F472857

General Info

Members Datasets Scaffolds Average Seq Length
654 232 654 257

Family's Representative Sequence

Representative Sequence 3300027682|Ga0209971_1017624|Ga0209971_10176242
Length 319
Sequence MKVVSVLTAVAMICSLFLFAPPILAHHSFAAEFDANKCRDFTGTLTKLDWQSPHAYFYLDIKNEAGKVENWSFQTYALITLNRPPANAISEQLITEVNAALNAVQSDDSVRAVIVTGAGDKIFCGGADLASAFSGGDVEQFIRFGNSVMRKLERFPKPVIAAINGHAMGGGMEIAMACHLRLMKESARMGQTESNLGIIPGYGGTQRLPRLVGRTKALEYLLLGTQIPAAECLALGLVNRLSKEGETLNDAKALARQLGGRAPLAMAAIIRAVDEGLEAPMAKSIDIELEQFLPTLRSEDASEGIQAFFAKREPHFKGK

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10012903 3300005295 Bacteria 2119
2 Ga0070676_10005622 3300005328 Bacteria 6679
3 Ga0070683_100083081 3300005329 Bacteria 3000
4 Ga0070690_100119744 3300005330 Unclassified 1766
5 Ga0070670_100115006 3300005331 Bacteria 2319
6 Ga0068869_100000012 3300005334 Bacteria 75525
7 Ga0070680_100004085 3300005336 Bacteria 10931
8 Ga0070680_100015564 3300005336 Bacteria 5967
9 Ga0070680_100057128 3300005336 Bacteria 3190
10 Ga0070682_100000192 3300005337 Bacteria 45700
11 Ga0070660_100000614 3300005339 Bacteria 23816
12 Ga0070689_100045755 3300005340 Bacteria 3371
13 Ga0070691_10000893 3300005341 Bacteria 12089
14 Ga0070691_10019301 3300005341 Bacteria 3144
15 Ga0070691_10028394 3300005341 Unclassified 2614
16 Ga0070687_100023875 3300005343 Bacteria 2911
17 Ga0070661_100000917 3300005344 Bacteria 21153
18 Ga0070692_10009036 3300005345 Bacteria 4474
19 Ga0070692_10105082 3300005345 Unclassified 1554
20 Ga0070668_100142255 3300005347 Bacteria 1934
21 Ga0070669_100118814 3300005353 Bacteria 2014
22 Ga0070675_100443568 3300005354 Bacteria 1163
23 Ga0070673_100171677 3300005364 Bacteria 1851
24 Ga0070659_100000328 3300005366 Bacteria 36586
25 Ga0070703_10001692 3300005406 Bacteria 6550
26 Ga0070703_10003696 3300005406 Unclassified 4335
27 Ga0070703_10118539 3300005406 Bacteria 957
28 Ga0070701_10045580 3300005438 Bacteria 2250
29 Ga0070701_10068686 3300005438 Bacteria 1889
30 Ga0070701_10089428 3300005438 Bacteria 1684
31 Ga0070705_100000714 3300005440 Bacteria 18917
32 Ga0070705_100021749 3300005440 Unclassified 3416
33 Ga0070705_100071245 3300005440 Bacteria 2102
34 Ga0070694_100000221 3300005444 Bacteria 29858
35 Ga0070694_100000708 3300005444 Bacteria 18590
36 Ga0070694_100043253 3300005444 Bacteria 3011
37 Ga0070694_100093269 3300005444 Bacteria 2116
38 Ga0070694_100161904 3300005444 Unclassified 1642
39 Ga0070694_100176718 3300005444 Unclassified 1576
40 Ga0070708_100022076 3300005445 Bacteria 5395
41 Ga0070708_100029245 3300005445 Bacteria 4750
42 Ga0070708_100057003 3300005445 Bacteria 3476
43 Ga0070708_100171376 3300005445 Bacteria 2026
44 Ga0070708_100232125 3300005445 Bacteria 1731
45 Ga0070708_100240439 3300005445 Bacteria 1700
46 Ga0070708_100264015 3300005445 Bacteria 1619
47 Ga0070662_100227690 3300005457 Bacteria 1490
48 Ga0070681_10003830 3300005458 Bacteria 14144
49 Ga0068867_100002111 3300005459 Bacteria 13937
50 Ga0068867_100621964 3300005459 Bacteria 944
51 Ga0070706_100002217 3300005467 Bacteria 19744
52 Ga0070706_100029148 3300005467 Bacteria 5086
53 Ga0070706_100202998 3300005467 Bacteria 1852
54 Ga0070706_100280036 3300005467 Bacteria 1556
55 Ga0070706_100336058 3300005467 Bacteria 1408
56 Ga0070707_100022952 3300005468 Bacteria 5900
57 Ga0070707_100049522 3300005468 Bacteria 4027
58 Ga0070707_100066131 3300005468 Bacteria 3474
59 Ga0070707_100067507 3300005468 Bacteria 3440
60 Ga0070707_100078244 3300005468 Bacteria 3190
61 Ga0070707_100193981 3300005468 Bacteria 1980
62 Ga0070707_100408190 3300005468 Bacteria 1319
63 Ga0070707_100677776 3300005468 Bacteria 994
64 Ga0070698_100017214 3300005471 Bacteria 7616
65 Ga0070698_100039179 3300005471 Bacteria 4879
66 Ga0070698_100049290 3300005471 Bacteria 4299
67 Ga0070698_100091467 3300005471 Bacteria 3025
68 Ga0070698_100205367 3300005471 Bacteria 1905
69 Ga0070698_100245473 3300005471 Bacteria 1723
70 Ga0070698_100262409 3300005471 Bacteria 1660
71 Ga0070698_100333828 3300005471 Bacteria 1447
72 Ga0070699_100001395 3300005518 Bacteria 22214
73 Ga0070699_100023904 3300005518 Bacteria 5267
74 Ga0070699_100045128 3300005518 Bacteria 3814
75 Ga0070699_100065744 3300005518 Bacteria 3147
76 Ga0070699_100103209 3300005518 Bacteria 2500
77 Ga0070699_100184565 3300005518 Bacteria 1852
78 Ga0070699_100203064 3300005518 Bacteria 1763
79 Ga0070699_100388053 3300005518 Bacteria 1261
80 Ga0070679_100005622 3300005530 Bacteria 11612
81 Ga0070679_100255469 3300005530 Bacteria 1708
82 Ga0070684_100023397 3300005535 Bacteria 5167
83 Ga0070697_100001688 3300005536 Bacteria 16867
84 Ga0070697_100003552 3300005536 Bacteria 11977
85 Ga0070697_100004819 3300005536 Bacteria 10342
86 Ga0070697_100018024 3300005536 Bacteria 5564
87 Ga0070697_100069620 3300005536 Bacteria 2882
88 Ga0070697_100096985 3300005536 Bacteria 2446
89 Ga0070697_100411272 3300005536 Bacteria 1175
90 Ga0068853_100000637 3300005539 Bacteria 24013
91 Ga0070672_100148379 3300005543 Bacteria 1939
92 Ga0070686_100043725 3300005544 Unclassified 2812
93 Ga0070695_100002800 3300005545 Bacteria 10127
94 Ga0070695_100003216 3300005545 Bacteria 9533
95 Ga0070695_100006214 3300005545 Bacteria 7055
96 Ga0070695_100011346 3300005545 Bacteria 5331
97 Ga0070695_100101955 3300005545 Bacteria 1934
98 Ga0070695_100186614 3300005545 Bacteria 1473
99 Ga0070695_100254997 3300005545 Unclassified 1279
100 Ga0070695_100369913 3300005545 Bacteria 1079
101 Ga0070696_100004086 3300005546 Bacteria 9732
102 Ga0070696_100007298 3300005546 Bacteria 7379
103 Ga0070696_100182700 3300005546 Bacteria 1557
104 Ga0070696_100183129 3300005546 Bacteria 1555
105 Ga0070696_100288061 3300005546 Bacteria 1254
106 Ga0070696_100594406 3300005546 Unclassified 891
107 Ga0070693_100000097 3300005547 Bacteria 38401
108 Ga0070704_100001786 3300005549 Bacteria 11806
109 Ga0070704_100049550 3300005549 Unclassified 2947
110 Ga0070704_100070456 3300005549 Bacteria 2537
111 Ga0070704_100188220 3300005549 Bacteria 1657
112 Ga0070704_100354285 3300005549 Bacteria 1240
113 Ga0068855_100000362 3300005563 Bacteria 56297
114 Ga0068857_100004826 3300005577 Bacteria 11423
115 Ga0068857_100128089 3300005577 Bacteria 2288
116 Ga0068857_100144389 3300005577 Bacteria 2153
117 Ga0068857_100223363 3300005577 Bacteria 1721
118 Ga0068854_100000762 3300005578 Bacteria 19112
119 Ga0068854_100170710 3300005578 Unclassified 1692
120 Ga0068854_100220617 3300005578 Bacteria 1500
121 Ga0070702_100001731 3300005615 Bacteria 9068
122 Ga0070702_100184973 3300005615 Unclassified 1366
123 Ga0068852_100277289 3300005616 Bacteria 1615
124 Ga0068859_100000348 3300005617 Bacteria 46023
125 Ga0068859_100052363 3300005617 Bacteria 4104
126 Ga0068859_100504862 3300005617 Bacteria 1304
127 Ga0068866_10032193 3300005718 Bacteria 2533
128 Ga0068861_100010479 3300005719 Bacteria 6434
129 Ga0068870_10000443 3300005840 Bacteria 15700
130 Ga0068870_10005194 3300005840 Bacteria 5671
131 Ga0068863_100010811 3300005841 Bacteria 8850
132 Ga0068863_100178034 3300005841 Bacteria 2041
133 Ga0068858_100021860 3300005842 Bacteria 5975
134 Ga0068860_100004134 3300005843 Bacteria 14876
135 Ga0068860_100008783 3300005843 Bacteria 10068
136 Ga0068860_100167050 3300005843 Unclassified 2124
137 Ga0068860_100595111 3300005843 Unclassified 1111
138 Ga0068862_100003329 3300005844 Bacteria 13874
139 Ga0068862_100130474 3300005844 Bacteria 2222
140 Ga0068862_100212158 3300005844 Bacteria 1750
141 Ga0068862_100320213 3300005844 Bacteria 1431
142 Ga0068862_100603583 3300005844 Bacteria 1054
143 Ga0068862_100743257 3300005844 Bacteria 954
144 Ga0081455_10000499 3300005937 Bacteria 51066
145 Ga0081455_10320932 3300005937 Bacteria 1103
146 Ga0081538_10085682 3300005981 Bacteria 1654
147 Ga0081538_10176870 3300005981 Bacteria 920
148 Ga0081539_10000002 3300005985 Bacteria 601032
149 Ga0070712_100003614 3300006175 Bacteria 9537
150 Ga0068871_100342696 3300006358 Bacteria 1320
151 Ga0075428_100000032 3300006844 Bacteria 118320
152 Ga0075428_100000837 3300006844 Bacteria 32226
153 Ga0075428_100004443 3300006844 Bacteria 15481
154 Ga0075428_100050842 3300006844 Bacteria 4544
155 Ga0075428_100126209 3300006844 Bacteria 2785
156 Ga0075430_100000002 3300006846 Bacteria 150510
157 Ga0075430_100000030 3300006846 Bacteria 73219
158 Ga0075430_100014005 3300006846 Bacteria 6836
159 Ga0075430_100070655 3300006846 Bacteria 2928
160 Ga0075430_100135124 3300006846 Bacteria 2055
161 Ga0075431_100000009 3300006847 Bacteria 101621
162 Ga0075431_100000013 3300006847 Bacteria 90623
163 Ga0075431_100001893 3300006847 Bacteria 19845
164 Ga0075431_100002318 3300006847 Bacteria 18283
165 Ga0075431_100003218 3300006847 Bacteria 15801
166 Ga0075431_100004225 3300006847 Bacteria 14071
167 Ga0075431_100005455 3300006847 Bacteria 12567
168 Ga0075431_100018582 3300006847 Bacteria 7082
169 Ga0075431_100022755 3300006847 Bacteria 6406
170 Ga0075431_100027671 3300006847 Bacteria 5818
171 Ga0075431_100175333 3300006847 Bacteria 2202
172 Ga0075431_100182461 3300006847 Bacteria 2153
173 Ga0075431_100330305 3300006847 Bacteria 1536
174 Ga0075433_10000017 3300006852 Bacteria 66778
175 Ga0075433_10000121 3300006852 Bacteria 39439
176 Ga0075433_10010195 3300006852 Bacteria 7537
177 Ga0075433_10013834 3300006852 Bacteria 6578
178 Ga0075433_10024303 3300006852 Bacteria 5112
179 Ga0075433_10080101 3300006852 Bacteria 2878
180 Ga0075433_10082823 3300006852 Bacteria 2830
181 Ga0075433_10083173 3300006852 Bacteria 2824
182 Ga0075433_10102909 3300006852 Bacteria 2529
183 Ga0075433_10120121 3300006852 Bacteria 2333
184 Ga0075433_10216856 3300006852 Bacteria 1700
185 Ga0075433_10261963 3300006852 Bacteria 1532
186 Ga0075434_100001334 3300006871 Bacteria 20666
187 Ga0075434_100013675 3300006871 Bacteria 7736
188 Ga0075434_100021778 3300006871 Bacteria 6234
189 Ga0075434_100036779 3300006871 Bacteria 4842
190 Ga0075434_100049904 3300006871 Bacteria 4156
191 Ga0075434_100065440 3300006871 Bacteria 3620
192 Ga0075434_100081534 3300006871 Bacteria 3232
193 Ga0075434_100096516 3300006871 Bacteria 2961
194 Ga0075434_100142711 3300006871 Bacteria 2415
195 Ga0075434_100283348 3300006871 Bacteria 1676
196 Ga0075434_100823434 3300006871 Bacteria 944
197 Ga0075429_100000006 3300006880 Bacteria 98571
198 Ga0075429_100001526 3300006880 Bacteria 19045
199 Ga0075429_100007453 3300006880 Bacteria 9494
200 Ga0075429_100007721 3300006880 Bacteria 9338
201 Ga0075429_100009193 3300006880 Bacteria 8580
202 Ga0075429_100010942 3300006880 Bacteria 7850
203 Ga0075429_100196690 3300006880 Bacteria 1766
204 Ga0075429_100327380 3300006880 Bacteria 1341
205 Ga0068865_100282995 3300006881 Bacteria 1321
206 Ga0075436_100005968 3300006914 Bacteria 8367
207 Ga0075436_100052367 3300006914 Bacteria 2817
208 Ga0075436_100157523 3300006914 Bacteria 1600
209 Ga0075436_100170575 3300006914 Bacteria 1536
210 Ga0075436_100292802 3300006914 Bacteria 1165
