F472857
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 654 | 232 | 654 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300027682|Ga0209971_1017624|Ga0209971_10176242 |
| Length | 319 |
| Sequence | MKVVSVLTAVAMICSLFLFAPPILAHHSFAAEFDANKCRDFTGTLTKLDWQSPHAYFYLDIKNEAGKVENWSFQTYALITLNRPPANAISEQLITEVNAALNAVQSDDSVRAVIVTGAGDKIFCGGADLASAFSGGDVEQFIRFGNSVMRKLERFPKPVIAAINGHAMGGGMEIAMACHLRLMKESARMGQTESNLGIIPGYGGTQRLPRLVGRTKALEYLLLGTQIPAAECLALGLVNRLSKEGETLNDAKALARQLGGRAPLAMAAIIRAVDEGLEAPMAKSIDIELEQFLPTLRSEDASEGIQAFFAKREPHFKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 160 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 164 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 175 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 176 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 177 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 178 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 179 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.38 |
| Rhizosphere | 98.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10012903 | 3300005295 | Bacteria | 2119 |
| 2 | Ga0070676_10005622 | 3300005328 | Bacteria | 6679 |
| 3 | Ga0070683_100083081 | 3300005329 | Bacteria | 3000 |
| 4 | Ga0070690_100119744 | 3300005330 | Unclassified | 1766 |
| 5 | Ga0070670_100115006 | 3300005331 | Bacteria | 2319 |
| 6 | Ga0068869_100000012 | 3300005334 | Bacteria | 75525 |
| 7 | Ga0070680_100004085 | 3300005336 | Bacteria | 10931 |
| 8 | Ga0070680_100015564 | 3300005336 | Bacteria | 5967 |
| 9 | Ga0070680_100057128 | 3300005336 | Bacteria | 3190 |
| 10 | Ga0070682_100000192 | 3300005337 | Bacteria | 45700 |
| 11 | Ga0070660_100000614 | 3300005339 | Bacteria | 23816 |
| 12 | Ga0070689_100045755 | 3300005340 | Bacteria | 3371 |
| 13 | Ga0070691_10000893 | 3300005341 | Bacteria | 12089 |
| 14 | Ga0070691_10019301 | 3300005341 | Bacteria | 3144 |
| 15 | Ga0070691_10028394 | 3300005341 | Unclassified | 2614 |
| 16 | Ga0070687_100023875 | 3300005343 | Bacteria | 2911 |
| 17 | Ga0070661_100000917 | 3300005344 | Bacteria | 21153 |
| 18 | Ga0070692_10009036 | 3300005345 | Bacteria | 4474 |
| 19 | Ga0070692_10105082 | 3300005345 | Unclassified | 1554 |
| 20 | Ga0070668_100142255 | 3300005347 | Bacteria | 1934 |
| 21 | Ga0070669_100118814 | 3300005353 | Bacteria | 2014 |
| 22 | Ga0070675_100443568 | 3300005354 | Bacteria | 1163 |
| 23 | Ga0070673_100171677 | 3300005364 | Bacteria | 1851 |
| 24 | Ga0070659_100000328 | 3300005366 | Bacteria | 36586 |
| 25 | Ga0070703_10001692 | 3300005406 | Bacteria | 6550 |
| 26 | Ga0070703_10003696 | 3300005406 | Unclassified | 4335 |
| 27 | Ga0070703_10118539 | 3300005406 | Bacteria | 957 |
| 28 | Ga0070701_10045580 | 3300005438 | Bacteria | 2250 |
| 29 | Ga0070701_10068686 | 3300005438 | Bacteria | 1889 |
| 30 | Ga0070701_10089428 | 3300005438 | Bacteria | 1684 |
| 31 | Ga0070705_100000714 | 3300005440 | Bacteria | 18917 |
| 32 | Ga0070705_100021749 | 3300005440 | Unclassified | 3416 |
| 33 | Ga0070705_100071245 | 3300005440 | Bacteria | 2102 |
| 34 | Ga0070694_100000221 | 3300005444 | Bacteria | 29858 |
| 35 | Ga0070694_100000708 | 3300005444 | Bacteria | 18590 |
