548 Ga0207428_10002796 3300027907 Bacteria 17330
549 Ga0207428_10035987 3300027907 Bacteria 4041
550 Ga0207428_10247785 3300027907 Bacteria 1329
551 Ga0268265_10029493 3300028380 Bacteria 3938
552 Ga0268265_10185530 3300028380 Bacteria 1791
553 Ga0268265_10222225 3300028380 Bacteria 1653
554 Ga0268265_10258243 3300028380 Bacteria 1547
555 Ga0268265_10366611 3300028380 Unclassified 1321
556 Ga0268264_10080869 3300028381 Bacteria 2776
557 Ga0268264_10295645 3300028381 Bacteria 1522
558 Ga0268264_10330647 3300028381 Unclassified 1444
559 Ga0268264_10424031 3300028381 Bacteria 1284
560 Ga0314311_1222542 3300030733 Unclassified 2781
561 Ga0307408_100317938 3300031548 Bacteria 1310
562 Ga0307408_100769980 3300031548 Bacteria 871
563 Ga0307405_10128925 3300031731 Bacteria 1744
564 Ga0307405_10240397 3300031731 Bacteria 1341
565 Ga0307406_10209501 3300031901 Bacteria 1441
566 Ga0307406_10694595 3300031901 Unclassified 849
567 Ga0307412_10133627 3300031911 Bacteria 1806
568 Ga0307416_100070396 3300032002 Bacteria 2900
569 Ga0307416_100180972 3300032002 Bacteria 1976
570 Ga0307414_10692211 3300032004 Bacteria 922
571 Ga0307411_10349869 3300032005 Unclassified 1204
572 Ga0307415_100218038 3300032126 Unclassified 1527
573 Ga0373946_0254273 3300035171 Bacteria 858
574 Ga0395900_0075407 3300037418 Bacteria 3468
575 Ga0395898_0068505 3300037466 Bacteria 3434
576 Ga0395901_0145592 3300038443 Bacteria 2490
577 Ga0242420_001536 3300038996 Bacteria 3094
578 Ga0242420_010818 3300038996 Unclassified 1522
579 Ga0436365_0394125 3300039437 Bacteria 6649
580 Ga0439433_0092665 3300041999 Unclassified 744
581 Ga0451577_0291501 3300042876 Unclassified 1479
582 Ga0453683_0030304 3300044673 Bacteria 3420
583 Ga0451576_0696384 3300045051 Unclassified 1068
584 Ga0451576_0699737 3300045051 Unclassified 1065
585 Ga0495610_0048285 3300046512 Bacteria 2090
586 Ga0495663_0000122 3300046525 Bacteria 32201
587 Ga0495598_0001729 3300046537 Bacteria 4378
588 Ga0495598_0004536 3300046537 Bacteria 3015
589 Ga0495621_0037742 3300046539 Bacteria 1682
590 Ga0495659_0004579 3300046664 Unclassified 4352
591 Ga0495636_0207908 3300047318 Unclassified 895
592 Ga0496102_0866998 3300048905 Unclassified 825
593 Ga0496104_0734661 3300048907 Unclassified 894
594 Ga0496106_0014031 3300048909 Bacteria 5923
595 Ga0496106_0127452 3300048909 Bacteria 1994
596 Ga0496106_0136244 3300048909 Bacteria 1929
597 Ga0496107_0253773 3300048910 Unclassified 1309
598 Ga0496108_0388182 3300048911 Unclassified 1219
599 Ga0496112_0598222 3300048915 Unclassified 1035
600 Ga0501291_019026 3300049514 Unclassified 1074
601 Ga0501295_042387 3300049518 Unclassified 948
602 Ga0501299_051604 3300049522 Unclassified 851
603 Ga0501300_012663 3300049523 Unclassified 1229
604 Ga0501072_0523912 3300049588 Unclassified 937
605 Ga0501075_0319470 3300049591 Bacteria 1183
606 Ga0501206_009937 3300049653 Bacteria 1268
607 Ga0501207_008145 3300049654 Bacteria 1509
608 Ga0501208_005920 3300049655 Bacteria 1530
609 Ga0501216_007138 3300049660 Bacteria 1731
610 Ga0501217_014045 3300049661 Bacteria 1804
611 Ga0501217_090744 3300049661 Bacteria 857
612 Ga0501233_018107 3300049668 Unclassified 1478
613 Ga0501243_006435 3300049675 Bacteria 1778
614 Ga0501249_005337 3300049679 Bacteria 2627
615 Ga0501259_004049 3300049688 Bacteria 2331
616 Ga0501261_030256 3300049690 Unclassified 816
617 Ga0501225_0013604 3300049705 Bacteria 2276
618 Ga0501234_027812 3300049707 Unclassified 909
619 Ga0501245_020460 3300049708 Unclassified 1033
620 Ga0501272_006159 3300049769 Bacteria 1278
621 Ga0501273_010836 3300049770 Unclassified 1126
622 Ga0501280_007910 3300049776 Bacteria 1485
623 Ga0501212_001102 3300049851 Bacteria 2948
624 nmdc:mga05p37_114743_c1 3300050507 Bacteria 3311
625 nmdc:mga05p37_1192297_c1 3300050507 Unclassified 787
626 nmdc:mga05p37_124133_c1 3300050507 Bacteria 3171
627 nmdc:mga05p37_147370_c1 3300050507 Unclassified 2880
628 nmdc:mga05p37_14770_c1 3300050507 Bacteria 9377
629 nmdc:mga05p37_241878_c1 3300050507 Bacteria 2170
630 nmdc:mga05p37_26820_c1 3300050507 Bacteria 7008
631 nmdc:mga05p37_59851_c1 3300050507 Unclassified 4690
632 nmdc:mga05p37_801592_c1 3300050507 Unclassified 1030
633 nmdc:mga05p37_844989_c1 3300050507 Unclassified 995
634 nmdc:mga05p37_9803_c1 3300050507 Bacteria 11367
635 nmdc:mga09592_171380_c1 3300050508 Bacteria 1877
636 nmdc:mga09592_86211_c1 3300050508 Bacteria 2679
637 nmdc:mga0qj67_412595_c1 3300050509 Bacteria 1089
638 nmdc:mga06r32_109410_c1 3300050510 Bacteria 2717
639 nmdc:mga08y16_3098_c1 3300050511 Bacteria 17205
640 nmdc:mga08y16_397058_c1 3300050511 Bacteria 1412
641 nmdc:mga0n895_127529_c1 3300050512 Bacteria 2568
642 nmdc:mga0n895_180966_c1 3300050512 Bacteria 2139
643 nmdc:mga0n895_192108_c1 3300050512 Unclassified 2073
644 nmdc:mga0n895_509276_c1 3300050512 Bacteria 1212
645 nmdc:mga0n895_71066_c1 3300050512 Bacteria 3450
646 nmdc:mga0n895_820493_c1 3300050512 Bacteria 919
647 nmdc:mga0rr50_109283_c1 3300050513 Unclassified 2186
648 nmdc:mga0rr50_229844_c1 3300050513 Bacteria 1534
649 nmdc:mga0a205_123017_c1 3300050515 Unclassified 2494
650 nmdc:mga0a205_219490_c1 3300050515 Bacteria 1787
651 nmdc:mga0a205_220467_c1 3300050515 Bacteria 1782
652 nmdc:mga0a205_357291_c1 3300050515 Bacteria 1328
653 nmdc:mga0a205_40562_c1 3300050515 Bacteria 4482
654 nmdc:mga0a205_6769_c2 3300050515 Bacteria 9509
655 nmdc:mga0a205_709314_c1 3300050515 Unclassified 856

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10226575 Ga0207674_102265752 181
2 3300001432 JGI24034J14986_100037 JGI24034J14986_1000374 208
3 3300005617 Ga0068859_100925601 Ga0068859_1009256012 208
4 3300006931 Ga0097620_100925707 Ga0097620_1009257072 208
5 3300025223 Ga0207672_1000795 Ga0207672_10007954 208
6 3300025922 Ga0207646_10196853 Ga0207646_101968532 208