211 Ga0097620_100000348 3300006931 Bacteria 46023
212 Ga0097620_100052361 3300006931 Bacteria 4104
213 Ga0097620_100504860 3300006931 Bacteria 1304
214 Ga0075435_100002475 3300007076 Bacteria 12279
215 Ga0075435_100004315 3300007076 Bacteria 9776
216 Ga0075435_100021302 3300007076 Bacteria 4983
217 Ga0075435_100032600 3300007076 Bacteria 4115
218 Ga0075435_100611377 3300007076 Bacteria 945
219 Ga0099794_10003767 3300007265 Bacteria 5845
220 Ga0099794_10005009 3300007265 Bacteria 5275
221 Ga0099794_10034390 3300007265 Bacteria 2387
222 Ga0111539_10006297 3300009094 Bacteria 15321
223 Ga0111539_10016096 3300009094 Bacteria 9281
224 Ga0111539_10028818 3300009094 Bacteria 6771
225 Ga0111539_10321074 3300009094 Bacteria 1802
226 Ga0105245_10784931 3300009098 Unclassified 990
227 Ga0105247_10163505 3300009101 Unclassified 1475
228 Ga0114129_10000053 3300009147 Bacteria 100477
229 Ga0114129_10000182 3300009147 Bacteria 70001
230 Ga0114129_10000454 3300009147 Bacteria 48898
231 Ga0114129_10004798 3300009147 Bacteria 19109
232 Ga0114129_10005559 3300009147 Bacteria 17830
233 Ga0114129_10011655 3300009147 Bacteria 12515
234 Ga0114129_10036137 3300009147 Bacteria 6976
235 Ga0114129_10055460 3300009147 Bacteria 5553
236 Ga0114129_10056921 3300009147 Bacteria 5474
237 Ga0114129_10073458 3300009147 Bacteria 4765
238 Ga0114129_10084238 3300009147 Bacteria 4415
239 Ga0114129_10097091 3300009147 Bacteria 4079
240 Ga0114129_10156876 3300009147 Bacteria 3111
241 Ga0114129_10301204 3300009147 Bacteria 2137
242 Ga0114129_10380014 3300009147 Bacteria 1866
243 Ga0114129_10428723 3300009147 Bacteria 1738
244 Ga0114129_10887056 3300009147 Bacteria 1131
245 Ga0114129_10947783 3300009147 Bacteria 1087
246 Ga0105243_10055485 3300009148 Bacteria 3148
247 Ga0105243_10094370 3300009148 Bacteria 2470
248 Ga0105243_10157637 3300009148 Bacteria 1954
249 Ga0105241_10031744 3300009174 Bacteria 3955
250 Ga0105241_10081797 3300009174 Bacteria 2530
251 Ga0105242_10092043 3300009176 Unclassified 2554
252 Ga0105242_10214481 3300009176 Bacteria 1717
253 Ga0105248_10067618 3300009177 Bacteria 4012
254 Ga0105248_10317192 3300009177 Bacteria 1756
255 Ga0105249_10044073 3300009553 Bacteria 4058
256 Ga0105249_10064946 3300009553 Bacteria 3356
257 Ga0105246_10737164 3300011119 Bacteria 868
258 Ga0157373_10000316 3300013100 Bacteria 38900
259 Ga0157371_10075398 3300013102 Bacteria 2389
260 Ga0157369_10008219 3300013105 Bacteria 11965
261 Ga0157378_10168322 3300013297 Bacteria 2054
262 Ga0163162_10006161 3300013306 Bacteria 11615
263 Ga0163162_10614278 3300013306 Unclassified 1213
264 Ga0157372_10000280 3300013307 Bacteria 56597
265 Ga0157372_10094378 3300013307 Bacteria 3407
266 Ga0157375_10439497 3300013308 Bacteria 1470
267 Ga0157380_10024963 3300014326 Bacteria 4528
268 Ga0163161_10285016 3300017792 Bacteria 1297
269 Ga0207653_10003277 3300025885 Bacteria 5105
270 Ga0207653_10006684 3300025885 Unclassified 3602
271 Ga0207653_10119934 3300025885 Bacteria 946
272 Ga0207642_10070914 3300025899 Bacteria 1658
273 Ga0207688_10008008 3300025901 Bacteria 5751
274 Ga0207647_10019631 3300025904 Bacteria 4543
275 Ga0207645_10001727 3300025907 Bacteria 17713
276 Ga0207643_10001135 3300025908 Bacteria 15834
277 Ga0207643_10021877 3300025908 Unclassified 3518
278 Ga0207684_10001398 3300025910 Bacteria 26216
279 Ga0207684_10003869 3300025910 Bacteria 14379
280 Ga0207684_10015250 3300025910 Bacteria 6620
281 Ga0207684_10037779 3300025910 Bacteria 4097
282 Ga0207684_10063626 3300025910 Bacteria 3132
283 Ga0207684_10183616 3300025910 Bacteria 1804
284 Ga0207684_10195228 3300025910 Bacteria 1746
285 Ga0207684_10335781 3300025910 Bacteria 1301
286 Ga0207684_10445655 3300025910 Bacteria 1112
287 Ga0207654_10001729 3300025911 Bacteria 11365
288 Ga0207654_10099656 3300025911 Bacteria 1788
289 Ga0207707_10000034 3300025912 Bacteria 152677
290 Ga0207671_10063819 3300025914 Bacteria 2737
291 Ga0207693_10006771 3300025915 Bacteria 9462
292 Ga0207693_10078261 3300025915 Bacteria 2588
293 Ga0207663_10186000 3300025916 Bacteria 1487
294 Ga0207660_10000382 3300025917 Bacteria 29017
295 Ga0207660_10056472 3300025917 Unclassified 2809
296 Ga0207660_10546421 3300025917 Bacteria 942
297 Ga0207662_10121548 3300025918 Bacteria 1638
298 Ga0207657_10002825 3300025919 Bacteria 18666
299 Ga0207649_10002273 3300025920 Bacteria 10810
300 Ga0207652_10000430 3300025921 Bacteria 43655
301 Ga0207652_10200712 3300025921 Bacteria 1795
302 Ga0207646_10001023 3300025922 Bacteria 35723
303 Ga0207646_10007724 3300025922 Bacteria 10886
304 Ga0207646_10016616 3300025922 Bacteria 6903
305 Ga0207646_10020663 3300025922 Bacteria 6098
306 Ga0207646_10045011 3300025922 Bacteria 3961
307 Ga0207646_10103231 3300025922 Bacteria 2557
308 Ga0207646_10290742 3300025922 Bacteria 1477
309 Ga0207646_10317309 3300025922 Bacteria 1408
310 Ga0207646_10341083 3300025922 Bacteria 1354
311 Ga0207646_10514047 3300025922 Unclassified 1078
312 Ga0207646_10657066 3300025922 Bacteria 939
313 Ga0207650_10002719 3300025925 Bacteria 12204
314 Ga0207659_10660870 3300025926 Bacteria 893
315 Ga0207690_10003117 3300025932 Bacteria 9983
316 Ga0207706_10077976 3300025933 Bacteria 2914
317 Ga0207706_10136232 3300025933 Bacteria 2160
318 Ga0207706_10713869 3300025933 Bacteria 856
319 Ga0207686_10278618 3300025934 Unclassified 1233
320 Ga0207709_10043293 3300025935 Unclassified 2713
321 Ga0207709_10057711 3300025935 Bacteria 2408
322 Ga0207709_10135297 3300025935 Bacteria 1686
323 Ga0207670_10047938 3300025936 Bacteria 2848
324 Ga0207704_10346380 3300025938 Bacteria 1155
325 Ga0207665_10020047 3300025939 Bacteria 4392
326 Ga0207691_10070576 3300025940 Bacteria 3154
327 Ga0207711_10106718 3300025941 Bacteria 2485
328 Ga0207711_10566277 3300025941 Bacteria 1060
329 Ga0207689_10000153 3300025942 Bacteria 59635
330 Ga0207689_10017750 3300025942 Bacteria 6013
331 Ga0207689_10081732 3300025942 Bacteria 2656
332 Ga0207689_10156706 3300025942 Unclassified 1877
333 Ga0207661_10063648 3300025944 Bacteria 2988
334 Ga0207679_10002005 3300025945 Bacteria 12641
335 Ga0207667_10000308 3300025949 Bacteria 67806
336 Ga0207651_10037435 3300025960 Bacteria 3178
337 Ga0207712_10003979 3300025961 Bacteria 9327
338 Ga0207712_10035886 3300025961 Bacteria 3372
339 Ga0207712_10197381 3300025961 Archaea 1593
340 Ga0207640_10003433 3300025981 Bacteria 8534
341 Ga0207658_10319709 3300025986 Bacteria 1343
342 Ga0207677_10053492 3300026023 Bacteria 2748
343 Ga0207677_10503537 3300026023 Bacteria 1048
344 Ga0207703_10006298 3300026035 Bacteria 9487
345 Ga0207703_10203758 3300026035 Unclassified 1759
346 Ga0207639_10000976 3300026041 Bacteria 19448
347 Ga0207708_10104728 3300026075 Unclassified 2192
348 Ga0207702_10000652 3300026078 Bacteria 37789
349 Ga0207641_10025025 3300026088 Bacteria 4922
350 Ga0207641_10154821 3300026088 Bacteria 2079
351 Ga0207648_10000169 3300026089 Bacteria 67635
352 Ga0207648_10115205 3300026089 Bacteria 2362
353 Ga0207676_10033771 3300026095 Bacteria 3868
354 Ga0207676_10530760 3300026095 Bacteria 1122
355 Ga0207674_10000050 3300026116 Bacteria 116782
356 Ga0207674_10071805 3300026116 Bacteria 3478
357 Ga0207674_10175770 3300026116 Bacteria 2093
358 Ga0207675_100011174 3300026118 Bacteria 8406
359 Ga0207675_100104588 3300026118 Bacteria 2668
360 Ga0207675_100128949 3300026118 Bacteria 2398
361 Ga0207698_10214271 3300026142 Bacteria 1735
362 Ga0210000_1006161 3300027462 Bacteria 1746
363 Ga0209995_1000557 3300027471 Bacteria 5671
364 Ga0209968_1003187 3300027526 Bacteria 2460
365 Ga0209999_1003564 3300027543 Bacteria 2789
366 Ga0209970_1001167 3300027614 Bacteria 4626
367 Ga0209983_1001441 3300027665 Bacteria 5283
368 Ga0209588_1049838 3300027671 Bacteria 1355
369 Ga0209971_1000103 3300027682 Bacteria 25109
370 Ga0209971_1017624 3300027682 Bacteria 1693
371 Ga0209966_1000042 3300027695 Bacteria 53500
372 Ga0209998_10000127 3300027717 Bacteria 29842
373 Ga0209974_10000436 3300027876 Bacteria 13888
374 Ga0207428_10000054 3300027907 Bacteria 175237
375 Ga0207428_10007442 3300027907 Bacteria 9982
376 Ga0268265_10003808 3300028380 Bacteria 10690
377 Ga0268265_10007220 3300028380 Bacteria 7507
378 Ga0268265_10011871 3300028380 Bacteria 5889
379 Ga0268265_10016149 3300028380 Bacteria 5125
380 Ga0268265_10424943 3300028380 Bacteria 1235
381 Ga0268264_10008214 3300028381 Bacteria 8668
382 Ga0268264_10074280 3300028381 Bacteria 2887
383 Ga0268264_10519338 3300028381 Unclassified 1164
384 Ga0307408_100085026 3300031548 Bacteria 2374
385 Ga0307413_10354035 3300031824 Bacteria 1134
386 Ga0307407_10020838 3300031903 Bacteria 3368
387 Ga0307412_10367363 3300031911 Bacteria 1161
388 Ga0307409_100006456 3300031995 Bacteria 6893
389 Ga0307409_100369120 3300031995 Bacteria 1360
390 Ga0307416_100015112 3300032002 Bacteria 5318
391 Ga0307416_100322510 3300032002 Bacteria 1548
392 Ga0307416_100509513 3300032002 Bacteria 1269
393 Ga0307411_10232251 3300032005 Bacteria 1438
394 Ga0373948_0008669 3300034817 Bacteria 1737
395 Ga0373959_0010524 3300034820 Bacteria 1617
396 Ga0373949_0005449 3300035090 Bacteria 2837
397 Ga0373951_0041814 3300035091 Bacteria 1107
398 Ga0373952_0012965 3300035092 Bacteria 1648
399 Ga0373932_0069502 3300035112 Bacteria 1089
400 Ga0373960_0006606 3300035121 Bacteria 2725
401 Ga0373960_0062503 3300035121 Bacteria 1133
402 Ga0373961_0002388 3300035241 Bacteria 4886
403 Ga0373962_0014767 3300035242 Bacteria 1994
404 Ga0373931_0016937 3300035691 Bacteria 3595
405 Ga0373931_0092001 3300035691 Bacteria 1691
406 Ga0395899_0120663 3300037312 Bacteria 1878
407 Ga0395900_0002528 3300037418 Bacteria 20031
408 Ga0395900_0639401 3300037418 Bacteria 1001
409 Ga0395898_0035517 3300037466 Bacteria 4954
410 Ga0395898_0350806 3300037466 Bacteria 1407
411 Ga0395901_0002359 3300038443 Bacteria 19205
412 Ga0395901_0072757 3300038443 Bacteria 3584
413 Ga0439448_0001261 3300042005 Bacteria 6474
414 Ga0439448_0011765 3300042005 Bacteria 2610
415 Ga0439450_014672 3300042008 Bacteria 1592
416 Ga0439455_0051182 3300042012 Bacteria 1079
417 Ga0439455_0094369 3300042012 Bacteria 822
418 Ga0439463_055355 3300042016 Bacteria 1013
419 Ga0439458_0023619 3300042157 Bacteria 1434
420 Ga0439464_0003655 3300042439 Bacteria 3901
421 Ga0439460_0013223 3300042461 Bacteria 2156
422 Ga0451577_0028473 3300042876 Bacteria 5052
423 Ga0451577_0033485 3300042876 Bacteria 4632
424 Ga0451577_0053264 3300042876 Bacteria 3612
425 Ga0451577_0084240 3300042876 Bacteria 2837
426 Ga0451577_0090550 3300042876 Bacteria 2730
427 Ga0451577_0136954 3300042876 Bacteria 2199
428 Ga0451577_0357353 3300042876 Bacteria 1325
429 Ga0451577_0463517 3300042876 Bacteria 1151
430 Ga0453683_0012871 3300044673 Bacteria 5473
431 Ga0453683_0021188 3300044673 Bacteria 4150
432 Ga0453683_0033634 3300044673 Bacteria 3234
433 Ga0453683_0270505 3300044673 Bacteria 1084
434 Ga0453683_0348222 3300044673 Bacteria 951