| 36 | Ga0070694_100043253 | 3300005444 | Bacteria | 3011 |
| 37 | Ga0070694_100093269 | 3300005444 | Bacteria | 2116 |
| 38 | Ga0070694_100161904 | 3300005444 | Unclassified | 1642 |
| 39 | Ga0070694_100176718 | 3300005444 | Unclassified | 1576 |
| 40 | Ga0070708_100022076 | 3300005445 | Bacteria | 5395 |
| 41 | Ga0070708_100029245 | 3300005445 | Bacteria | 4750 |
| 42 | Ga0070708_100057003 | 3300005445 | Bacteria | 3476 |
| 43 | Ga0070708_100171376 | 3300005445 | Bacteria | 2026 |
| 44 | Ga0070708_100232125 | 3300005445 | Bacteria | 1731 |
| 45 | Ga0070708_100240439 | 3300005445 | Bacteria | 1700 |
| 46 | Ga0070708_100264015 | 3300005445 | Bacteria | 1619 |
| 47 | Ga0070662_100227690 | 3300005457 | Bacteria | 1490 |
| 48 | Ga0070681_10003830 | 3300005458 | Bacteria | 14144 |
| 49 | Ga0068867_100002111 | 3300005459 | Bacteria | 13937 |
| 50 | Ga0068867_100621964 | 3300005459 | Bacteria | 944 |
| 51 | Ga0070706_100002217 | 3300005467 | Bacteria | 19744 |
| 52 | Ga0070706_100029148 | 3300005467 | Bacteria | 5086 |
| 53 | Ga0070706_100202998 | 3300005467 | Bacteria | 1852 |
| 54 | Ga0070706_100280036 | 3300005467 | Bacteria | 1556 |
| 55 | Ga0070706_100336058 | 3300005467 | Bacteria | 1408 |
| 56 | Ga0070707_100022952 | 3300005468 | Bacteria | 5900 |
| 57 | Ga0070707_100049522 | 3300005468 | Bacteria | 4027 |
| 58 | Ga0070707_100066131 | 3300005468 | Bacteria | 3474 |
| 59 | Ga0070707_100067507 | 3300005468 | Bacteria | 3440 |
| 60 | Ga0070707_100078244 | 3300005468 | Bacteria | 3190 |
| 61 | Ga0070707_100193981 | 3300005468 | Bacteria | 1980 |
| 62 | Ga0070707_100408190 | 3300005468 | Bacteria | 1319 |
| 63 | Ga0070707_100677776 | 3300005468 | Bacteria | 994 |
| 64 | Ga0070698_100017214 | 3300005471 | Bacteria | 7616 |
| 65 | Ga0070698_100039179 | 3300005471 | Bacteria | 4879 |
| 66 | Ga0070698_100049290 | 3300005471 | Bacteria | 4299 |
| 67 | Ga0070698_100091467 | 3300005471 | Bacteria | 3025 |
| 68 | Ga0070698_100205367 | 3300005471 | Bacteria | 1905 |
| 69 | Ga0070698_100245473 | 3300005471 | Bacteria | 1723 |
| 70 | Ga0070698_100262409 | 3300005471 | Bacteria | 1660 |
| 71 | Ga0070698_100333828 | 3300005471 | Bacteria | 1447 |
| 72 | Ga0070699_100001395 | 3300005518 | Bacteria | 22214 |
| 73 | Ga0070699_100023904 | 3300005518 | Bacteria | 5267 |
| 74 | Ga0070699_100045128 | 3300005518 | Bacteria | 3814 |
| 75 | Ga0070699_100065744 | 3300005518 | Bacteria | 3147 |
| 76 | Ga0070699_100103209 | 3300005518 | Bacteria | 2500 |
| 77 | Ga0070699_100184565 | 3300005518 | Bacteria | 1852 |
| 78 | Ga0070699_100203064 | 3300005518 | Bacteria | 1763 |
| 79 | Ga0070699_100388053 | 3300005518 | Bacteria | 1261 |
| 80 | Ga0070679_100005622 | 3300005530 | Bacteria | 11612 |
| 81 | Ga0070679_100255469 | 3300005530 | Bacteria | 1708 |
| 82 | Ga0070684_100023397 | 3300005535 | Bacteria | 5167 |
| 83 | Ga0070697_100001688 | 3300005536 | Bacteria | 16867 |
| 84 | Ga0070697_100003552 | 3300005536 | Bacteria | 11977 |
| 85 | Ga0070697_100004819 | 3300005536 | Bacteria | 10342 |
| 86 | Ga0070697_100018024 | 3300005536 | Bacteria | 5564 |
| 87 | Ga0070697_100069620 | 3300005536 | Bacteria | 2882 |
| 88 | Ga0070697_100096985 | 3300005536 | Bacteria | 2446 |