7 3300005293 Ga0065715_10233599 Ga0065715_102335992 210
8 3300005334 Ga0068869_100050973 Ga0068869_1000509732 210
9 3300005338 Ga0068868_100205647 Ga0068868_1002056471 210
10 3300005340 Ga0070689_100365371 Ga0070689_1003653711 210
11 3300005355 Ga0070671_100117814 Ga0070671_1001178141 210
12 3300005367 Ga0070667_100308962 Ga0070667_1003089621 210
13 3300005564 Ga0070664_100209453 Ga0070664_1002094532 210
14 3300005616 Ga0068852_100921477 Ga0068852_1009214771 210
15 3300005617 Ga0068859_100004986 Ga0068859_1000049864 210
16 3300005618 Ga0068864_100046763 Ga0068864_1000467633 210
17 3300005842 Ga0068858_100041574 Ga0068858_1000415742 210
18 3300006358 Ga0068871_100002467 Ga0068871_10000246711 210
19 3300006931 Ga0097620_100004986 Ga0097620_1000049864 210
20 3300025936 Ga0207670_10294525 Ga0207670_102945252 210
21 3300025941 Ga0207711_10093311 Ga0207711_100933111 210
22 3300025942 Ga0207689_10016417 Ga0207689_100164172 210
23 3300025945 Ga0207679_10429087 Ga0207679_104290871 210
24 3300025960 Ga0207651_10120501 Ga0207651_101205011 210
25 3300025986 Ga0207658_10260782 Ga0207658_102607822 210
26 3300026035 Ga0207703_10031488 Ga0207703_100314883 210
27 3300026095 Ga0207676_10004331 Ga0207676_100043314 210
28 3300026142 Ga0207698_10104836 Ga0207698_101048361 210
29 3300028381 Ga0268264_10295645 Ga0268264_102956451 210
30 3300005366 Ga0070659_100606528 Ga0070659_1006065281 212
31 3300005842 Ga0068858_100022386 Ga0068858_1000223862 212
32 3300005843 Ga0068860_100236051 Ga0068860_1002360512 212
33 3300007076 Ga0075435_100209643 Ga0075435_1002096432 212
34 3300009177 Ga0105248_10083368 Ga0105248_100833682 212
35 3300013306 Ga0163162_10012958 Ga0163162_100129582 212
36 3300013308 Ga0157375_10187707 Ga0157375_101877072 212
37 3300014325 Ga0163163_10012225 Ga0163163_100122252 212
38 3300014968 Ga0157379_10180486 Ga0157379_101804862 212
39 3300025941 Ga0207711_10049505 Ga0207711_100495052 212
40 3300026035 Ga0207703_10091588 Ga0207703_100915882 212
41 3300028381 Ga0268264_10080869 Ga0268264_100808692 212
42 3300050513 nmdc:mga0rr50_109283_c1 nmdc:mga0rr50_109283_c1_943_1581 212
43 3300005293 Ga0065715_10021680 Ga0065715_100216802 213
44 3300005331 Ga0070670_100067484 Ga0070670_1000674843 213
45 3300005336 Ga0070680_100029267 Ga0070680_1000292672 213
46 3300005337 Ga0070682_100082304 Ga0070682_1000823042 213
47 3300005339 Ga0070660_100151453 Ga0070660_1001514532 213
48 3300005344 Ga0070661_100039632 Ga0070661_1000396322 213
49 3300005366 Ga0070659_100003236 Ga0070659_1000032369 213
50 3300005438 Ga0070701_10075517 Ga0070701_100755172 213
51 3300005458 Ga0070681_10000383 Ga0070681_1000038312 213
52 3300005459 Ga0068867_100002030 Ga0068867_10000203010 213
53 3300005467 Ga0070706_100000001 Ga0070706_100000001270 213
54 3300005530 Ga0070679_100068148 Ga0070679_1000681482 213
55 3300005535 Ga0070684_100768561 Ga0070684_1007685611 213
56 3300005539 Ga0068853_100020464 Ga0068853_1000204642 213
57 3300005564 Ga0070664_100025486 Ga0070664_1000254863 213
58 3300005577 Ga0068857_100026078 Ga0068857_1000260782 213
59 3300005618 Ga0068864_100002803 Ga0068864_1000028031 213
60 3300009551 Ga0105238_10618827 Ga0105238_106188271 213
61 3300013307 Ga0157372_10069140 Ga0157372_100691402 213
62 3300014745 Ga0157377_10022713 Ga0157377_100227132 213
63 3300025910 Ga0207684_10000286 Ga0207684_1000028630 213
64 3300025912 Ga0207707_10071957 Ga0207707_100719571 213
65 3300025917 Ga0207660_10463937 Ga0207660_104639371 213
66 3300025920 Ga0207649_10014254 Ga0207649_100142542 213
67 3300025921 Ga0207652_10136637 Ga0207652_101366372 213
68 3300025925 Ga0207650_10058628 Ga0207650_100586282 213
69 3300025945 Ga0207679_10050471 Ga0207679_100504711 213
70 3300026041 Ga0207639_10059425 Ga0207639_100594252 213
71 3300026116 Ga0207674_10001135 Ga0207674_100011355 213
72 3300037418 Ga0395900_0075407 Ga0395900_0075407_1696_2337 213
73 3300037466 Ga0395898_0068505 Ga0395898_0068505_2161_2802 213
74 3300038443 Ga0395901_0145592 Ga0395901_0145592_547_1188 213
75 3300050512 nmdc:mga0n895_820493_c1 nmdc:mga0n895_820493_c1_198_839 213
76 3300005288 Ga0065714_10002198 Ga0065714_1000219833 214
77 3300005290 Ga0065712_10000119 Ga0065712_1000011930 214
78 3300005293 Ga0065715_10089354 Ga0065715_100893545 214
79 3300005330 Ga0070690_100033304 Ga0070690_1000333042 214
80 3300005331 Ga0070670_100001298 Ga0070670_1000012989 214
81 3300005334 Ga0068869_100070758 Ga0068869_1000707582 214
82 3300005334 Ga0068869_100481406 Ga0068869_1004814061 214
83 3300005341 Ga0070691_10361503 Ga0070691_103615031 214
84 3300005353 Ga0070669_100014746 Ga0070669_1000147462 214
85 3300005353 Ga0070669_100133471 Ga0070669_1001334711 214
86 3300005354 Ga0070675_100524024 Ga0070675_1005240241 214
87 3300005355 Ga0070671_100232866 Ga0070671_1002328662 214
88 3300005356 Ga0070674_100084459 Ga0070674_1000844591 214
89 3300005364 Ga0070673_100031146 Ga0070673_1000311462 214
90 3300005364 Ga0070673_100032156 Ga0070673_1000321563 214
91 3300005364 Ga0070673_100177265 Ga0070673_1001772652 214
92 3300005367 Ga0070667_100075838 Ga0070667_1000758382 214
93 3300005438 Ga0070701_10067337 Ga0070701_100673372 214
94 3300005440 Ga0070705_100065375 Ga0070705_1000653751 214
95 3300005445 Ga0070708_100001024 Ga0070708_1000010244 214
96 3300005456 Ga0070678_100175863 Ga0070678_1001758631 214
97 3300005457 Ga0070662_100256599 Ga0070662_1002565992 214
98 3300005457 Ga0070662_100296969 Ga0070662_1002969692 214
99 3300005467 Ga0070706_100013408 Ga0070706_1000134083 214
100 3300005468 Ga0070707_100009936 Ga0070707_1000099364 214
101 3300005471 Ga0070698_100011527 Ga0070698_1000115274 214
102 3300005471 Ga0070698_100026115 Ga0070698_1000261152 214
103 3300005518 Ga0070699_100007970 Ga0070699_1000079704 214
104 3300005518 Ga0070699_100038258 Ga0070699_1000382582 214
105 3300005536 Ga0070697_100009933 Ga0070697_1000099332 214