435 Ga0453683_0387675 3300044673 Unclassified 900
436 Ga0453684_0022188 3300044712 Bacteria 9435
437 Ga0453684_0059192 3300044712 Bacteria 4941
438 Ga0453684_0105532 3300044712 Bacteria 3436
439 Ga0453684_0675488 3300044712 Bacteria 1125
440 Ga0451576_0003436 3300045051 Bacteria 21774
441 Ga0451576_0041817 3300045051 Bacteria 4843
442 Ga0451576_0075462 3300045051 Bacteria 3508
443 Ga0451576_0090083 3300045051 Bacteria 3190
444 Ga0451576_0100041 3300045051 Bacteria 3016
445 Ga0451576_0176658 3300045051 Bacteria 2229
446 Ga0451576_0221170 3300045051 Bacteria 1977
447 Ga0451576_0417426 3300045051 Bacteria 1408
448 Ga0451576_0474738 3300045051 Bacteria 1313
449 Ga0451576_0733171 3300045051 Bacteria 1038
450 Ga0495580_0001279 3300046472 Bacteria 22163
451 Ga0495580_0059569 3300046472 Bacteria 2683
452 Ga0495584_0044378 3300046491 Bacteria 2244
453 Ga0495669_0029212 3300046684 Bacteria 2417
454 Ga0495636_0152070 3300047318 Bacteria 1039
455 Ga0496100_0128796 3300048903 Bacteria 1780
456 Ga0496102_0023647 3300048905 Bacteria 5460
457 Ga0496102_0034628 3300048905 Bacteria 4543
458 Ga0496106_0050838 3300048909 Bacteria 3124
459 Ga0496106_0243680 3300048909 Bacteria 1436
460 Ga0496109_0307166 3300048912 Bacteria 1496
461 Ga0496110_0315927 3300048913 Bacteria 1423
462 Ga0496112_0038924 3300048915 Bacteria 4645
463 Ga0496113_0097028 3300048916 Bacteria 2280
464 Ga0501033_0040153 3300049570 Bacteria 3494
465 Ga0501033_0423216 3300049570 Bacteria 927
466 Ga0501036_0284355 3300049572 Bacteria 1384
467 Ga0501036_0403086 3300049572 Bacteria 1141
468 Ga0501037_0123863 3300049573 Bacteria 1857
469 Ga0501038_0120984 3300049574 Bacteria 2159
470 Ga0501038_0133303 3300049574 Bacteria 2037
471 Ga0501039_0130183 3300049575 Bacteria 1975
472 Ga0501039_0178787 3300049575 Bacteria 1669
473 Ga0501039_0218665 3300049575 Bacteria 1498
474 Ga0501040_0001692 3300049576 Bacteria 14136
475 Ga0501040_0005881 3300049576 Bacteria 7941
476 Ga0501040_0012970 3300049576 Bacteria 5479
477 Ga0501040_0200330 3300049576 Bacteria 1417
478 Ga0501041_0004951 3300049577 Bacteria 7748
479 Ga0501041_0043353 3300049577 Bacteria 2735
480 Ga0501041_0320854 3300049577 Bacteria 977
481 Ga0501042_0001027 3300049578 Bacteria 15893
482 Ga0501046_0000084 3300049580 Bacteria 100971
483 Ga0501046_0142686 3300049580 Bacteria 1811
484 Ga0501048_0006618 3300049582 Bacteria 8809
485 Ga0501048_0133124 3300049582 Bacteria 1757
486 Ga0501048_0158167 3300049582 Bacteria 1603
487 Ga0501067_0025668 3300049583 Bacteria 3266
488 Ga0501067_0292595 3300049583 Bacteria 907
489 Ga0501068_0037970 3300049584 Bacteria 2884
490 Ga0501068_0131366 3300049584 Bacteria 1566
491 Ga0501068_0167254 3300049584 Bacteria 1387
492 Ga0501069_0007030 3300049585 Bacteria 5892
493 Ga0501069_0197984 3300049585 Bacteria 1164
494 Ga0501071_0030163 3300049587 Bacteria 3834
495 Ga0501072_0040433 3300049588 Bacteria 3661
496 Ga0501072_0112021 3300049588 Bacteria 2172
497 Ga0501072_0266859 3300049588 Bacteria 1362
498 Ga0501072_0371239 3300049588 Bacteria 1135
499 Ga0501072_0519080 3300049588 Bacteria 942
500 Ga0501073_0233931 3300049589 Bacteria 1269
501 Ga0501073_0386499 3300049589 Bacteria 967
502 Ga0501074_0004066 3300049590 Bacteria 10435
503 Ga0501074_0191215 3300049590 Bacteria 1459
504 Ga0501074_0297225 3300049590 Bacteria 1147
505 Ga0501075_0096900 3300049591 Bacteria 2238
506 Ga0501075_0126192 3300049591 Bacteria 1948
507 Ga0501075_0187806 3300049591 Bacteria 1576
508 Ga0501075_0217779 3300049591 Bacteria 1456
509 Ga0501075_0392875 3300049591 Bacteria 1057
510 Ga0501075_0413290 3300049591 Bacteria 1029
511 Ga0501076_0003680 3300049592 Bacteria 10779
512 Ga0501076_0054077 3300049592 Bacteria 3182
513 Ga0501076_0093822 3300049592 Bacteria 2416
514 Ga0501076_0096684 3300049592 Bacteria 2379
515 Ga0501076_0109213 3300049592 Bacteria 2235
516 Ga0501076_0162086 3300049592 Bacteria 1822
517 Ga0501076_0186499 3300049592 Bacteria 1692
518 Ga0501076_0207813 3300049592 Bacteria 1599
519 Ga0501077_0016948 3300049593 Bacteria 4596
520 Ga0501077_0118093 3300049593 Bacteria 1681
521 Ga0501077_0201160 3300049593 Bacteria 1265
522 Ga0501077_0215906 3300049593 Bacteria 1219
523 Ga0501077_0305462 3300049593 Bacteria 1014
524 Ga0501079_0000126 3300049741 Bacteria 40724
525 Ga0501079_0028751 3300049741 Bacteria 4267
526 Ga0501079_0042598 3300049741 Bacteria 3505
527 Ga0501079_0107054 3300049741 Bacteria 2170
528 Ga0501079_0137499 3300049741 Bacteria 1903
529 Ga0501079_0158042 3300049741 Bacteria 1767
530 Ga0501079_0426215 3300049741 Bacteria 1041
531 Ga0501080_0028768 3300049742 Bacteria 5174
532 Ga0501080_0140161 3300049742 Bacteria 2236
533 Ga0501080_0702384 3300049742 Bacteria 892
534 Ga0501081_0002938 3300049743 Bacteria 10811
535 Ga0501081_0005134 3300049743 Bacteria 8428
536 Ga0501081_0013413 3300049743 Bacteria 5389
537 Ga0501081_0015599 3300049743 Bacteria 5015
538 Ga0501081_0015840 3300049743 Bacteria 4977
539 Ga0501081_0068424 3300049743 Bacteria 2472
540 Ga0501081_0168895 3300049743 Bacteria 1579
541 Ga0501081_0281478 3300049743 Bacteria 1218
542 Ga0501083_0301449 3300049744 Bacteria 1042
543 Ga0501035_0290920 3300049822 Bacteria 1379
544 Ga0501045_0000701 3300049824 Bacteria 21268
545 Ga0501045_0068944 3300049824 Bacteria 2599
546 Ga0501045_0074466 3300049824 Bacteria 2500
547 Ga0501045_0095868 3300049824 Bacteria 2195
548 Ga0501045_0124822 3300049824 Bacteria 1912
549 Ga0501045_0357955 3300049824 Bacteria 1086
550 Ga0501045_0358918 3300049824 Bacteria 1084
551 Ga0501045_0372091 3300049824 Bacteria 1063
552 nmdc:mga05p37_100710_c1 3300050507 Bacteria 3559
553 nmdc:mga05p37_12948_c1 3300050507 Bacteria 9977
554 nmdc:mga05p37_134317_c1 3300050507 Bacteria 3035
555 nmdc:mga05p37_1427_c1 3300050507 Bacteria 27781
556 nmdc:mga05p37_152101_c1 3300050507 Bacteria 2830
557 nmdc:mga05p37_15303_c1 3300050507 Bacteria 9215
558 nmdc:mga05p37_168271_c1 3300050507 Bacteria 2674
559 nmdc:mga05p37_2575_c1 3300050507 Bacteria 21085
560 nmdc:mga05p37_45733_c1 3300050507 Bacteria 5382
561 nmdc:mga05p37_45908_c1 3300050507 Bacteria 5373
562 nmdc:mga05p37_546896_c1 3300050507 Bacteria 1319
563 nmdc:mga05p37_5969_c1 3300050507 Bacteria 5263
564 nmdc:mga05p37_61012_c1 3300050507 Bacteria 4643
565 nmdc:mga05p37_6660_c1 3300050507 Bacteria 13630
566 nmdc:mga05p37_67273_c1 3300050507 Bacteria 4408
567 nmdc:mga05p37_6_c1 3300050507 Bacteria 155503
568 nmdc:mga05p37_768505_c1 3300050507 Bacteria 1059
569 nmdc:mga09592_159_c1 3300050508 Bacteria 47011
570 nmdc:mga09592_1747_c1 3300050508 Bacteria 17460
571 nmdc:mga09592_25844_c1 3300050508 Bacteria 4863
572 nmdc:mga09592_289732_c1 3300050508 Bacteria 1419
573 nmdc:mga09592_3854_c1 3300050508 Bacteria 12072
574 nmdc:mga09592_46347_c1 3300050508 Bacteria 3663
575 nmdc:mga09592_8228_c1 3300050508 Bacteria 8481
576 nmdc:mga0qj67_109653_c1 3300050509 Bacteria 2228
577 nmdc:mga0qj67_154902_c1 3300050509 Bacteria 1859
578 nmdc:mga0qj67_28180_c1 3300050509 Bacteria 4358
579 nmdc:mga0qj67_474_c1 3300050509 Bacteria 27378
580 nmdc:mga06r32_130290_c1 3300050510 Bacteria 2487
581 nmdc:mga06r32_2028_c1 3300050510 Bacteria 18108
582 nmdc:mga06r32_232747_c1 3300050510 Bacteria 1830
583 nmdc:mga06r32_25044_c1 3300050510 Bacteria 5545
584 nmdc:mga06r32_3585_c1 3300050510 Bacteria 13853
585 nmdc:mga06r32_361_c1 3300050510 Bacteria 38128
586 nmdc:mga06r32_362_c1 3300050510 Bacteria 38094
587 nmdc:mga06r32_36558_c1 3300050510 Bacteria 4641
588 nmdc:mga06r32_405047_c1 3300050510 Bacteria 1346
589 nmdc:mga06r32_40567_c1 3300050510 Bacteria 4420
590 nmdc:mga06r32_64638_c1 3300050510 Bacteria 3528
591 nmdc:mga06r32_70576_c1 3300050510 Bacteria 3379
592 nmdc:mga06r32_763548_c1 3300050510 Unclassified 929
593 nmdc:mga06r32_9821_c1 3300050510 Bacteria 8634
594 nmdc:mga08y16_233459_c1 3300050511 Bacteria 1902
595 nmdc:mga08y16_2863_c1 3300050511 Bacteria 17747
596 nmdc:mga08y16_4495_c1 3300050511 Bacteria 14572
597 nmdc:mga08y16_46350_c1 3300050511 Bacteria 4551
598 nmdc:mga0n895_13531_c1 3300050512 Bacteria 7368
599 nmdc:mga0n895_141599_c1 3300050512 Bacteria 2434
600 nmdc:mga0n895_16149_c1 3300050512 Bacteria 6843
601 nmdc:mga0n895_20052_c1 3300050512 Bacteria 6226
602 nmdc:mga0n895_226260_c1 3300050512 Bacteria 1899
603 nmdc:mga0n895_287693_c1 3300050512 Bacteria 1666
604 nmdc:mga0n895_48577_c1 3300050512 Bacteria 4154
605 nmdc:mga0n895_528498_c1 3300050512 Bacteria 1187
606 nmdc:mga0n895_66753_c1 3300050512 Bacteria 3562
607 nmdc:mga0n895_66809_c1 3300050512 Bacteria 3560
608 nmdc:mga0n895_713_c1 3300050512 Bacteria 23385
609 nmdc:mga0n895_81594_c1 3300050512 Bacteria 3223
610 nmdc:mga0n895_85666_c1 3300050512 Bacteria 3146
611 nmdc:mga0n895_8963_c1 3300050512 Bacteria 8722
612 nmdc:mga0rr50_1514_c1 3300050513 Bacteria 12803
613 nmdc:mga0rr50_184105_c1 3300050513 Bacteria 1709
614 nmdc:mga0rr50_228853_c1 3300050513 Bacteria 1538
615 nmdc:mga0rr50_270921_c1 3300050513 Bacteria 1415
616 nmdc:mga0rr50_292766_c1 3300050513 Bacteria 1361
617 nmdc:mga0rr50_4899_c2 3300050513 Bacteria 6978
618 nmdc:mga0rr50_49292_c1 3300050513 Bacteria 3118
619 nmdc:mga0rr50_88857_c1 3300050513 Bacteria 2401
620 nmdc:mga0rr50_9978_c1 3300050513 Bacteria 6005
621 nmdc:mga08x19_112247_c1 3300050514 Bacteria 1819
622 nmdc:mga08x19_27650_c1 3300050514 Bacteria 3548
623 nmdc:mga08x19_43214_c1 3300050514 Bacteria 2875
624 nmdc:mga08x19_6921_c1 3300050514 Bacteria 6735
625 nmdc:mga08x19_963_c1 3300050514 Bacteria 18072
626 nmdc:mga0a205_14189_c1 3300050515 Bacteria 7432
627 nmdc:mga0a205_1824_c1 3300050515 Bacteria 18416
628 nmdc:mga0a205_19278_c1 3300050515 Bacteria 6428
629 nmdc:mga0a205_2149_c1 3300050515 Bacteria 17313
630 nmdc:mga0a205_252626_c1 3300050515 Bacteria 1642
631 nmdc:mga0a205_318363_c1 3300050515 Bacteria 1427
632 nmdc:mga0a205_3835_c1 3300050515 Bacteria 13471
633 nmdc:mga0a205_50847_c1 3300050515 Bacteria 4001
634 nmdc:mga0a205_57545_c1 3300050515 Bacteria 3754
635 nmdc:mga0a205_58846_c1 3300050515 Bacteria 3712
636 nmdc:mga0a205_59855_c1 3300050515 Bacteria 3679
637 nmdc:mga0a205_85539_c1 3300050515 Bacteria 3045
638 Ga0501084_0000139 3300054114 Bacteria 54829
639 Ga0501084_0042821 3300054114 Bacteria 3788
640 Ga0501084_0062480 3300054114 Bacteria 3118
641 Ga0501084_0095416 3300054114 Bacteria 2498
642 Ga0501084_0110303 3300054114 Bacteria 2312
643 Ga0501084_0135457 3300054114 Bacteria 2074
644 Ga0501082_0000528 3300060353 Bacteria 34016
645 Ga0501082_0058879 3300060353 Bacteria 3310
646 Ga0501082_0086041 3300060353 Bacteria 2711
647 Ga0530510_0065148 3300061734 Bacteria 2640
648 Ga0530510_0128740 3300061734 Bacteria 1862
649 Ga0530510_0159604 3300061734 Bacteria 1667
650 Ga0530510_0214423 3300061734 Bacteria 1430
651 Ga0530510_0217974 3300061734 Bacteria 1418
652 Ga0530510_0227999 3300061734 Bacteria 1385
653 Ga0530510_0356966 3300061734 Bacteria 1098
654 Ga0530510_0358496 3300061734 Bacteria 1096