| 89 | Ga0070697_100411272 | 3300005536 | Bacteria | 1175 |
| 90 | Ga0068853_100000637 | 3300005539 | Bacteria | 24013 |
| 91 | Ga0070672_100148379 | 3300005543 | Bacteria | 1939 |
| 92 | Ga0070686_100043725 | 3300005544 | Unclassified | 2812 |
| 93 | Ga0070695_100002800 | 3300005545 | Bacteria | 10127 |
| 94 | Ga0070695_100003216 | 3300005545 | Bacteria | 9533 |
| 95 | Ga0070695_100006214 | 3300005545 | Bacteria | 7055 |
| 96 | Ga0070695_100011346 | 3300005545 | Bacteria | 5331 |
| 97 | Ga0070695_100101955 | 3300005545 | Bacteria | 1934 |
| 98 | Ga0070695_100186614 | 3300005545 | Bacteria | 1473 |
| 99 | Ga0070695_100254997 | 3300005545 | Unclassified | 1279 |
| 100 | Ga0070695_100369913 | 3300005545 | Bacteria | 1079 |
| 101 | Ga0070696_100004086 | 3300005546 | Bacteria | 9732 |
| 102 | Ga0070696_100007298 | 3300005546 | Bacteria | 7379 |
| 103 | Ga0070696_100182700 | 3300005546 | Bacteria | 1557 |
| 104 | Ga0070696_100183129 | 3300005546 | Bacteria | 1555 |
| 105 | Ga0070696_100288061 | 3300005546 | Bacteria | 1254 |
| 106 | Ga0070696_100594406 | 3300005546 | Unclassified | 891 |
| 107 | Ga0070693_100000097 | 3300005547 | Bacteria | 38401 |
| 108 | Ga0070704_100001786 | 3300005549 | Bacteria | 11806 |
| 109 | Ga0070704_100049550 | 3300005549 | Unclassified | 2947 |
| 110 | Ga0070704_100070456 | 3300005549 | Bacteria | 2537 |
| 111 | Ga0070704_100188220 | 3300005549 | Bacteria | 1657 |
| 112 | Ga0070704_100354285 | 3300005549 | Bacteria | 1240 |
| 113 | Ga0068855_100000362 | 3300005563 | Bacteria | 56297 |
| 114 | Ga0068857_100004826 | 3300005577 | Bacteria | 11423 |
| 115 | Ga0068857_100128089 | 3300005577 | Bacteria | 2288 |
| 116 | Ga0068857_100144389 | 3300005577 | Bacteria | 2153 |
| 117 | Ga0068857_100223363 | 3300005577 | Bacteria | 1721 |
| 118 | Ga0068854_100000762 | 3300005578 | Bacteria | 19112 |
| 119 | Ga0068854_100170710 | 3300005578 | Unclassified | 1692 |
| 120 | Ga0068854_100220617 | 3300005578 | Bacteria | 1500 |
| 121 | Ga0070702_100001731 | 3300005615 | Bacteria | 9068 |
| 122 | Ga0070702_100184973 | 3300005615 | Unclassified | 1366 |
| 123 | Ga0068852_100277289 | 3300005616 | Bacteria | 1615 |
| 124 | Ga0068859_100000348 | 3300005617 | Bacteria | 46023 |
| 125 | Ga0068859_100052363 | 3300005617 | Bacteria | 4104 |
| 126 | Ga0068859_100504862 | 3300005617 | Bacteria | 1304 |
| 127 | Ga0068866_10032193 | 3300005718 | Bacteria | 2533 |
| 128 | Ga0068861_100010479 | 3300005719 | Bacteria | 6434 |
| 129 | Ga0068870_10000443 | 3300005840 | Bacteria | 15700 |
| 130 | Ga0068870_10005194 | 3300005840 | Bacteria | 5671 |
| 131 | Ga0068863_100010811 | 3300005841 | Bacteria | 8850 |
| 132 | Ga0068863_100178034 | 3300005841 | Bacteria | 2041 |
| 133 | Ga0068858_100021860 | 3300005842 | Bacteria | 5975 |
| 134 | Ga0068860_100004134 | 3300005843 | Bacteria | 14876 |
| 135 | Ga0068860_100008783 | 3300005843 | Bacteria | 10068 |
| 136 | Ga0068860_100167050 | 3300005843 | Unclassified | 2124 |
| 137 | Ga0068860_100595111 | 3300005843 | Unclassified | 1111 |
| 138 | Ga0068862_100003329 | 3300005844 | Bacteria | 13874 |
| 139 | Ga0068862_100130474 | 3300005844 | Bacteria | 2222 |
| 140 | Ga0068862_100212158 | 3300005844 | Bacteria | 1750 |