106 3300005536 Ga0070697_100074800 Ga0070697_1000748001 214
107 3300005539 Ga0068853_100345488 Ga0068853_1003454882 214
108 3300005546 Ga0070696_100396663 Ga0070696_1003966632 214
109 3300005547 Ga0070693_100042517 Ga0070693_1000425172 214
110 3300005549 Ga0070704_100238957 Ga0070704_1002389572 214
111 3300005564 Ga0070664_100241183 Ga0070664_1002411833 214
112 3300005577 Ga0068857_100179938 Ga0068857_1001799382 214
113 3300005578 Ga0068854_100142830 Ga0068854_1001428302 214
114 3300005614 Ga0068856_100161748 Ga0068856_1001617482 214
115 3300005615 Ga0070702_100038912 Ga0070702_1000389122 214
116 3300005617 Ga0068859_100030949 Ga0068859_1000309493 214
117 3300005617 Ga0068859_100053437 Ga0068859_1000534372 214
118 3300005618 Ga0068864_100123535 Ga0068864_1001235352 214
119 3300005718 Ga0068866_10015098 Ga0068866_100150982 214
120 3300005719 Ga0068861_100015997 Ga0068861_1000159973 214
121 3300005719 Ga0068861_100059993 Ga0068861_1000599932 214
122 3300005719 Ga0068861_100302988 Ga0068861_1003029882 214
123 3300005841 Ga0068863_100068448 Ga0068863_1000684482 214
124 3300005841 Ga0068863_100075068 Ga0068863_1000750682 214
125 3300005841 Ga0068863_100515056 Ga0068863_1005150562 214
126 3300006237 Ga0097621_100008185 Ga0097621_1000081854 214
127 3300006358 Ga0068871_100009395 Ga0068871_1000093953 214
128 3300006358 Ga0068871_100600614 Ga0068871_1006006142 214
129 3300006844 Ga0075428_100906089 Ga0075428_1009060891 214
130 3300006881 Ga0068865_100030351 Ga0068865_1000303512 214
131 3300006931 Ga0097620_100030950 Ga0097620_1000309503 214
132 3300006931 Ga0097620_100053440 Ga0097620_1000534402 214
133 3300006931 Ga0097620_100302886 Ga0097620_1003028862 214
134 3300009093 Ga0105240_10063290 Ga0105240_100632903 214
135 3300009094 Ga0111539_10345936 Ga0111539_103459362 214
136 3300009098 Ga0105245_10015028 Ga0105245_100150282 214
137 3300009101 Ga0105247_10060962 Ga0105247_100609622 214
138 3300009148 Ga0105243_10003913 Ga0105243_100039132 214
139 3300009176 Ga0105242_10006988 Ga0105242_100069883 214
140 3300009176 Ga0105242_10114474 Ga0105242_101144742 214
141 3300009177 Ga0105248_10005805 Ga0105248_100058055 214
142 3300009177 Ga0105248_10032138 Ga0105248_100321384 214
143 3300009553 Ga0105249_10196432 Ga0105249_101964322 214
144 3300009553 Ga0105249_11332280 Ga0105249_113322801 214
145 3300010375 Ga0105239_11175605 Ga0105239_111756051 214
146 3300013296 Ga0157374_10082843 Ga0157374_100828431 214
147 3300013296 Ga0157374_10135832 Ga0157374_101358322 214
148 3300013297 Ga0157378_10013296 Ga0157378_100132962 214
149 3300013297 Ga0157378_10013817 Ga0157378_100138176 214
150 3300013297 Ga0157378_10019504 Ga0157378_100195042 214
151 3300013306 Ga0163162_10023010 Ga0163162_100230104 214
152 3300013307 Ga0157372_10045651 Ga0157372_100456513 214
153 3300013308 Ga0157375_10366866 Ga0157375_103668662 214
154 3300014325 Ga0163163_10008020 Ga0163163_100080202 214
155 3300014325 Ga0163163_10028251 Ga0163163_100282512 214
156 3300014325 Ga0163163_10048588 Ga0163163_100485883 214
157 3300014745 Ga0157377_10028162 Ga0157377_100281622 214
158 3300014969 Ga0157376_10030500 Ga0157376_100305002 214
159 3300014969 Ga0157376_10158248 Ga0157376_101582482 214
160 3300017792 Ga0163161_10026181 Ga0163161_100261812 214
161 3300017792 Ga0163161_10081320 Ga0163161_100813201 214
162 3300025315 Ga0207697_10005901 Ga0207697_100059013 214
163 3300025900 Ga0207710_10021224 Ga0207710_100212243 214
164 3300025903 Ga0207680_10076168 Ga0207680_100761682 214
165 3300025910 Ga0207684_10010256 Ga0207684_100102565 214
166 3300025913 Ga0207695_10104060 Ga0207695_101040601 214
167 3300025922 Ga0207646_10237350 Ga0207646_102373502 214
168 3300025923 Ga0207681_10001502 Ga0207681_100015023 214
169 3300025923 Ga0207681_10117473 Ga0207681_101174731 214
170 3300025924 Ga0207694_10001759 Ga0207694_100017594 214
171 3300025925 Ga0207650_10001407 Ga0207650_100014073 214
172 3300025926 Ga0207659_10549955 Ga0207659_105499551 214
173 3300025931 Ga0207644_10086786 Ga0207644_100867862 214
174 3300025931 Ga0207644_10102018 Ga0207644_101020182 214
175 3300025934 Ga0207686_10066174 Ga0207686_100661741 214
176 3300025935 Ga0207709_10016805 Ga0207709_100168052 214
177 3300025935 Ga0207709_10222440 Ga0207709_102224402 214
178 3300025938 Ga0207704_10012525 Ga0207704_100125252 214
179 3300025941 Ga0207711_10008138 Ga0207711_100081385 214
180 3300025941 Ga0207711_10045821 Ga0207711_100458213 214
181 3300025941 Ga0207711_10212800 Ga0207711_102128002 214
182 3300025942 Ga0207689_10001286 Ga0207689_1000128622 214
183 3300025942 Ga0207689_10158117 Ga0207689_101581172 214
184 3300025945 Ga0207679_10262907 Ga0207679_102629072 214
185 3300025960 Ga0207651_10031485 Ga0207651_100314852 214
186 3300025960 Ga0207651_10153369 Ga0207651_101533693 214
187 3300025960 Ga0207651_10563174 Ga0207651_105631741 214
188 3300025981 Ga0207640_10034507 Ga0207640_100345072 214
189 3300026075 Ga0207708_10105844 Ga0207708_101058442 214
190 3300026088 Ga0207641_10044300 Ga0207641_100443003 214
191 3300026088 Ga0207641_10198955 Ga0207641_101989552 214
192 3300026089 Ga0207648_10002250 Ga0207648_100022508 214
193 3300026095 Ga0207676_10109467 Ga0207676_101094672 214
194 3300026116 Ga0207674_10188958 Ga0207674_101889582 214
195 3300026116 Ga0207674_10216156 Ga0207674_102161562 214
196 3300026118 Ga0207675_100130908 Ga0207675_1001309081 214
197 3300026118 Ga0207675_100304308 Ga0207675_1003043081 214
198 3300026121 Ga0207683_10101495 Ga0207683_101014951 214
199 3300028380 Ga0268265_10222225 Ga0268265_102222252 214
200 3300028380 Ga0268265_10366611 Ga0268265_103666112 214
201 3300035171 Ga0373946_0254273 Ga0373946_0254273_105_767 214
202 3300049660 Ga0501216_007138 Ga0501216_007138_89_733 214
203 3300049661 Ga0501217_090744 Ga0501217_090744_165_809 214
204 3300049668 Ga0501233_018107 Ga0501233_018107_617_1261 214