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10085682 Ga0081538_100856823 256
2 3300006846 Ga0075430_100070655 Ga0075430_1000706553 256
3 3300006847 Ga0075431_100002318 Ga0075431_10000231819 256
4 3300006852 Ga0075433_10010195 Ga0075433_100101952 256
5 3300006852 Ga0075433_10013834 Ga0075433_100138346 256
6 3300006852 Ga0075433_10024303 Ga0075433_100243032 256
7 3300006871 Ga0075434_100081534 Ga0075434_1000815342 256
8 3300009094 Ga0111539_10016096 Ga0111539_100160964 256
9 3300025933 Ga0207706_10713869 Ga0207706_107138691 256
10 3300027907 Ga0207428_10000054 Ga0207428_1000005424 256
11 3300028380 Ga0268265_10016149 Ga0268265_100161494 256
12 3300042876 Ga0451577_0028473 Ga0451577_0028473_839_1609 256
13 3300044673 Ga0453683_0021188 Ga0453683_0021188_1631_2401 256
14 3300044712 Ga0453684_0022188 Ga0453684_0022188_7426_8196 256
15 3300045051 Ga0451576_0176658 Ga0451576_0176658_813_1583 256
16 3300045051 Ga0451576_0221170 Ga0451576_0221170_75_845 256
17 3300050510 nmdc:mga06r32_362_c1 nmdc:mga06r32_362_c1_20506_21276 256
18 3300050511 nmdc:mga08y16_2863_c1 nmdc:mga08y16_2863_c1_12481_13251 256
19 3300050512 nmdc:mga0n895_48577_c1 nmdc:mga0n895_48577_c1_2934_3704 256
20 3300050512 nmdc:mga0n895_528498_c1 nmdc:mga0n895_528498_c1_127_897 256
21 3300050512 nmdc:mga0n895_66809_c1 nmdc:mga0n895_66809_c1_716_1486 256
22 3300050513 nmdc:mga0rr50_88857_c1 nmdc:mga0rr50_88857_c1_1574_2344 256
23 3300050515 nmdc:mga0a205_1824_c1 nmdc:mga0a205_1824_c1_832_1602 256
24 3300050515 nmdc:mga0a205_3835_c1 nmdc:mga0a205_3835_c1_9354_10124 256
25 3300005295 Ga0065707_10012903 Ga0065707_100129031 257
26 3300005328 Ga0070676_10005622 Ga0070676_100056224 257
27 3300005329 Ga0070683_100083081 Ga0070683_1000830812 257
28 3300005330 Ga0070690_100119744 Ga0070690_1001197443 257
29 3300005331 Ga0070670_100115006 Ga0070670_1001150062 257
30 3300005334 Ga0068869_100000012 Ga0068869_10000001215 257
31 3300005336 Ga0070680_100004085 Ga0070680_10000408512 257
32 3300005336 Ga0070680_100015564 Ga0070680_1000155647 257
33 3300005336 Ga0070680_100057128 Ga0070680_1000571284 257
34 3300005337 Ga0070682_100000192 Ga0070682_10000019213 257
35 3300005339 Ga0070660_100000614 Ga0070660_10000061417 257
36 3300005340 Ga0070689_100045755 Ga0070689_1000457551 257
37 3300005341 Ga0070691_10000893 Ga0070691_1000089310 257
38 3300005341 Ga0070691_10019301 Ga0070691_100193012 257
39 3300005341 Ga0070691_10028394 Ga0070691_100283942 257
40 3300005343 Ga0070687_100023875 Ga0070687_1000238753 257
41 3300005344 Ga0070661_100000917 Ga0070661_10000091720 257
42 3300005345 Ga0070692_10009036 Ga0070692_100090364 257
43 3300005345 Ga0070692_10105082 Ga0070692_101050821 257
44 3300005347 Ga0070668_100142255 Ga0070668_1001422553 257
45 3300005353 Ga0070669_100118814 Ga0070669_1001188142 257
46 3300005354 Ga0070675_100443568 Ga0070675_1004435682 257
47 3300005364 Ga0070673_100171677 Ga0070673_1001716772 257
48 3300005366 Ga0070659_100000328 Ga0070659_10000032836 257
49 3300005406 Ga0070703_10001692 Ga0070703_100016924 257
50 3300005406 Ga0070703_10003696 Ga0070703_100036964 257
51 3300005406 Ga0070703_10118539 Ga0070703_101185391 257
52 3300005438 Ga0070701_10045580 Ga0070701_100455803 257
53 3300005438 Ga0070701_10068686 Ga0070701_100686862 257
54 3300005438 Ga0070701_10089428 Ga0070701_100894282 257
55 3300005440 Ga0070705_100000714 Ga0070705_10000071419 257
56 3300005440 Ga0070705_100021749 Ga0070705_1000217492 257
57 3300005440 Ga0070705_100071245 Ga0070705_1000712452 257
58 3300005444 Ga0070694_100000221 Ga0070694_1000002216 257
59 3300005444 Ga0070694_100000708 Ga0070694_10000070815 257
60 3300005444 Ga0070694_100043253 Ga0070694_1000432533 257
61 3300005444 Ga0070694_100093269 Ga0070694_1000932692 257
62 3300005444 Ga0070694_100161904 Ga0070694_1001619042 257
63 3300005444 Ga0070694_100176718 Ga0070694_1001767182 257
64 3300005445 Ga0070708_100022076 Ga0070708_1000220764 257
65 3300005445 Ga0070708_100029245 Ga0070708_1000292455 257
66 3300005445 Ga0070708_100057003 Ga0070708_1000570032 257
67 3300005445 Ga0070708_100171376 Ga0070708_1001713762 257
68 3300005445 Ga0070708_100232125 Ga0070708_1002321253 257
69 3300005445 Ga0070708_100240439 Ga0070708_1002404392 257
70 3300005445 Ga0070708_100264015 Ga0070708_1002640152 257
71 3300005457 Ga0070662_100227690 Ga0070662_1002276902 257
72 3300005458 Ga0070681_10003830 Ga0070681_1000383012 257
73 3300005459 Ga0068867_100002111 Ga0068867_10000211112 257
74 3300005459 Ga0068867_100621964 Ga0068867_1006219641 257
75 3300005467 Ga0070706_100002217 Ga0070706_1000022175 257
76 3300005467 Ga0070706_100029148 Ga0070706_1000291484 257
77 3300005467 Ga0070706_100202998 Ga0070706_1002029982 257
78 3300005467 Ga0070706_100280036 Ga0070706_1002800362 257
79 3300005467 Ga0070706_100336058 Ga0070706_1003360581 257
80 3300005468 Ga0070707_100022952 Ga0070707_1000229525 257
81 3300005468 Ga0070707_100049522 Ga0070707_1000495223 257
82 3300005468 Ga0070707_100066131 Ga0070707_1000661313 257
83 3300005468 Ga0070707_100067507 Ga0070707_1000675074 257
84 3300005468 Ga0070707_100078244 Ga0070707_1000782442 257
85 3300005468 Ga0070707_100193981 Ga0070707_1001939812 257
86 3300005468 Ga0070707_100408190 Ga0070707_1004081901 257
87 3300005468 Ga0070707_100677776 Ga0070707_1006777761 257
88 3300005471 Ga0070698_100017214 Ga0070698_1000172146 257
89 3300005471 Ga0070698_100039179 Ga0070698_1000391793 257
90 3300005471 Ga0070698_100049290 Ga0070698_1000492906 257
91 3300005471 Ga0070698_100091467 Ga0070698_1000914674 257
92 3300005471 Ga0070698_100205367 Ga0070698_1002053672 257
93 3300005471 Ga0070698_100245473 Ga0070698_1002454733 257
94 3300005471 Ga0070698_100262409 Ga0070698_1002624092 257
95 3300005471 Ga0070698_100333828 Ga0070698_1003338281 257
96 3300005518 Ga0070699_100001395 Ga0070699_1000013959 257
97 3300005518 Ga0070699_100023904 Ga0070699_1000239043 257
98 3300005518 Ga0070699_100045128 Ga0070699_1000451282 257
99 3300005518 Ga0070699_100065744 Ga0070699_1000657443 257
100 3300005518 Ga0070699_100103209 Ga0070699_1001032093 257
101 3300005518 Ga0070699_100184565 Ga0070699_1001845652 257
102 3300005518 Ga0070699_100203064 Ga0070699_1002030642 257
103 3300005518 Ga0070699_100388053 Ga0070699_1003880532 257
104 3300005530 Ga0070679_100005622 Ga0070679_1000056224 257
105 3300005530 Ga0070679_100255469 Ga0070679_1002554692 257
106 3300005535 Ga0070684_100023397 Ga0070684_1000233975 257
107 3300005536 Ga0070697_100001688 Ga0070697_10000168820 257
108 3300005536 Ga0070697_100003552 Ga0070697_1000035527 257
109 3300005536 Ga0070697_100004819 Ga0070697_10000481912 257
110 3300005536 Ga0070697_100018024 Ga0070697_1000180246 257
111 3300005536 Ga0070697_100069620 Ga0070697_1000696204 257
112 3300005536 Ga0070697_100096985 Ga0070697_1000969852 257
113 3300005536 Ga0070697_100411272 Ga0070697_1004112722 257
114 3300005539 Ga0068853_100000637 Ga0068853_10000063719 257
115 3300005543 Ga0070672_100148379 Ga0070672_1001483793 257
116 3300005544 Ga0070686_100043725 Ga0070686_1000437252 257
117 3300005545 Ga0070695_100002800 Ga0070695_1000028008 257
118 3300005545 Ga0070695_100003216 Ga0070695_10000321610 257
119 3300005545 Ga0070695_100006214 Ga0070695_1000062144 257
120 3300005545 Ga0070695_100011346 Ga0070695_1000113465 257
121 3300005545 Ga0070695_100101955 Ga0070695_1001019553 257
122 3300005545 Ga0070695_100186614 Ga0070695_1001866142 257
123 3300005545 Ga0070695_100254997 Ga0070695_1002549971 257
124 3300005545 Ga0070695_100369913 Ga0070695_1003699132 257
125 3300005546 Ga0070696_100004086 Ga0070696_1000040862 257
126 3300005546 Ga0070696_100007298 Ga0070696_1000072984 257
127 3300005546 Ga0070696_100182700 Ga0070696_1001827002 257
128 3300005546 Ga0070696_100183129 Ga0070696_1001831292 257
129 3300005546 Ga0070696_100288061 Ga0070696_1002880612 257
130 3300005546 Ga0070696_100594406 Ga0070696_1005944061 257
131 3300005547 Ga0070693_100000097 Ga0070693_1000000975 257
132 3300005549 Ga0070704_100001786 Ga0070704_10000178611 257
133 3300005549 Ga0070704_100049550 Ga0070704_1000495504 257
134 3300005549 Ga0070704_100070456 Ga0070704_1000704561 257
135 3300005549 Ga0070704_100188220 Ga0070704_1001882202 257
136 3300005549 Ga0070704_100354285 Ga0070704_1003542852 257
137 3300005563 Ga0068855_100000362 Ga0068855_10000036221 257
138 3300005577 Ga0068857_100004826 Ga0068857_1000048264 257
139 3300005577 Ga0068857_100128089 Ga0068857_1001280893 257
140 3300005577 Ga0068857_100144389 Ga0068857_1001443893 257
141 3300005577 Ga0068857_100223363 Ga0068857_1002233632 257
142 3300005578 Ga0068854_100000762 Ga0068854_10000076220 257
143 3300005578 Ga0068854_100170710 Ga0068854_1001707103 257
144 3300005578 Ga0068854_100220617 Ga0068854_1002206172 257
145 3300005615 Ga0070702_100001731 Ga0070702_1000017315 257
146 3300005615 Ga0070702_100184973 Ga0070702_1001849732 257
147 3300005616 Ga0068852_100277289 Ga0068852_1002772892 257
148 3300005617 Ga0068859_100000348 Ga0068859_10000034840 257
149 3300005617 Ga0068859_100052363 Ga0068859_1000523634 257
150 3300005617 Ga0068859_100504862 Ga0068859_1005048622 257
151 3300005718 Ga0068866_10032193 Ga0068866_100321934 257
152 3300005719 Ga0068861_100010479 Ga0068861_1000104796 257
153 3300005840 Ga0068870_10000443 Ga0068870_100004433 257
154 3300005840 Ga0068870_10005194 Ga0068870_100051946 257
155 3300005841 Ga0068863_100010811 Ga0068863_1000108116 257
156 3300005841 Ga0068863_100178034 Ga0068863_1001780343 257
157 3300005842 Ga0068858_100021860 Ga0068858_1000218603 257
158 3300005843 Ga0068860_100004134 Ga0068860_1000041348 257
159 3300005843 Ga0068860_100008783 Ga0068860_1000087838 257
160 3300005843 Ga0068860_100167050 Ga0068860_1001670502 257
161 3300005843 Ga0068860_100595111 Ga0068860_1005951111 257
162 3300005844 Ga0068862_100003329 Ga0068862_10000332912 257
163 3300005844 Ga0068862_100130474 Ga0068862_1001304742 257
164 3300005844 Ga0068862_100212158 Ga0068862_1002121582 257
165 3300005844 Ga0068862_100320213 Ga0068862_1003202132 257
166 3300005844 Ga0068862_100603583 Ga0068862_1006035832 257
167 3300005844 Ga0068862_100743257 Ga0068862_1007432572 257
168 3300005937 Ga0081455_10000499 Ga0081455_1000049951 257
169 3300005937 Ga0081455_10320932 Ga0081455_103209322 257
170 3300005981 Ga0081538_10176870 Ga0081538_101768701 257
171 3300005985 Ga0081539_10000002 Ga0081539_1000000248 257
172 3300006175 Ga0070712_100003614 Ga0070712_1000036148 257
173 3300006358 Ga0068871_100342696 Ga0068871_1003426961 257
174 3300006844 Ga0075428_100000032 Ga0075428_100000032121 257
175 3300006844 Ga0075428_100000837 Ga0075428_10000083725 257
176 3300006844 Ga0075428_100004443 Ga0075428_10000444312 257
177 3300006844 Ga0075428_100050842 Ga0075428_1000508427 257
178 3300006844 Ga0075428_100126209 Ga0075428_1001262094 257
179 3300006846 Ga0075430_100000002 Ga0075430_100000002107 257
180 3300006846 Ga0075430_100000030 Ga0075430_10000003078 257
181 3300006846 Ga0075430_100014005 Ga0075430_1000140053 257
182 3300006846 Ga0075430_100135124 Ga0075430_1001351242 257
183 3300006847 Ga0075431_100000009 Ga0075431_10000000982 257
184 3300006847 Ga0075431_100000013 Ga0075431_10000001321 257
185 3300006847 Ga0075431_100001893 Ga0075431_10000189317 257
186 3300006847 Ga0075431_100003218 Ga0075431_10000321813 257
187 3300006847 Ga0075431_100004225 Ga0075431_1000042255 257
188 3300006847 Ga0075431_100005455 Ga0075431_10000545512 257
189 3300006847 Ga0075431_100018582 Ga0075431_1000185827 257
190 3300006847 Ga0075431_100022755 Ga0075431_1000227559 257
191 3300006847 Ga0075431_100027671 Ga0075431_1000276712 257
192 3300006847 Ga0075431_100175333 Ga0075431_1001753333 257
193 3300006847 Ga0075431_100182461 Ga0075431_1001824613 257
194 3300006847 Ga0075431_100330305 Ga0075431_1003303052 257
195 3300006852 Ga0075433_10000017 Ga0075433_100000174 257
196 3300006852 Ga0075433_10000121 Ga0075433_1000012135 257
197 3300006852 Ga0075433_10080101 Ga0075433_100801013 257
198 3300006852 Ga0075433_10082823 Ga0075433_100828232 257
199 3300006852 Ga0075433_10083173 Ga0075433_100831734 257
200 3300006852 Ga0075433_10102909 Ga0075433_101029094 257
201 3300006852 Ga0075433_10120121 Ga0075433_101201212 257
202 3300006852 Ga0075433_10216856 Ga0075433_102168562 257
203 3300006852 Ga0075433_10261963 Ga0075433_102619632 257
204 3300006871 Ga0075434_100001334 Ga0075434_10000133417 257
205 3300006871 Ga0075434_100013675 Ga0075434_1000136751 257
206 3300006871 Ga0075434_100021778 Ga0075434_1000217786 257
207 3300006871 Ga0075434_100036779 Ga0075434_1000367797 257
208 3300006871 Ga0075434_100049904 Ga0075434_1000499042 257
209 3300006871 Ga0075434_100065440 Ga0075434_1000654404 257
210 3300006871 Ga0075434_100096516 Ga0075434_1000965163 257
211 3300006871 Ga0075434_100142711 Ga0075434_1001427114 257
212 3300006871 Ga0075434_100283348 Ga0075434_1002833482 257
213 3300006871 Ga0075434_100823434 Ga0075434_1008234342 257
214 3300006880 Ga0075429_100000006 Ga0075429_10000000617 257
215 3300006880 Ga0075429_100001526 Ga0075429_10000152612 257
216 3300006880 Ga0075429_100007453 Ga0075429_10000745311 257
217 3300006880 Ga0075429_100007721 Ga0075429_1000077219 257
218 3300006880 Ga0075429_100009193 Ga0075429_1000091939 257
219 3300006880 Ga0075429_100010942 Ga0075429_1000109425 257
220 3300006880 Ga0075429_100196690 Ga0075429_1001966903 257
221 3300006880 Ga0075429_100327380 Ga0075429_1003273801 257
222 3300006881 Ga0068865_100282995 Ga0068865_1002829951 257
223 3300006914 Ga0075436_100005968 Ga0075436_1000059682 257
224 3300006914 Ga0075436_100052367 Ga0075436_1000523674 257
225 3300006914 Ga0075436_100157523 Ga0075436_1001575231 257
226 3300006914 Ga0075436_100170575 Ga0075436_1001705752 257
227 3300006914 Ga0075436_100292802 Ga0075436_1002928022 257
228 3300006931 Ga0097620_100000348 Ga0097620_10000034840 257
229 3300006931 Ga0097620_100052361 Ga0097620_1000523613 257
230 3300006931 Ga0097620_100504860 Ga0097620_1005048602 257
231 3300007076 Ga0075435_100002475 Ga0075435_10000247513 257
232 3300007076 Ga0075435_100004315 Ga0075435_1000043157 257
233 3300007076 Ga0075435_100021302 Ga0075435_1000213024 257
234 3300007076 Ga0075435_100032600 Ga0075435_1000326004 257
235 3300007076 Ga0075435_100611377 Ga0075435_1006113771 257
236 3300007265 Ga0099794_10003767 Ga0099794_100037672 257
237 3300007265 Ga0099794_10005009 Ga0099794_100050095 257
238 3300007265 Ga0099794_10034390 Ga0099794_100343902 257
239 3300009094 Ga0111539_10006297 Ga0111539_1000629715 257
240 3300009094 Ga0111539_10028818 Ga0111539_100288186 257
241 3300009094 Ga0111539_10321074 Ga0111539_103210742 257
242 3300009098 Ga0105245_10784931 Ga0105245_107849311 257
243 3300009101 Ga0105247_10163505 Ga0105247_101635052 257
244 3300009147 Ga0114129_10000053 Ga0114129_1000005343 257
245 3300009147 Ga0114129_10000182 Ga0114129_1000018225 257
246 3300009147 Ga0114129_10000454 Ga0114129_1000045431 257
247 3300009147 Ga0114129_10004798 Ga0114129_1000479818 257
248 3300009147 Ga0114129_10005559 Ga0114129_1000555916 257
249 3300009147 Ga0114129_10011655 Ga0114129_100116557 257
250 3300009147 Ga0114129_10036137 Ga0114129_100361379 257
251 3300009147 Ga0114129_10055460 Ga0114129_100554606 257
252 3300009147 Ga0114129_10056921 Ga0114129_100569213 257
253 3300009147 Ga0114129_10073458 Ga0114129_100734586 257
254 3300009147 Ga0114129_10084238 Ga0114129_100842383 257
255 3300009147 Ga0114129_10097091 Ga0114129_100970915 257
256 3300009147 Ga0114129_10156876 Ga0114129_101568761 257
257 3300009147 Ga0114129_10301204 Ga0114129_103012042 257
258 3300009147 Ga0114129_10380014 Ga0114129_103800143 257
259 3300009147 Ga0114129_10428723 Ga0114129_104287232 257
260 3300009147 Ga0114129_10887056 Ga0114129_108870562 257
261 3300009147 Ga0114129_10947783 Ga0114129_109477831 257
262 3300009148 Ga0105243_10055485 Ga0105243_100554852 257
263 3300009148 Ga0105243_10094370 Ga0105243_100943702 257
264 3300009148 Ga0105243_10157637 Ga0105243_101576372 257
265 3300009174 Ga0105241_10031744 Ga0105241_100317443 257
266 3300009174 Ga0105241_10081797 Ga0105241_100817972 257
267 3300009176 Ga0105242_10092043 Ga0105242_100920434 257
268 3300009176 Ga0105242_10214481 Ga0105242_102144812 257
269 3300009177 Ga0105248_10067618 Ga0105248_100676184 257
270 3300009177 Ga0105248_10317192 Ga0105248_103171922 257
271 3300009553 Ga0105249_10044073 Ga0105249_100440734 257
272 3300009553 Ga0105249_10064946 Ga0105249_100649463 257
273 3300011119 Ga0105246_10737164 Ga0105246_107371641 257
274 3300013100 Ga0157373_10000316 Ga0157373_100003164 257
275 3300013102 Ga0157371_10075398 Ga0157371_100753982 257
276 3300013105 Ga0157369_10008219 Ga0157369_1000821911 257
277 3300013297 Ga0157378_10168322 Ga0157378_101683223 257
278 3300013306 Ga0163162_10006161 Ga0163162_100061617 257
279 3300013306 Ga0163162_10614278 Ga0163162_106142781 257
280 3300013307 Ga0157372_10000280 Ga0157372_1000028021 257
281 3300013307 Ga0157372_10094378 Ga0157372_100943784 257
282 3300013308 Ga0157375_10439497 Ga0157375_104394972 257
283 3300014326 Ga0157380_10024963 Ga0157380_100249634 257
284 3300017792 Ga0163161_10285016 Ga0163161_102850162 257
285 3300025885 Ga0207653_10003277 Ga0207653_100032776 257
286 3300025885 Ga0207653_10006684 Ga0207653_100066843 257
287 3300025885 Ga0207653_10119934 Ga0207653_101199341 257
288 3300025899 Ga0207642_10070914 Ga0207642_100709141 257
289 3300025901 Ga0207688_10008008 Ga0207688_100080084 257
290 3300025904 Ga0207647_10019631 Ga0207647_100196316 257
291 3300025907 Ga0207645_10001727 Ga0207645_1000172710 257
292 3300025908 Ga0207643_10001135 Ga0207643_1000113516 257
293 3300025908 Ga0207643_10021877 Ga0207643_100218774 257
294 3300025910 Ga0207684_10001398 Ga0207684_1000139812 257
295 3300025910 Ga0207684_10003869 Ga0207684_100038696 257
296 3300025910 Ga0207684_10015250 Ga0207684_100152505 257
297 3300025910 Ga0207684_10037779 Ga0207684_100377794 257
298 3300025910 Ga0207684_10063626 Ga0207684_100636262 257
299 3300025910 Ga0207684_10183616 Ga0207684_101836162 257
300 3300025910 Ga0207684_10195228 Ga0207684_101952282 257
301 3300025910 Ga0207684_10335781 Ga0207684_103357812 257
302 3300025910 Ga0207684_10445655 Ga0207684_104456552 257
303 3300025911 Ga0207654_10001729 Ga0207654_100017299 257
304 3300025911 Ga0207654_10099656 Ga0207654_100996563 257
305 3300025912 Ga0207707_10000034 Ga0207707_1000003465 257
306 3300025914 Ga0207671_10063819 Ga0207671_100638192 257
307 3300025915 Ga0207693_10006771 Ga0207693_100067716 257
308 3300025915 Ga0207693_10078261 Ga0207693_100782612 257
309 3300025916 Ga0207663_10186000 Ga0207663_101860002 257
310 3300025917 Ga0207660_10000382 Ga0207660_1000038223 257
311 3300025917 Ga0207660_10056472 Ga0207660_100564723 257
312 3300025917 Ga0207660_10546421 Ga0207660_105464212 257
313 3300025918 Ga0207662_10121548 Ga0207662_101215482 257
314 3300025919 Ga0207657_10002825 Ga0207657_100028252 257
315 3300025920 Ga0207649_10002273 Ga0207649_1000227313 257
316 3300025921 Ga0207652_10000430 Ga0207652_1000043010 257
317 3300025921 Ga0207652_10200712 Ga0207652_102007122 257
318 3300025922 Ga0207646_10001023 Ga0207646_1000102331 257
319 3300025922 Ga0207646_10007724 Ga0207646_1000772412 257
320 3300025922 Ga0207646_10016616 Ga0207646_100166163 257
321 3300025922 Ga0207646_10020663 Ga0207646_100206638 257
322 3300025922 Ga0207646_10045011 Ga0207646_100450114 257
323 3300025922 Ga0207646_10103231 Ga0207646_101032311 257
324 3300025922 Ga0207646_10290742 Ga0207646_102907421 257
325 3300025922 Ga0207646_10317309 Ga0207646_103173092 257
326 3300025922 Ga0207646_10341083 Ga0207646_103410832 257
327 3300025922 Ga0207646_10514047 Ga0207646_105140471 257
328 3300025922 Ga0207646_10657066 Ga0207646_106570661 257
329 3300025925 Ga0207650_10002719 Ga0207650_1000271913 257
330 3300025926 Ga0207659_10660870 Ga0207659_106608701 257
331 3300025932 Ga0207690_10003117 Ga0207690_100031174 257
332 3300025933 Ga0207706_10077976 Ga0207706_100779764 257
333 3300025933 Ga0207706_10136232 Ga0207706_101362322 257
334 3300025934 Ga0207686_10278618 Ga0207686_102786182 257
335 3300025935 Ga0207709_10043293 Ga0207709_100432933 257
336 3300025935 Ga0207709_10057711 Ga0207709_100577112 257
337 3300025935 Ga0207709_10135297 Ga0207709_101352971 257
338 3300025936 Ga0207670_10047938 Ga0207670_100479384 257
339 3300025938 Ga0207704_10346380 Ga0207704_103463801 257
340 3300025939 Ga0207665_10020047 Ga0207665_100200472 257
341 3300025940 Ga0207691_10070576 Ga0207691_100705762 257
342 3300025941 Ga0207711_10106718 Ga0207711_101067184 257
343 3300025941 Ga0207711_10566277 Ga0207711_105662772 257