205 3300049679 Ga0501249_005337 Ga0501249_005337_312_956 214
206 3300049688 Ga0501259_004049 Ga0501259_004049_58_702 214
207 3300049690 Ga0501261_030256 Ga0501261_030256_99_743 214
208 3300049708 Ga0501245_020460 Ga0501245_020460_29_673 214
209 2162886011 MRS1b_contig_6662657 MRS1b_0032.00001500 215
210 3300001426 JGI24030J14995_100098 JGI24030J14995_1000982 215
211 3300002074 JGI24748J21848_1000007 JGI24748J21848_100000799 215
212 3300002239 JGI24034J26672_10000002 JGI24034J26672_1000000283 215
213 3300002244 JGI24742J22300_10002227 JGI24742J22300_100022274 215
214 3300005289 Ga0065704_10091881 Ga0065704_100918811 215
215 3300005289 Ga0065704_10322250 Ga0065704_103222501 215
216 3300005290 Ga0065712_10098197 Ga0065712_100981972 215
217 3300005290 Ga0065712_10300032 Ga0065712_103000321 215
218 3300005293 Ga0065715_10002770 Ga0065715_100027705 215
219 3300005293 Ga0065715_10091482 Ga0065715_100914822 215
220 3300005295 Ga0065707_10087432 Ga0065707_100874322 215
221 3300005295 Ga0065707_10247255 Ga0065707_102472551 215
222 3300005295 Ga0065707_10275915 Ga0065707_102759152 215
223 3300005295 Ga0065707_10367904 Ga0065707_103679041 215
224 3300005328 Ga0070676_10030711 Ga0070676_100307114 215
225 3300005328 Ga0070676_10322528 Ga0070676_103225281 215
226 3300005328 Ga0070676_10356902 Ga0070676_103569022 215
227 3300005330 Ga0070690_100028362 Ga0070690_1000283622 215
228 3300005330 Ga0070690_100046197 Ga0070690_1000461972 215
229 3300005330 Ga0070690_100227703 Ga0070690_1002277032 215
230 3300005330 Ga0070690_100317039 Ga0070690_1003170392 215
231 3300005331 Ga0070670_100054717 Ga0070670_1000547173 215
232 3300005331 Ga0070670_100297161 Ga0070670_1002971611 215
233 3300005334 Ga0068869_100007326 Ga0068869_1000073265 215
234 3300005334 Ga0068869_100247901 Ga0068869_1002479012 215
235 3300005334 Ga0068869_100304080 Ga0068869_1003040802 215
236 3300005336 Ga0070680_100004282 Ga0070680_1000042823 215
237 3300005336 Ga0070680_100403826 Ga0070680_1004038261 215
238 3300005337 Ga0070682_100000521 Ga0070682_1000005218 215
239 3300005337 Ga0070682_100006312 Ga0070682_1000063123 215
240 3300005337 Ga0070682_100168847 Ga0070682_1001688472 215
241 3300005343 Ga0070687_100001368 Ga0070687_1000013683 215
242 3300005343 Ga0070687_100130872 Ga0070687_1001308722 215
243 3300005343 Ga0070687_100298848 Ga0070687_1002988481 215
244 3300005343 Ga0070687_100447059 Ga0070687_1004470591 215
245 3300005345 Ga0070692_10043655 Ga0070692_100436551 215
246 3300005345 Ga0070692_10052574 Ga0070692_100525743 215
247 3300005345 Ga0070692_10376916 Ga0070692_103769161 215
248 3300005354 Ga0070675_100254440 Ga0070675_1002544402 215
249 3300005354 Ga0070675_100613685 Ga0070675_1006136852 215
250 3300005354 Ga0070675_100753690 Ga0070675_1007536902 215
251 3300005355 Ga0070671_100063676 Ga0070671_1000636764 215
252 3300005356 Ga0070674_100377721 Ga0070674_1003777211 215
253 3300005364 Ga0070673_100019174 Ga0070673_1000191744 215
254 3300005364 Ga0070673_100060934 Ga0070673_1000609343 215
255 3300005364 Ga0070673_100343711 Ga0070673_1003437112 215
256 3300005364 Ga0070673_100441298 Ga0070673_1004412981 215
257 3300005406 Ga0070703_10000049 Ga0070703_1000004943 215
258 3300005406 Ga0070703_10024402 Ga0070703_100244022 215
259 3300005440 Ga0070705_100037158 Ga0070705_1000371583 215
260 3300005440 Ga0070705_100044060 Ga0070705_1000440603 215
261 3300005440 Ga0070705_100320810 Ga0070705_1003208101 215
262 3300005440 Ga0070705_100549702 Ga0070705_1005497022 215
263 3300005441 Ga0070700_100001165 Ga0070700_1000011652 215
264 3300005441 Ga0070700_100072607 Ga0070700_1000726072 215
265 3300005441 Ga0070700_100079056 Ga0070700_1000790561 215
266 3300005444 Ga0070694_100009560 Ga0070694_1000095603 215
267 3300005444 Ga0070694_100021942 Ga0070694_1000219425 215
268 3300005444 Ga0070694_100025088 Ga0070694_1000250882 215
269 3300005444 Ga0070694_100049054 Ga0070694_1000490542 215
270 3300005444 Ga0070694_100170601 Ga0070694_1001706012 215
271 3300005444 Ga0070694_100487308 Ga0070694_1004873081 215
272 3300005445 Ga0070708_100045110 Ga0070708_1000451103 215
273 3300005457 Ga0070662_100290627 Ga0070662_1002906272 215
274 3300005457 Ga0070662_100345919 Ga0070662_1003459192 215
275 3300005457 Ga0070662_100581101 Ga0070662_1005811011 215
276 3300005458 Ga0070681_10001279 Ga0070681_1000127914 215
277 3300005459 Ga0068867_100043408 Ga0068867_1000434083 215
278 3300005459 Ga0068867_100047363 Ga0068867_1000473632 215
279 3300005467 Ga0070706_100003314 Ga0070706_10000331412 215
280 3300005468 Ga0070707_100003580 Ga0070707_1000035806 215
281 3300005468 Ga0070707_100693397 Ga0070707_1006933971 215
282 3300005471 Ga0070698_100019886 Ga0070698_1000198861 215
283 3300005471 Ga0070698_100026461 Ga0070698_1000264615 215
284 3300005518 Ga0070699_100010521 Ga0070699_1000105218 215
285 3300005518 Ga0070699_100048193 Ga0070699_1000481932 215
286 3300005518 Ga0070699_100070986 Ga0070699_1000709864 215
287 3300005518 Ga0070699_100092479 Ga0070699_1000924794 215
288 3300005518 Ga0070699_100433750 Ga0070699_1004337502 215
289 3300005518 Ga0070699_100600418 Ga0070699_1006004181 215
290 3300005518 Ga0070699_100763800 Ga0070699_1007638001 215
291 3300005518 Ga0070699_100991659 Ga0070699_1009916591 215
292 3300005530 Ga0070679_100002107 Ga0070679_1000021076 215
293 3300005536 Ga0070697_100000438 Ga0070697_1000004389 215
294 3300005536 Ga0070697_100002186 Ga0070697_10000218612 215
295 3300005536 Ga0070697_100094787 Ga0070697_1000947871 215
296 3300005536 Ga0070697_100230167 Ga0070697_1002301672 215
297 3300005536 Ga0070697_100716426 Ga0070697_1007164261 215
298 3300005536 Ga0070697_100967023 Ga0070697_1009670231 215
299 3300005543 Ga0070672_100412207 Ga0070672_1004122071 215
300 3300005543 Ga0070672_100438337 Ga0070672_1004383372 215
301 3300005544 Ga0070686_100001507 Ga0070686_1000015077 215
302 3300005544 Ga0070686_100049648 Ga0070686_1000496481 215
303 3300005544 Ga0070686_100156706 Ga0070686_1001567063 215
304 3300005544 Ga0070686_100219885 Ga0070686_1002198852 215
305 3300005545 Ga0070695_100042394 Ga0070695_1000423941 215
306 3300005545 Ga0070695_100071804 Ga0070695_1000718042 215
307 3300005545 Ga0070695_100076985 Ga0070695_1000769851 215
308 3300005545 Ga0070695_100107704 Ga0070695_1001077043 215
309 3300005545 Ga0070695_100137801 Ga0070695_1001378012 215
310 3300005545 Ga0070695_100412779 Ga0070695_1004127792 215
311 3300005545 Ga0070695_100641558 Ga0070695_1006415581 215
312 3300005546 Ga0070696_100029427 Ga0070696_1000294271 215
313 3300005546 Ga0070696_100040019 Ga0070696_1000400194 215
314 3300005546 Ga0070696_100040419 Ga0070696_1000404194 215
315 3300005546 Ga0070696_100041611 Ga0070696_1000416112 215
316 3300005546 Ga0070696_100082236 Ga0070696_1000822361 215
317 3300005546 Ga0070696_100281601 Ga0070696_1002816012 215
318 3300005546 Ga0070696_100311083 Ga0070696_1003110831 215
319 3300005546 Ga0070696_100649982 Ga0070696_1006499821 215
320 3300005547 Ga0070693_100074871 Ga0070693_1000748711 215
321 3300005547 Ga0070693_100103332 Ga0070693_1001033322 215
322 3300005547 Ga0070693_100237665 Ga0070693_1002376651 215
323 3300005547 Ga0070693_100433314 Ga0070693_1004333141 215
324 3300005547 Ga0070693_100458543 Ga0070693_1004585431 215
325 3300005549 Ga0070704_100003983 Ga0070704_1000039836 215
326 3300005549 Ga0070704_100039745 Ga0070704_1000397453 215
327 3300005549 Ga0070704_100064854 Ga0070704_1000648543 215
328 3300005563 Ga0068855_100748904 Ga0068855_1007489042 215
329 3300005564 Ga0070664_100666061 Ga0070664_1006660611 215
330 3300005577 Ga0068857_100166074 Ga0068857_1001660742 215
331 3300005578 Ga0068854_100091220 Ga0068854_1000912204 215
332 3300005615 Ga0070702_100022160 Ga0070702_1000221601 215
333 3300005617 Ga0068859_100007834 Ga0068859_1000078345 215
334 3300005617 Ga0068859_100043818 Ga0068859_1000438181 215
335 3300005617 Ga0068859_100070457 Ga0068859_1000704573 215
336 3300005617 Ga0068859_100291040 Ga0068859_1002910402 215
337 3300005617 Ga0068859_100325190 Ga0068859_1003251902 215
338 3300005617 Ga0068859_100429032 Ga0068859_1004290322 215
339 3300005617 Ga0068859_100512795 Ga0068859_1005127951 215
340 3300005618 Ga0068864_100067259 Ga0068864_1000672594 215
341 3300005618 Ga0068864_100168970 Ga0068864_1001689703 215
342 3300005618 Ga0068864_100352024 Ga0068864_1003520242 215
343 3300005618 Ga0068864_100536228 Ga0068864_1005362281 215
344 3300005718 Ga0068866_10121782 Ga0068866_101217822 215
345 3300005719 Ga0068861_100017383 Ga0068861_1000173833 215
346 3300005719 Ga0068861_100125852 Ga0068861_1001258523 215
347 3300005719 Ga0068861_100456270 Ga0068861_1004562701 215
348 3300005719 Ga0068861_100668036 Ga0068861_1006680361 215
349 3300005719 Ga0068861_101145717 Ga0068861_1011457171 215
350 3300005834 Ga0068851_10001177 Ga0068851_100011774 215
351 3300005840 Ga0068870_10082607 Ga0068870_100826072 215
352 3300005840 Ga0068870_10249820 Ga0068870_102498202 215
353 3300005840 Ga0068870_10288525 Ga0068870_102885252 215
354 3300005840 Ga0068870_10476098 Ga0068870_104760981 215
355 3300005841 Ga0068863_100679330 Ga0068863_1006793302 215
356 3300005842 Ga0068858_100001261 Ga0068858_1000012617 215
357 3300005842 Ga0068858_100230639 Ga0068858_1002306392 215
358 3300005842 Ga0068858_100356497 Ga0068858_1003564972 215
359 3300005842 Ga0068858_100473940 Ga0068858_1004739401 215
360 3300005843 Ga0068860_100303500 Ga0068860_1003035002 215
361 3300005843 Ga0068860_101417076 Ga0068860_1014170761 215
362 3300005844 Ga0068862_100029025 Ga0068862_1000290254 215
363 3300005844 Ga0068862_100238054 Ga0068862_1002380542 215
364 3300005844 Ga0068862_100599792 Ga0068862_1005997921 215
365 3300005985 Ga0081539_10000898 Ga0081539_100008988 215
366 3300006358 Ga0068871_100559521 Ga0068871_1005595212 215
367 3300006844 Ga0075428_100306290 Ga0075428_1003062903 215
368 3300006844 Ga0075428_100342300 Ga0075428_1003423002 215
369 3300006844 Ga0075428_100864419 Ga0075428_1008644191 215
370 3300006846 Ga0075430_100226825 Ga0075430_1002268252 215
371 3300006846 Ga0075430_100250246 Ga0075430_1002502462 215
372 3300006846 Ga0075430_100436073 Ga0075430_1004360731 215
373 3300006847 Ga0075431_100005951 Ga0075431_1000059518 215
374 3300006847 Ga0075431_100108057 Ga0075431_1001080572 215
375 3300006847 Ga0075431_100128547 Ga0075431_1001285473 215
376 3300006852 Ga0075433_10020523 Ga0075433_100205232 215
377 3300006852 Ga0075433_10028353 Ga0075433_100283533 215
378 3300006852 Ga0075433_10053421 Ga0075433_100534212 215
379 3300006852 Ga0075433_10072374 Ga0075433_100723742 215
380 3300006852 Ga0075433_10089846 Ga0075433_100898463 215
381 3300006852 Ga0075433_10139844 Ga0075433_101398441 215
382 3300006852 Ga0075433_10610270 Ga0075433_106102701 215
383 3300006871 Ga0075434_100018537 Ga0075434_1000185377 215
384 3300006871 Ga0075434_100028680 Ga0075434_1000286803 215
385 3300006871 Ga0075434_100106418 Ga0075434_1001064183 215
386 3300006871 Ga0075434_101278631 Ga0075434_1012786311 215
387 3300006880 Ga0075429_100040092 Ga0075429_1000400922 215
388 3300006880 Ga0075429_100091303 Ga0075429_1000913032 215
389 3300006914 Ga0075436_100008947 Ga0075436_1000089476 215
390 3300006931 Ga0097620_100007834 Ga0097620_1000078345 215
391 3300006931 Ga0097620_100043818 Ga0097620_1000438181 215
392 3300006931 Ga0097620_100070455 Ga0097620_1000704552 215
393 3300006931 Ga0097620_100291033 Ga0097620_1002910332 215
394 3300006931 Ga0097620_100325194 Ga0097620_1003251942 215
395 3300006931 Ga0097620_100429000 Ga0097620_1004290001 215
396 3300006931 Ga0097620_100512794 Ga0097620_1005127942 215
397 3300007076 Ga0075435_100209617 Ga0075435_1002096173 215