344 3300025942 Ga0207689_10000153 Ga0207689_1000015346 257
345 3300025942 Ga0207689_10017750 Ga0207689_100177502 257
346 3300025942 Ga0207689_10081732 Ga0207689_100817322 257
347 3300025942 Ga0207689_10156706 Ga0207689_101567063 257
348 3300025944 Ga0207661_10063648 Ga0207661_100636484 257
349 3300025945 Ga0207679_10002005 Ga0207679_1000200511 257
350 3300025949 Ga0207667_10000308 Ga0207667_100003085 257
351 3300025960 Ga0207651_10037435 Ga0207651_100374354 257
352 3300025961 Ga0207712_10003979 Ga0207712_100039797 257
353 3300025961 Ga0207712_10035886 Ga0207712_100358863 257
354 3300025961 Ga0207712_10197381 Ga0207712_101973812 257
355 3300025981 Ga0207640_10003433 Ga0207640_100034336 257
356 3300025986 Ga0207658_10319709 Ga0207658_103197092 257
357 3300026023 Ga0207677_10053492 Ga0207677_100534922 257
358 3300026023 Ga0207677_10503537 Ga0207677_105035371 257
359 3300026035 Ga0207703_10006298 Ga0207703_100062983 257
360 3300026035 Ga0207703_10203758 Ga0207703_102037581 257
361 3300026041 Ga0207639_10000976 Ga0207639_1000097614 257
362 3300026075 Ga0207708_10104728 Ga0207708_101047282 257
363 3300026078 Ga0207702_10000652 Ga0207702_1000065216 257
364 3300026088 Ga0207641_10025025 Ga0207641_100250253 257
365 3300026088 Ga0207641_10154821 Ga0207641_101548212 257
366 3300026089 Ga0207648_10000169 Ga0207648_1000016927 257
367 3300026089 Ga0207648_10115205 Ga0207648_101152051 257
368 3300026095 Ga0207676_10033771 Ga0207676_100337714 257
369 3300026095 Ga0207676_10530760 Ga0207676_105307602 257
370 3300026116 Ga0207674_10000050 Ga0207674_1000005020 257
371 3300026116 Ga0207674_10071805 Ga0207674_100718054 257
372 3300026116 Ga0207674_10175770 Ga0207674_101757703 257
373 3300026118 Ga0207675_100011174 Ga0207675_1000111748 257
374 3300026118 Ga0207675_100104588 Ga0207675_1001045882 257
375 3300026118 Ga0207675_100128949 Ga0207675_1001289493 257
376 3300026142 Ga0207698_10214271 Ga0207698_102142712 257
377 3300027462 Ga0210000_1006161 Ga0210000_10061613 257
378 3300027471 Ga0209995_1000557 Ga0209995_10005577 257
379 3300027526 Ga0209968_1003187 Ga0209968_10031872 257
380 3300027543 Ga0209999_1003564 Ga0209999_10035643 257
381 3300027614 Ga0209970_1001167 Ga0209970_10011673 257
382 3300027665 Ga0209983_1001441 Ga0209983_10014415 257
383 3300027671 Ga0209588_1049838 Ga0209588_10498382 257
384 3300027682 Ga0209971_1000103 Ga0209971_100010322 257
385 3300027682 Ga0209971_1017624 Ga0209971_10176242 257
386 3300027695 Ga0209966_1000042 Ga0209966_100004228 257
387 3300027717 Ga0209998_10000127 Ga0209998_1000012722 257
388 3300027876 Ga0209974_10000436 Ga0209974_1000043610 257
389 3300027907 Ga0207428_10007442 Ga0207428_1000744210 257
390 3300028380 Ga0268265_10003808 Ga0268265_100038082 257
391 3300028380 Ga0268265_10007220 Ga0268265_100072202 257
392 3300028380 Ga0268265_10011871 Ga0268265_100118715 257
393 3300028380 Ga0268265_10424943 Ga0268265_104249431 257
394 3300028381 Ga0268264_10008214 Ga0268264_100082148 257
395 3300028381 Ga0268264_10074280 Ga0268264_100742803 257
396 3300028381 Ga0268264_10519338 Ga0268264_105193382 257
397 3300031548 Ga0307408_100085026 Ga0307408_1000850262 257
398 3300031824 Ga0307413_10354035 Ga0307413_103540352 257
399 3300031903 Ga0307407_10020838 Ga0307407_100208383 257
400 3300031911 Ga0307412_10367363 Ga0307412_103673632 257
401 3300031995 Ga0307409_100006456 Ga0307409_1000064562 257
402 3300031995 Ga0307409_100369120 Ga0307409_1003691202 257
403 3300032002 Ga0307416_100015112 Ga0307416_1000151127 257
404 3300032002 Ga0307416_100322510 Ga0307416_1003225102 257
405 3300032002 Ga0307416_100509513 Ga0307416_1005095132 257
406 3300032005 Ga0307411_10232251 Ga0307411_102322512 257
407 3300034817 Ga0373948_0008669 Ga0373948_0008669_823_1596 257
408 3300034820 Ga0373959_0010524 Ga0373959_0010524_611_1384 257
409 3300035090 Ga0373949_0005449 Ga0373949_0005449_1263_2036 257
410 3300035091 Ga0373951_0041814 Ga0373951_0041814_254_1027 257
411 3300035092 Ga0373952_0012965 Ga0373952_0012965_224_997 257
412 3300035112 Ga0373932_0069502 Ga0373932_0069502_40_813 257
413 3300035121 Ga0373960_0006606 Ga0373960_0006606_1066_1839 257
414 3300035121 Ga0373960_0062503 Ga0373960_0062503_332_1105 257
415 3300035241 Ga0373961_0002388 Ga0373961_0002388_2180_2953 257
416 3300035242 Ga0373962_0014767 Ga0373962_0014767_863_1636 257
417 3300035691 Ga0373931_0016937 Ga0373931_0016937_1202_1975 257
418 3300035691 Ga0373931_0092001 Ga0373931_0092001_159_932 257
419 3300037312 Ga0395899_0120663 Ga0395899_0120663_264_1037 257
420 3300037418 Ga0395900_0002528 Ga0395900_0002528_18500_19273 257
421 3300037418 Ga0395900_0639401 Ga0395900_0639401_83_856 257
422 3300037466 Ga0395898_0035517 Ga0395898_0035517_2768_3541 257
423 3300037466 Ga0395898_0350806 Ga0395898_0350806_407_1180 257
424 3300038443 Ga0395901_0002359 Ga0395901_0002359_685_1458 257
425 3300038443 Ga0395901_0072757 Ga0395901_0072757_1606_2379 257
426 3300042005 Ga0439448_0001261 Ga0439448_0001261_2072_2845 257
427 3300042005 Ga0439448_0011765 Ga0439448_0011765_457_1230 257
428 3300042008 Ga0439450_014672 Ga0439450_014672_43_816 257
429 3300042012 Ga0439455_0051182 Ga0439455_0051182_218_991 257
430 3300042012 Ga0439455_0094369 Ga0439455_0094369_12_785 257
431 3300042016 Ga0439463_055355 Ga0439463_055355_160_933 257
432 3300042157 Ga0439458_0023619 Ga0439458_0023619_548_1321 257
433 3300042439 Ga0439464_0003655 Ga0439464_0003655_1230_2003 257
434 3300042461 Ga0439460_0013223 Ga0439460_0013223_499_1272 257
435 3300042876 Ga0451577_0033485 Ga0451577_0033485_3522_4295 257
436 3300042876 Ga0451577_0053264 Ga0451577_0053264_2388_3161 257
437 3300042876 Ga0451577_0084240 Ga0451577_0084240_1953_2726 257
438 3300042876 Ga0451577_0090550 Ga0451577_0090550_1241_2014 257
439 3300042876 Ga0451577_0136954 Ga0451577_0136954_1174_1947 257
440 3300042876 Ga0451577_0357353 Ga0451577_0357353_171_944 257
441 3300042876 Ga0451577_0463517 Ga0451577_0463517_70_843 257
442 3300044673 Ga0453683_0012871 Ga0453683_0012871_2975_3748 257
443 3300044673 Ga0453683_0033634 Ga0453683_0033634_2441_3214 257
444 3300044673 Ga0453683_0270505 Ga0453683_0270505_147_920 257
445 3300044673 Ga0453683_0348222 Ga0453683_0348222_94_867 257
446 3300044673 Ga0453683_0387675 Ga0453683_0387675_17_790 257
447 3300044712 Ga0453684_0059192 Ga0453684_0059192_38_811 257
448 3300044712 Ga0453684_0105532 Ga0453684_0105532_802_1575 257
449 3300044712 Ga0453684_0675488 Ga0453684_0675488_30_803 257
450 3300045051 Ga0451576_0003436 Ga0451576_0003436_14697_15470 257
451 3300045051 Ga0451576_0041817 Ga0451576_0041817_2699_3472 257
452 3300045051 Ga0451576_0075462 Ga0451576_0075462_2434_3207 257
453 3300045051 Ga0451576_0090083 Ga0451576_0090083_1271_2044 257
454 3300045051 Ga0451576_0100041 Ga0451576_0100041_1540_2313 257
455 3300045051 Ga0451576_0417426 Ga0451576_0417426_21_794 257
456 3300045051 Ga0451576_0474738 Ga0451576_0474738_337_1110 257
457 3300045051 Ga0451576_0733171 Ga0451576_0733171_24_797 257
458 3300046472 Ga0495580_0001279 Ga0495580_0001279_13345_14118 257
459 3300046472 Ga0495580_0059569 Ga0495580_0059569_1115_1888 257
460 3300046491 Ga0495584_0044378 Ga0495584_0044378_1250_2023 257
461 3300046684 Ga0495669_0029212 Ga0495669_0029212_308_1081 257
462 3300047318 Ga0495636_0152070 Ga0495636_0152070_170_943 257
463 3300048903 Ga0496100_0128796 Ga0496100_0128796_187_960 257
464 3300048905 Ga0496102_0023647 Ga0496102_0023647_849_1622 257
465 3300048905 Ga0496102_0034628 Ga0496102_0034628_711_1484 257
466 3300048909 Ga0496106_0050838 Ga0496106_0050838_1475_2248 257
467 3300048909 Ga0496106_0243680 Ga0496106_0243680_91_864 257
468 3300048912 Ga0496109_0307166 Ga0496109_0307166_305_1078 257
469 3300048913 Ga0496110_0315927 Ga0496110_0315927_541_1314 257
470 3300048915 Ga0496112_0038924 Ga0496112_0038924_3529_4302 257
471 3300048916 Ga0496113_0097028 Ga0496113_0097028_890_1663 257
472 3300049570 Ga0501033_0040153 Ga0501033_0040153_10_783 257
473 3300049570 Ga0501033_0423216 Ga0501033_0423216_12_785 257
474 3300049572 Ga0501036_0284355 Ga0501036_0284355_88_861 257
475 3300049572 Ga0501036_0403086 Ga0501036_0403086_315_1088 257
476 3300049573 Ga0501037_0123863 Ga0501037_0123863_746_1519 257
477 3300049574 Ga0501038_0120984 Ga0501038_0120984_39_812 257
478 3300049574 Ga0501038_0133303 Ga0501038_0133303_1100_1873 257
479 3300049575 Ga0501039_0130183 Ga0501039_0130183_570_1343 257
480 3300049575 Ga0501039_0178787 Ga0501039_0178787_144_917 257
481 3300049575 Ga0501039_0218665 Ga0501039_0218665_469_1242 257
482 3300049576 Ga0501040_0001692 Ga0501040_0001692_3150_3923 257
483 3300049576 Ga0501040_0005881 Ga0501040_0005881_5153_5926 257
484 3300049576 Ga0501040_0012970 Ga0501040_0012970_3789_4562 257
485 3300049576 Ga0501040_0200330 Ga0501040_0200330_72_845 257
486 3300049577 Ga0501041_0004951 Ga0501041_0004951_6596_7369 257
487 3300049577 Ga0501041_0043353 Ga0501041_0043353_1172_1945 257
488 3300049577 Ga0501041_0320854 Ga0501041_0320854_168_941 257
489 3300049578 Ga0501042_0001027 Ga0501042_0001027_7495_8268 257
490 3300049580 Ga0501046_0000084 Ga0501046_0000084_72438_73211 257
491 3300049580 Ga0501046_0142686 Ga0501046_0142686_253_1026 257
492 3300049582 Ga0501048_0006618 Ga0501048_0006618_5491_6264 257
493 3300049582 Ga0501048_0133124 Ga0501048_0133124_92_865 257
494 3300049582 Ga0501048_0158167 Ga0501048_0158167_187_960 257
495 3300049583 Ga0501067_0025668 Ga0501067_0025668_1265_2038 257
496 3300049583 Ga0501067_0292595 Ga0501067_0292595_83_856 257
497 3300049584 Ga0501068_0037970 Ga0501068_0037970_37_810 257
498 3300049584 Ga0501068_0131366 Ga0501068_0131366_595_1368 257
499 3300049584 Ga0501068_0167254 Ga0501068_0167254_288_1061 257
500 3300049585 Ga0501069_0007030 Ga0501069_0007030_969_1742 257
501 3300049585 Ga0501069_0197984 Ga0501069_0197984_257_1030 257
502 3300049587 Ga0501071_0030163 Ga0501071_0030163_1702_2475 257
503 3300049588 Ga0501072_0040433 Ga0501072_0040433_357_1130 257
504 3300049588 Ga0501072_0112021 Ga0501072_0112021_773_1546 257
505 3300049588 Ga0501072_0266859 Ga0501072_0266859_17_790 257
506 3300049588 Ga0501072_0371239 Ga0501072_0371239_36_809 257
507 3300049588 Ga0501072_0519080 Ga0501072_0519080_87_860 257
508 3300049589 Ga0501073_0233931 Ga0501073_0233931_229_1002 257