398 3300007265 Ga0099794_10144467 Ga0099794_101444671 215
399 3300007788 Ga0099795_10187434 Ga0099795_101874341 215
400 3300009094 Ga0111539_10004471 Ga0111539_1000447115 215
401 3300009094 Ga0111539_10061895 Ga0111539_100618954 215
402 3300009094 Ga0111539_10178567 Ga0111539_101785673 215
403 3300009094 Ga0111539_10251650 Ga0111539_102516502 215
404 3300009098 Ga0105245_10803055 Ga0105245_108030551 215
405 3300009098 Ga0105245_10998986 Ga0105245_109989861 215
406 3300009098 Ga0105245_11151096 Ga0105245_111510961 215
407 3300009101 Ga0105247_10000001 Ga0105247_10000001555 215
408 3300009101 Ga0105247_10327482 Ga0105247_103274821 215
409 3300009147 Ga0114129_10003333 Ga0114129_1000333311 215
410 3300009147 Ga0114129_10038702 Ga0114129_100387021 215
411 3300009147 Ga0114129_10061731 Ga0114129_100617314 215
412 3300009147 Ga0114129_10131197 Ga0114129_101311973 215
413 3300009147 Ga0114129_10232270 Ga0114129_102322702 215
414 3300009147 Ga0114129_10386533 Ga0114129_103865331 215
415 3300009147 Ga0114129_10703202 Ga0114129_107032022 215
416 3300009147 Ga0114129_11005074 Ga0114129_110050741 215
417 3300009147 Ga0114129_11007422 Ga0114129_110074222 215
418 3300009147 Ga0114129_11136260 Ga0114129_111362602 215
419 3300009148 Ga0105243_10000124 Ga0105243_1000012460 215
420 3300009148 Ga0105243_10000436 Ga0105243_1000043630 215
421 3300009148 Ga0105243_10049750 Ga0105243_100497504 215
422 3300009148 Ga0105243_10114163 Ga0105243_101141633 215
423 3300009148 Ga0105243_10383468 Ga0105243_103834681 215
424 3300009148 Ga0105243_10625560 Ga0105243_106255601 215
425 3300009174 Ga0105241_10071258 Ga0105241_100712583 215
426 3300009174 Ga0105241_10250662 Ga0105241_102506621 215
427 3300009174 Ga0105241_10529459 Ga0105241_105294591 215
428 3300009176 Ga0105242_10000021 Ga0105242_1000002195 215
429 3300009176 Ga0105242_10271146 Ga0105242_102711462 215
430 3300009176 Ga0105242_10841082 Ga0105242_108410821 215
431 3300009177 Ga0105248_10069315 Ga0105248_100693152 215
432 3300009545 Ga0105237_10006578 Ga0105237_100065782 215
433 3300009545 Ga0105237_10039930 Ga0105237_100399302 215
434 3300009553 Ga0105249_10042347 Ga0105249_100423473 215
435 3300009553 Ga0105249_10174569 Ga0105249_101745692 215
436 3300009553 Ga0105249_10225350 Ga0105249_102253502 215
437 3300009553 Ga0105249_10538463 Ga0105249_105384632 215
438 3300009553 Ga0105249_10595220 Ga0105249_105952201 215
439 3300009553 Ga0105249_10597823 Ga0105249_105978232 215
440 3300010159 Ga0099796_10070306 Ga0099796_100703061 215
441 3300010375 Ga0105239_10043879 Ga0105239_100438795 215
442 3300010375 Ga0105239_10090240 Ga0105239_100902403 215
443 3300010375 Ga0105239_11057616 Ga0105239_110576161 215
444 3300011119 Ga0105246_10163841 Ga0105246_101638412 215
445 3300011119 Ga0105246_10190435 Ga0105246_101904352 215
446 3300011119 Ga0105246_10400791 Ga0105246_104007911 215
447 3300013100 Ga0157373_10238865 Ga0157373_102388652 215
448 3300013297 Ga0157378_10000379 Ga0157378_100003793 215
449 3300013297 Ga0157378_10013290 Ga0157378_100132906 215
450 3300013297 Ga0157378_10019839 Ga0157378_100198393 215
451 3300013297 Ga0157378_10064345 Ga0157378_100643453 215
452 3300013297 Ga0157378_10094716 Ga0157378_100947162 215
453 3300013297 Ga0157378_10131278 Ga0157378_101312784 215
454 3300013297 Ga0157378_10390138 Ga0157378_103901382 215
455 3300013297 Ga0157378_10480197 Ga0157378_104801972 215
456 3300013306 Ga0163162_10016077 Ga0163162_100160776 215
457 3300013306 Ga0163162_10164920 Ga0163162_101649203 215
458 3300013306 Ga0163162_10279213 Ga0163162_102792131 215
459 3300013306 Ga0163162_11009000 Ga0163162_110090001 215
460 3300013307 Ga0157372_10115325 Ga0157372_101153252 215
461 3300013308 Ga0157375_10007377 Ga0157375_100073778 215
462 3300013308 Ga0157375_10021696 Ga0157375_100216964 215
463 3300013308 Ga0157375_10114446 Ga0157375_101144462 215
464 3300014325 Ga0163163_10115085 Ga0163163_101150852 215
465 3300014325 Ga0163163_11073599 Ga0163163_110735991 215
466 3300014326 Ga0157380_10001291 Ga0157380_100012915 215
467 3300014326 Ga0157380_10001861 Ga0157380_1000186113 215
468 3300014326 Ga0157380_10031640 Ga0157380_100316403 215
469 3300014326 Ga0157380_10081331 Ga0157380_100813314 215
470 3300014326 Ga0157380_10212352 Ga0157380_102123522 215
471 3300014326 Ga0157380_10361450 Ga0157380_103614501 215
472 3300014745 Ga0157377_10216200 Ga0157377_102162002 215
473 3300014968 Ga0157379_10266429 Ga0157379_102664292 215
474 3300014968 Ga0157379_10499591 Ga0157379_104995912 215
475 3300014968 Ga0157379_10862066 Ga0157379_108620662 215
476 3300021384 Ga0213876_10083750 Ga0213876_100837502 215
477 3300025321 Ga0207656_10019923 Ga0207656_100199231 215
478 3300025885 Ga0207653_10000163 Ga0207653_100001636 215
479 3300025885 Ga0207653_10000825 Ga0207653_100008258 215
480 3300025885 Ga0207653_10032887 Ga0207653_100328871 215
481 3300025885 Ga0207653_10054182 Ga0207653_100541822 215
482 3300025893 Ga0207682_10129840 Ga0207682_101298402 215
483 3300025899 Ga0207642_10033642 Ga0207642_100336422 215
484 3300025900 Ga0207710_10000003 Ga0207710_1000000380 215
485 3300025901 Ga0207688_10041601 Ga0207688_100416013 215
486 3300025904 Ga0207647_10141864 Ga0207647_101418642 215
487 3300025906 Ga0207699_10369802 Ga0207699_103698022 215
488 3300025907 Ga0207645_10067496 Ga0207645_100674962 215
489 3300025907 Ga0207645_10234079 Ga0207645_102340792 215
490 3300025907 Ga0207645_10297052 Ga0207645_102970521 215
491 3300025908 Ga0207643_10025868 Ga0207643_100258684 215
492 3300025908 Ga0207643_10239787 Ga0207643_102397872 215
493 3300025910 Ga0207684_10016170 Ga0207684_100161702 215
494 3300025910 Ga0207684_10030630 Ga0207684_100306302 215
495 3300025911 Ga0207654_10021362 Ga0207654_100213624 215
496 3300025911 Ga0207654_10456738 Ga0207654_104567381 215
497 3300025912 Ga0207707_10000080 Ga0207707_1000008085 215
498 3300025914 Ga0207671_10009947 Ga0207671_100099473 215
499 3300025914 Ga0207671_10217838 Ga0207671_102178381 215
500 3300025917 Ga0207660_10026610 Ga0207660_100266103 215
501 3300025917 Ga0207660_10137816 Ga0207660_101378162 215
502 3300025918 Ga0207662_10006191 Ga0207662_100061913 215
503 3300025918 Ga0207662_10146668 Ga0207662_101466682 215
504 3300025918 Ga0207662_10238991 Ga0207662_102389912 215
505 3300025918 Ga0207662_10470207 Ga0207662_104702072 215
506 3300025921 Ga0207652_10001974 Ga0207652_100019749 215
507 3300025922 Ga0207646_10006373 Ga0207646_100063735 215
508 3300025922 Ga0207646_10008262 Ga0207646_100082626 215
509 3300025923 Ga0207681_10302511 Ga0207681_103025112 215
510 3300025925 Ga0207650_10084552 Ga0207650_100845522 215
511 3300025925 Ga0207650_10129684 Ga0207650_101296842 215
512 3300025925 Ga0207650_10511585 Ga0207650_105115852 215
513 3300025926 Ga0207659_10249843 Ga0207659_102498432 215
514 3300025926 Ga0207659_10276841 Ga0207659_102768412 215
515 3300025926 Ga0207659_10724219 Ga0207659_107242191 215
516 3300025927 Ga0207687_10127494 Ga0207687_101274943 215
517 3300025931 Ga0207644_10006884 Ga0207644_100068842 215
518 3300025931 Ga0207644_10557494 Ga0207644_105574941 215
519 3300025933 Ga0207706_10598342 Ga0207706_105983422 215
520 3300025933 Ga0207706_10905139 Ga0207706_109051391 215
521 3300025934 Ga0207686_10000003 Ga0207686_10000003124 215
522 3300025935 Ga0207709_10000017 Ga0207709_10000017183 215
523 3300025935 Ga0207709_10001413 Ga0207709_100014139 215
524 3300025935 Ga0207709_10187682 Ga0207709_101876822 215
525 3300025935 Ga0207709_10373106 Ga0207709_103731061 215
526 3300025939 Ga0207665_10026931 Ga0207665_100269312 215
527 3300025940 Ga0207691_10568557 Ga0207691_105685571 215
528 3300025941 Ga0207711_10255711 Ga0207711_102557112 215
529 3300025942 Ga0207689_10184606 Ga0207689_101846061 215
530 3300025942 Ga0207689_10233449 Ga0207689_102334492 215
531 3300025942 Ga0207689_10325268 Ga0207689_103252682 215
532 3300025942 Ga0207689_10346251 Ga0207689_103462512 215
533 3300025960 Ga0207651_10020599 Ga0207651_100205993 215
534 3300025960 Ga0207651_10166053 Ga0207651_101660532 215
535 3300025960 Ga0207651_10577924 Ga0207651_105779241 215
536 3300025961 Ga0207712_10000180 Ga0207712_1000018019 215
537 3300025961 Ga0207712_10058094 Ga0207712_100580943 215
538 3300025961 Ga0207712_10360001 Ga0207712_103600012 215
539 3300025972 Ga0207668_10014287 Ga0207668_100142875 215
540 3300025981 Ga0207640_10590791 Ga0207640_105907911 215
541 3300025981 Ga0207640_10675190 Ga0207640_106751901 215
542 3300025986 Ga0207658_10376053 Ga0207658_103760532 215
543 3300026023 Ga0207677_10111181 Ga0207677_101111812 215
544 3300026035 Ga0207703_10002069 Ga0207703_100020698 215
545 3300026035 Ga0207703_10038722 Ga0207703_100387222 215
546 3300026035 Ga0207703_10553963 Ga0207703_105539631 215
547 3300026035 Ga0207703_10658530 Ga0207703_106585302 215
548 3300026075 Ga0207708_10001124 Ga0207708_1000112417 215
549 3300026075 Ga0207708_10035790 Ga0207708_100357903 215
550 3300026075 Ga0207708_10718931 Ga0207708_107189311 215
551 3300026078 Ga0207702_10024513 Ga0207702_100245134 215
552 3300026089 Ga0207648_10060567 Ga0207648_100605673 215
553 3300026089 Ga0207648_10240070 Ga0207648_102400702 215
554 3300026089 Ga0207648_10704928 Ga0207648_107049281 215
555 3300026095 Ga0207676_10243392 Ga0207676_102433922 215
556 3300026095 Ga0207676_10506852 Ga0207676_105068522 215
557 3300026095 Ga0207676_10674053 Ga0207676_106740531 215
558 3300026095 Ga0207676_10818931 Ga0207676_108189311 215
559 3300026116 Ga0207674_10059514 Ga0207674_100595143 215
560 3300026118 Ga0207675_100003630 Ga0207675_1000036306 215
561 3300026118 Ga0207675_100135208 Ga0207675_1001352082 215
562 3300026118 Ga0207675_100446645 Ga0207675_1004466452 215
563 3300026118 Ga0207675_101161577 Ga0207675_1011615771 215
564 3300026121 Ga0207683_10354861 Ga0207683_103548611 215
565 3300027907 Ga0207428_10002796 Ga0207428_100027964 215
566 3300027907 Ga0207428_10035987 Ga0207428_100359873 215
567 3300027907 Ga0207428_10247785 Ga0207428_102477851 215
568 3300028380 Ga0268265_10029493 Ga0268265_100294933 215
569 3300028380 Ga0268265_10185530 Ga0268265_101855302 215
570 3300028380 Ga0268265_10258243 Ga0268265_102582432 215
571 3300028381 Ga0268264_10330647 Ga0268264_103306472 215
572 3300028381 Ga0268264_10424031 Ga0268264_104240312 215
573 3300030733 Ga0314311_1222542 Ga0314311_12225423 215
574 3300031548 Ga0307408_100317938 Ga0307408_1003179382 215
575 3300031548 Ga0307408_100769980 Ga0307408_1007699801 215
576 3300031731 Ga0307405_10128925 Ga0307405_101289252 215
577 3300031731 Ga0307405_10240397 Ga0307405_102403972 215
578 3300031901 Ga0307406_10209501 Ga0307406_102095012 215
579 3300031901 Ga0307406_10694595 Ga0307406_106945951 215
580 3300031911 Ga0307412_10133627 Ga0307412_101336272 215
581 3300032002 Ga0307416_100070396 Ga0307416_1000703965 215
582 3300032002 Ga0307416_100180972 Ga0307416_1001809722 215
583 3300032004 Ga0307414_10692211 Ga0307414_106922111 215
584 3300032005 Ga0307411_10349869 Ga0307411_103498692 215
585 3300032126 Ga0307415_100218038 Ga0307415_1002180383 215
586 3300038996 Ga0242420_001536 Ga0242420_001536_119_775 215
587 3300038996 Ga0242420_010818 Ga0242420_010818_657_1304 215
588 3300039437 Ga0436365_0394125 Ga0436365_0394125_2543_3235 215
589 3300041999 Ga0439433_0092665 Ga0439433_0092665_84_731 215
590 3300042876 Ga0451577_0291501 Ga0451577_0291501_407_1063 215
591 3300044673 Ga0453683_0030304 Ga0453683_0030304_707_1363 215
592 3300045051 Ga0451576_0696384 Ga0451576_0696384_64_711 215
593 3300045051 Ga0451576_0699737 Ga0451576_0699737_170_817 215
594 3300046512 Ga0495610_0048285 Ga0495610_0048285_631_1278 215
595 3300046525 Ga0495663_0000122 Ga0495663_0000122_13524_14171 215