509 3300049589 Ga0501073_0386499 Ga0501073_0386499_24_797 257
510 3300049590 Ga0501074_0004066 Ga0501074_0004066_9620_10393 257
511 3300049590 Ga0501074_0191215 Ga0501074_0191215_283_1056 257
512 3300049590 Ga0501074_0297225 Ga0501074_0297225_93_866 257
513 3300049591 Ga0501075_0096900 Ga0501075_0096900_123_896 257
514 3300049591 Ga0501075_0126192 Ga0501075_0126192_240_1013 257
515 3300049591 Ga0501075_0187806 Ga0501075_0187806_621_1394 257
516 3300049591 Ga0501075_0217779 Ga0501075_0217779_448_1221 257
517 3300049591 Ga0501075_0392875 Ga0501075_0392875_144_917 257
518 3300049591 Ga0501075_0413290 Ga0501075_0413290_235_1008 257
519 3300049592 Ga0501076_0003680 Ga0501076_0003680_6912_7685 257
520 3300049592 Ga0501076_0054077 Ga0501076_0054077_1300_2073 257
521 3300049592 Ga0501076_0093822 Ga0501076_0093822_486_1259 257
522 3300049592 Ga0501076_0096684 Ga0501076_0096684_1179_1952 257
523 3300049592 Ga0501076_0109213 Ga0501076_0109213_758_1531 257
524 3300049592 Ga0501076_0162086 Ga0501076_0162086_395_1168 257
525 3300049592 Ga0501076_0186499 Ga0501076_0186499_143_916 257
526 3300049592 Ga0501076_0207813 Ga0501076_0207813_390_1163 257
527 3300049593 Ga0501077_0016948 Ga0501077_0016948_2164_2937 257
528 3300049593 Ga0501077_0118093 Ga0501077_0118093_840_1613 257
529 3300049593 Ga0501077_0201160 Ga0501077_0201160_274_1047 257
530 3300049593 Ga0501077_0215906 Ga0501077_0215906_372_1145 257
531 3300049593 Ga0501077_0305462 Ga0501077_0305462_30_803 257
532 3300049741 Ga0501079_0000126 Ga0501079_0000126_17248_18021 257
533 3300049741 Ga0501079_0028751 Ga0501079_0028751_1934_2707 257
534 3300049741 Ga0501079_0042598 Ga0501079_0042598_1098_1871 257
535 3300049741 Ga0501079_0107054 Ga0501079_0107054_1270_2043 257
536 3300049741 Ga0501079_0137499 Ga0501079_0137499_71_844 257
537 3300049741 Ga0501079_0158042 Ga0501079_0158042_793_1566 257
538 3300049741 Ga0501079_0426215 Ga0501079_0426215_175_948 257
539 3300049742 Ga0501080_0028768 Ga0501080_0028768_1358_2131 257
540 3300049742 Ga0501080_0140161 Ga0501080_0140161_1139_1912 257
541 3300049742 Ga0501080_0702384 Ga0501080_0702384_37_810 257
542 3300049743 Ga0501081_0002938 Ga0501081_0002938_5030_5803 257
543 3300049743 Ga0501081_0005134 Ga0501081_0005134_6663_7436 257
544 3300049743 Ga0501081_0013413 Ga0501081_0013413_517_1290 257
545 3300049743 Ga0501081_0015599 Ga0501081_0015599_2272_3045 257
546 3300049743 Ga0501081_0015840 Ga0501081_0015840_474_1247 257
547 3300049743 Ga0501081_0068424 Ga0501081_0068424_729_1502 257
548 3300049743 Ga0501081_0168895 Ga0501081_0168895_177_950 257
549 3300049743 Ga0501081_0281478 Ga0501081_0281478_258_1031 257
550 3300049744 Ga0501083_0301449 Ga0501083_0301449_180_953 257
551 3300049822 Ga0501035_0290920 Ga0501035_0290920_549_1322 257
552 3300049824 Ga0501045_0000701 Ga0501045_0000701_8842_9615 257
553 3300049824 Ga0501045_0068944 Ga0501045_0068944_809_1582 257
554 3300049824 Ga0501045_0074466 Ga0501045_0074466_577_1350 257
555 3300049824 Ga0501045_0095868 Ga0501045_0095868_496_1269 257
556 3300049824 Ga0501045_0124822 Ga0501045_0124822_56_829 257
557 3300049824 Ga0501045_0357955 Ga0501045_0357955_68_841 257
558 3300049824 Ga0501045_0358918 Ga0501045_0358918_293_1066 257
559 3300049824 Ga0501045_0372091 Ga0501045_0372091_49_822 257
560 3300050507 nmdc:mga05p37_100710_c1 nmdc:mga05p37_100710_c1_2694_3467 257
561 3300050507 nmdc:mga05p37_12948_c1 nmdc:mga05p37_12948_c1_1135_1908 257
562 3300050507 nmdc:mga05p37_134317_c1 nmdc:mga05p37_134317_c1_2210_2983 257
563 3300050507 nmdc:mga05p37_1427_c1 nmdc:mga05p37_1427_c1_20213_20986 257
564 3300050507 nmdc:mga05p37_152101_c1 nmdc:mga05p37_152101_c1_532_1305 257
565 3300050507 nmdc:mga05p37_15303_c1 nmdc:mga05p37_15303_c1_3483_4256 257
566 3300050507 nmdc:mga05p37_168271_c1 nmdc:mga05p37_168271_c1_1370_2143 257
567 3300050507 nmdc:mga05p37_2575_c1 nmdc:mga05p37_2575_c1_11920_12693 257
568 3300050507 nmdc:mga05p37_45733_c1 nmdc:mga05p37_45733_c1_4039_4812 257
569 3300050507 nmdc:mga05p37_45908_c1 nmdc:mga05p37_45908_c1_2435_3208 257
570 3300050507 nmdc:mga05p37_546896_c1 nmdc:mga05p37_546896_c1_42_815 257
571 3300050507 nmdc:mga05p37_5969_c1 nmdc:mga05p37_5969_c1_4078_4851 257
572 3300050507 nmdc:mga05p37_61012_c1 nmdc:mga05p37_61012_c1_1183_1956 257
573 3300050507 nmdc:mga05p37_6660_c1 nmdc:mga05p37_6660_c1_10850_11623 257
574 3300050507 nmdc:mga05p37_67273_c1 nmdc:mga05p37_67273_c1_1973_2746 257
575 3300050507 nmdc:mga05p37_6_c1 nmdc:mga05p37_6_c1_132445_133218 257
576 3300050507 nmdc:mga05p37_768505_c1 nmdc:mga05p37_768505_c1_191_964 257
577 3300050508 nmdc:mga09592_159_c1 nmdc:mga09592_159_c1_32500_33273 257
578 3300050508 nmdc:mga09592_1747_c1 nmdc:mga09592_1747_c1_11176_11949 257
579 3300050508 nmdc:mga09592_25844_c1 nmdc:mga09592_25844_c1_2137_2910 257
580 3300050508 nmdc:mga09592_289732_c1 nmdc:mga09592_289732_c1_519_1292 257
581 3300050508 nmdc:mga09592_3854_c1 nmdc:mga09592_3854_c1_8394_9167 257
582 3300050508 nmdc:mga09592_46347_c1 nmdc:mga09592_46347_c1_798_1571 257
583 3300050508 nmdc:mga09592_8228_c1 nmdc:mga09592_8228_c1_6941_7714 257
584 3300050509 nmdc:mga0qj67_109653_c1 nmdc:mga0qj67_109653_c1_869_1642 257
585 3300050509 nmdc:mga0qj67_154902_c1 nmdc:mga0qj67_154902_c1_775_1548 257
586 3300050509 nmdc:mga0qj67_28180_c1 nmdc:mga0qj67_28180_c1_1475_2248 257
587 3300050509 nmdc:mga0qj67_474_c1 nmdc:mga0qj67_474_c1_25857_26630 257
588 3300050510 nmdc:mga06r32_130290_c1 nmdc:mga06r32_130290_c1_1189_1962 257
589 3300050510 nmdc:mga06r32_2028_c1 nmdc:mga06r32_2028_c1_10170_10943 257
590 3300050510 nmdc:mga06r32_232747_c1 nmdc:mga06r32_232747_c1_864_1637 257
591 3300050510 nmdc:mga06r32_25044_c1 nmdc:mga06r32_25044_c1_3626_4399 257
592 3300050510 nmdc:mga06r32_3585_c1 nmdc:mga06r32_3585_c1_3255_4028 257
593 3300050510 nmdc:mga06r32_361_c1 nmdc:mga06r32_361_c1_574_1347 257
594 3300050510 nmdc:mga06r32_36558_c1 nmdc:mga06r32_36558_c1_694_1467 257
595 3300050510 nmdc:mga06r32_405047_c1 nmdc:mga06r32_405047_c1_529_1302 257
596 3300050510 nmdc:mga06r32_40567_c1 nmdc:mga06r32_40567_c1_997_1770 257
597 3300050510 nmdc:mga06r32_64638_c1 nmdc:mga06r32_64638_c1_966_1739 257
598 3300050510 nmdc:mga06r32_70576_c1 nmdc:mga06r32_70576_c1_402_1175 257
599 3300050510 nmdc:mga06r32_763548_c1 nmdc:mga06r32_763548_c1_19_792 257
600 3300050510 nmdc:mga06r32_9821_c1 nmdc:mga06r32_9821_c1_1464_2237 257
601 3300050511 nmdc:mga08y16_233459_c1 nmdc:mga08y16_233459_c1_483_1256 257
602 3300050511 nmdc:mga08y16_4495_c1 nmdc:mga08y16_4495_c1_11916_12689 257
603 3300050511 nmdc:mga08y16_46350_c1 nmdc:mga08y16_46350_c1_1442_2215 257
604 3300050512 nmdc:mga0n895_13531_c1 nmdc:mga0n895_13531_c1_2613_3386 257
605 3300050512 nmdc:mga0n895_141599_c1 nmdc:mga0n895_141599_c1_369_1142 257
606 3300050512 nmdc:mga0n895_16149_c1 nmdc:mga0n895_16149_c1_988_1761 257
607 3300050512 nmdc:mga0n895_20052_c1 nmdc:mga0n895_20052_c1_5127_5900 257
608 3300050512 nmdc:mga0n895_226260_c1 nmdc:mga0n895_226260_c1_233_1006 257
609 3300050512 nmdc:mga0n895_287693_c1 nmdc:mga0n895_287693_c1_807_1580 257
610 3300050512 nmdc:mga0n895_66753_c1 nmdc:mga0n895_66753_c1_2667_3440 257
611 3300050512 nmdc:mga0n895_713_c1 nmdc:mga0n895_713_c1_10244_11017 257
612 3300050512 nmdc:mga0n895_81594_c1 nmdc:mga0n895_81594_c1_520_1293 257
613 3300050512 nmdc:mga0n895_85666_c1 nmdc:mga0n895_85666_c1_686_1459 257
614 3300050512 nmdc:mga0n895_8963_c1 nmdc:mga0n895_8963_c1_5023_5796 257
615 3300050513 nmdc:mga0rr50_1514_c1 nmdc:mga0rr50_1514_c1_1193_1966 257
616 3300050513 nmdc:mga0rr50_184105_c1 nmdc:mga0rr50_184105_c1_539_1312 257
617 3300050513 nmdc:mga0rr50_228853_c1 nmdc:mga0rr50_228853_c1_564_1337 257
618 3300050513 nmdc:mga0rr50_270921_c1 nmdc:mga0rr50_270921_c1_260_1033 257
619 3300050513 nmdc:mga0rr50_292766_c1 nmdc:mga0rr50_292766_c1_50_823 257
620 3300050513 nmdc:mga0rr50_4899_c2 nmdc:mga0rr50_4899_c2_3530_4303 257
621 3300050513 nmdc:mga0rr50_49292_c1 nmdc:mga0rr50_49292_c1_539_1312 257
622 3300050513 nmdc:mga0rr50_9978_c1 nmdc:mga0rr50_9978_c1_3266_4039 257
623 3300050514 nmdc:mga08x19_112247_c1 nmdc:mga08x19_112247_c1_300_1073 257
624 3300050514 nmdc:mga08x19_27650_c1 nmdc:mga08x19_27650_c1_2415_3188 257
625 3300050514 nmdc:mga08x19_43214_c1 nmdc:mga08x19_43214_c1_40_813 257
626 3300050514 nmdc:mga08x19_6921_c1 nmdc:mga08x19_6921_c1_5067_5840 257
627 3300050514 nmdc:mga08x19_963_c1 nmdc:mga08x19_963_c1_7136_7909 257
628 3300050515 nmdc:mga0a205_14189_c1 nmdc:mga0a205_14189_c1_1709_2482 257
629 3300050515 nmdc:mga0a205_19278_c1 nmdc:mga0a205_19278_c1_3736_4509 257
630 3300050515 nmdc:mga0a205_2149_c1 nmdc:mga0a205_2149_c1_592_1365 257
631 3300050515 nmdc:mga0a205_252626_c1 nmdc:mga0a205_252626_c1_84_857 257
632 3300050515 nmdc:mga0a205_318363_c1 nmdc:mga0a205_318363_c1_358_1131 257
633 3300050515 nmdc:mga0a205_50847_c1 nmdc:mga0a205_50847_c1_582_1355 257
634 3300050515 nmdc:mga0a205_57545_c1 nmdc:mga0a205_57545_c1_849_1622 257
635 3300050515 nmdc:mga0a205_58846_c1 nmdc:mga0a205_58846_c1_547_1320 257
636 3300050515 nmdc:mga0a205_59855_c1 nmdc:mga0a205_59855_c1_337_1110 257
637 3300050515 nmdc:mga0a205_85539_c1 nmdc:mga0a205_85539_c1_1459_2232 257
638 3300054114 Ga0501084_0000139 Ga0501084_0000139_40666_41439 257
639 3300054114 Ga0501084_0042821 Ga0501084_0042821_1079_1852 257
640 3300054114 Ga0501084_0062480 Ga0501084_0062480_876_1649 257
641 3300054114 Ga0501084_0095416 Ga0501084_0095416_567_1340 257
642 3300054114 Ga0501084_0110303 Ga0501084_0110303_243_1016 257
643 3300054114 Ga0501084_0135457 Ga0501084_0135457_593_1366 257
644 3300060353 Ga0501082_0000528 Ga0501082_0000528_28747_29520 257
645 3300060353 Ga0501082_0058879 Ga0501082_0058879_542_1315 257
646 3300060353 Ga0501082_0086041 Ga0501082_0086041_1922_2695 257
647 3300061734 Ga0530510_0065148 Ga0530510_0065148_373_1146 257
648 3300061734 Ga0530510_0128740 Ga0530510_0128740_295_1068 257
649 3300061734 Ga0530510_0159604 Ga0530510_0159604_661_1434 257
650 3300061734 Ga0530510_0214423 Ga0530510_0214423_515_1288 257
651 3300061734 Ga0530510_0217974 Ga0530510_0217974_462_1235 257
652 3300061734 Ga0530510_0227999 Ga0530510_0227999_120_893 257
653 3300061734 Ga0530510_0356966 Ga0530510_0356966_42_815 257
654 3300061734 Ga0530510_0358496 Ga0530510_0358496_234_1007 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

73

319

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

76

250

0.92

PF19649

DUF6152

Family of unknown function (DUF6152)

15

108

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.9597 1 248
6lvp-assembly1.cif.gz_C enoyl-coa hydratase (hyech) from hymenobacter sp. pamc 26628 0.9578 2 256
2ppy-assembly1.cif.gz_A crystal structure of enoyl-coa hydrates (gk_1992) from geobacillus kaustophilus hta426 0.9572 1 256
5zai-assembly1.cif.gz_D crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula 0.9566 1 255
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9549 4 256
ID Description Score Start End Superfamily
1hzdF02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9787 198 256 1.10.12.10
1hzdE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9785 198 256 1.10.12.10
2zqqC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9785 198 256 1.10.12.10
2zqrE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9778 198 256 1.10.12.10
2zqqA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9765 198 256 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2G9XP34-F1-model_v4 Crotonase 0.9756 32 256 GO:0006635
GO:0016836
AF-A0A2V8NUW7-F1-model_v4 Enoyl-CoA hydratase 0.973 2 256 GO:0006635
GO:0016829
AF-A0A0L8MY38-F1-model_v4 deleted 0.9726 95 194
AF-A0A7W1LYZ4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9716 103 256 GO:0006635
GO:0016829
GO:0016853
AF-A0A419EUR1-F1-model_v4 Enoyl-CoA hydratase 0.9713 1 256 GO:0006635
GO:0016836

Feature Viewer

pLDDT pTM Quality
91.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map