596 3300046537 Ga0495598_0001729 Ga0495598_0001729_2454_3101 215
597 3300046537 Ga0495598_0004536 Ga0495598_0004536_2225_2872 215
598 3300046539 Ga0495621_0037742 Ga0495621_0037742_291_938 215
599 3300046664 Ga0495659_0004579 Ga0495659_0004579_1916_2563 215
600 3300047318 Ga0495636_0207908 Ga0495636_0207908_35_691 215
601 3300048905 Ga0496102_0866998 Ga0496102_0866998_18_665 215
602 3300048907 Ga0496104_0734661 Ga0496104_0734661_24_671 215
603 3300048909 Ga0496106_0014031 Ga0496106_0014031_3221_3877 215
604 3300048909 Ga0496106_0127452 Ga0496106_0127452_1250_1897 215
605 3300048909 Ga0496106_0136244 Ga0496106_0136244_223_870 215
606 3300048910 Ga0496107_0253773 Ga0496107_0253773_149_796 215
607 3300048911 Ga0496108_0388182 Ga0496108_0388182_76_723 215
608 3300048915 Ga0496112_0598222 Ga0496112_0598222_258_905 215
609 3300049514 Ga0501291_019026 Ga0501291_019026_86_733 215
610 3300049518 Ga0501295_042387 Ga0501295_042387_172_819 215
611 3300049522 Ga0501299_051604 Ga0501299_051604_159_806 215
612 3300049523 Ga0501300_012663 Ga0501300_012663_286_933 215
613 3300049588 Ga0501072_0523912 Ga0501072_0523912_243_890 215
614 3300049591 Ga0501075_0319470 Ga0501075_0319470_164_811 215
615 3300049653 Ga0501206_009937 Ga0501206_009937_38_685 215
616 3300049654 Ga0501207_008145 Ga0501207_008145_259_906 215
617 3300049655 Ga0501208_005920 Ga0501208_005920_399_1046 215
618 3300049661 Ga0501217_014045 Ga0501217_014045_410_1057 215
619 3300049675 Ga0501243_006435 Ga0501243_006435_1021_1668 215
620 3300049705 Ga0501225_0013604 Ga0501225_0013604_260_907 215
621 3300049707 Ga0501234_027812 Ga0501234_027812_177_824 215
622 3300049769 Ga0501272_006159 Ga0501272_006159_323_970 215
623 3300049770 Ga0501273_010836 Ga0501273_010836_166_813 215
624 3300049776 Ga0501280_007910 Ga0501280_007910_120_767 215
625 3300049851 Ga0501212_001102 Ga0501212_001102_570_1217 215
626 3300050507 nmdc:mga05p37_114743_c1 nmdc:mga05p37_114743_c1_2599_3246 215
627 3300050507 nmdc:mga05p37_1192297_c1 nmdc:mga05p37_1192297_c1_19_666 215
628 3300050507 nmdc:mga05p37_124133_c1 nmdc:mga05p37_124133_c1_2353_3000 215
629 3300050507 nmdc:mga05p37_147370_c1 nmdc:mga05p37_147370_c1_221_868 215
630 3300050507 nmdc:mga05p37_14770_c1 nmdc:mga05p37_14770_c1_4859_5512 215
631 3300050507 nmdc:mga05p37_241878_c1 nmdc:mga05p37_241878_c1_1474_2130 215
632 3300050507 nmdc:mga05p37_26820_c1 nmdc:mga05p37_26820_c1_2375_3022 215
633 3300050507 nmdc:mga05p37_59851_c1 nmdc:mga05p37_59851_c1_1906_2562 215
634 3300050507 nmdc:mga05p37_801592_c1 nmdc:mga05p37_801592_c1_193_840 215
635 3300050507 nmdc:mga05p37_844989_c1 nmdc:mga05p37_844989_c1_47_694 215
636 3300050507 nmdc:mga05p37_9803_c1 nmdc:mga05p37_9803_c1_4784_5479 215
637 3300050508 nmdc:mga09592_171380_c1 nmdc:mga09592_171380_c1_892_1539 215
638 3300050508 nmdc:mga09592_86211_c1 nmdc:mga09592_86211_c1_1199_1846 215
639 3300050509 nmdc:mga0qj67_412595_c1 nmdc:mga0qj67_412595_c1_135_782 215
640 3300050510 nmdc:mga06r32_109410_c1 nmdc:mga06r32_109410_c1_391_1038 215
641 3300050511 nmdc:mga08y16_3098_c1 nmdc:mga08y16_3098_c1_11902_12549 215
642 3300050511 nmdc:mga08y16_397058_c1 nmdc:mga08y16_397058_c1_165_812 215
643 3300050512 nmdc:mga0n895_127529_c1 nmdc:mga0n895_127529_c1_1879_2526 215
644 3300050512 nmdc:mga0n895_180966_c1 nmdc:mga0n895_180966_c1_763_1410 215
645 3300050512 nmdc:mga0n895_192108_c1 nmdc:mga0n895_192108_c1_548_1204 215
646 3300050512 nmdc:mga0n895_509276_c1 nmdc:mga0n895_509276_c1_479_1126 215
647 3300050512 nmdc:mga0n895_71066_c1 nmdc:mga0n895_71066_c1_2713_3369 215
648 3300050513 nmdc:mga0rr50_229844_c1 nmdc:mga0rr50_229844_c1_380_1027 215
649 3300050515 nmdc:mga0a205_123017_c1 nmdc:mga0a205_123017_c1_214_861 215
650 3300050515 nmdc:mga0a205_219490_c1 nmdc:mga0a205_219490_c1_243_938 215
651 3300050515 nmdc:mga0a205_220467_c1 nmdc:mga0a205_220467_c1_890_1537 215
652 3300050515 nmdc:mga0a205_357291_c1 nmdc:mga0a205_357291_c1_528_1184 215
653 3300050515 nmdc:mga0a205_40562_c1 nmdc:mga0a205_40562_c1_945_1601 215
654 3300050515 nmdc:mga0a205_6769_c2 nmdc:mga0a205_6769_c2_4957_5604 215
655 3300050515 nmdc:mga0a205_709314_c1 nmdc:mga0a205_709314_c1_43_690 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

3

136

0.76

PF00149

Metallophos

Calcineurin-like phosphoesterase

2

200

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dfj-assembly1.cif.gz_B crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a 0.873 5 208
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.8728 1 208
4j6o-assembly2.cif.gz_B crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp 0.866 3 215
4j6o-assembly2.cif.gz_B crystal structure of the phosphatase domain of c. thermocellum (bacterial) pnkp 0.8546 3 215
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.8417 1 208
ID Description Score Start End Superfamily
2dfjA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8751 5 208 3.60.21.10
af_A4I019_330_570_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.868 2 208 3.60.21.10
4j6oB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8613 3 215 3.60.21.10
4j6oB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.85 3 215 3.60.21.10
2qjcA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8477 1 208 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V8SG51-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9976 5 102 GO:0005737
GO:0016791
AF-A0A7V9HZ02-F1-model_v4 Metallophosphoesterase 0.993 1 215 GO:0005737
GO:0016791
AF-A0A2V8RET4-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9927 2 215 GO:0005737
GO:0016791
AF-A0A2V8LIR4-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9908 3 215 GO:0005737
GO:0016791
AF-A0A2V8RET4-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9835 2 215 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
96.69 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map