| 141 | Ga0068862_100320213 | 3300005844 | Bacteria | 1431 |
| 142 | Ga0068862_100603583 | 3300005844 | Bacteria | 1054 |
| 143 | Ga0068862_100743257 | 3300005844 | Bacteria | 954 |
| 144 | Ga0081455_10000499 | 3300005937 | Bacteria | 51066 |
| 145 | Ga0081455_10320932 | 3300005937 | Bacteria | 1103 |
| 146 | Ga0081538_10085682 | 3300005981 | Bacteria | 1654 |
| 147 | Ga0081538_10176870 | 3300005981 | Bacteria | 920 |
| 148 | Ga0081539_10000002 | 3300005985 | Bacteria | 601032 |
| 149 | Ga0070712_100003614 | 3300006175 | Bacteria | 9537 |
| 150 | Ga0068871_100342696 | 3300006358 | Bacteria | 1320 |
| 151 | Ga0075428_100000032 | 3300006844 | Bacteria | 118320 |
| 152 | Ga0075428_100000837 | 3300006844 | Bacteria | 32226 |
| 153 | Ga0075428_100004443 | 3300006844 | Bacteria | 15481 |
| 154 | Ga0075428_100050842 | 3300006844 | Bacteria | 4544 |
| 155 | Ga0075428_100126209 | 3300006844 | Bacteria | 2785 |
| 156 | Ga0075430_100000002 | 3300006846 | Bacteria | 150510 |
| 157 | Ga0075430_100000030 | 3300006846 | Bacteria | 73219 |
| 158 | Ga0075430_100014005 | 3300006846 | Bacteria | 6836 |
| 159 | Ga0075430_100070655 | 3300006846 | Bacteria | 2928 |
| 160 | Ga0075430_100135124 | 3300006846 | Bacteria | 2055 |
| 161 | Ga0075431_100000009 | 3300006847 | Bacteria | 101621 |
| 162 | Ga0075431_100000013 | 3300006847 | Bacteria | 90623 |
| 163 | Ga0075431_100001893 | 3300006847 | Bacteria | 19845 |
| 164 | Ga0075431_100002318 | 3300006847 | Bacteria | 18283 |
| 165 | Ga0075431_100003218 | 3300006847 | Bacteria | 15801 |
| 166 | Ga0075431_100004225 | 3300006847 | Bacteria | 14071 |
| 167 | Ga0075431_100005455 | 3300006847 | Bacteria | 12567 |
| 168 | Ga0075431_100018582 | 3300006847 | Bacteria | 7082 |
| 169 | Ga0075431_100022755 | 3300006847 | Bacteria | 6406 |
| 170 | Ga0075431_100027671 | 3300006847 | Bacteria | 5818 |
| 171 | Ga0075431_100175333 | 3300006847 | Bacteria | 2202 |
| 172 | Ga0075431_100182461 | 3300006847 | Bacteria | 2153 |
| 173 | Ga0075431_100330305 | 3300006847 | Bacteria | 1536 |
| 174 | Ga0075433_10000017 | 3300006852 | Bacteria | 66778 |
| 175 | Ga0075433_10000121 | 3300006852 | Bacteria | 39439 |
| 176 | Ga0075433_10010195 | 3300006852 | Bacteria | 7537 |
| 177 | Ga0075433_10013834 | 3300006852 | Bacteria | 6578 |
| 178 | Ga0075433_10024303 | 3300006852 | Bacteria | 5112 |
| 179 | Ga0075433_10080101 | 3300006852 | Bacteria | 2878 |
| 180 | Ga0075433_10082823 | 3300006852 | Bacteria | 2830 |
| 181 | Ga0075433_10083173 | 3300006852 | Bacteria | 2824 |
| 182 | Ga0075433_10102909 | 3300006852 | Bacteria | 2529 |
| 183 | Ga0075433_10120121 | 3300006852 | Bacteria | 2333 |
| 184 | Ga0075433_10216856 | 3300006852 | Bacteria | 1700 |
| 185 | Ga0075433_10261963 | 3300006852 | Bacteria | 1532 |
| 186 | Ga0075434_100001334 | 3300006871 | Bacteria | 20666 |
| 187 | Ga0075434_100013675 | 3300006871 | Bacteria | 7736 |
| 188 | Ga0075434_100021778 | 3300006871 | Bacteria | 6234 |
| 189 | Ga0075434_100036779 | 3300006871 | Bacteria | 4842 |
| 190 | Ga0075434_100049904 | 3300006871 | Bacteria | 4156 |
| 191 | Ga0075434_100065440 | 3300006871 | Bacteria | 3620 |
| 192 | Ga0075434_100081534 | 3300006871 | Bacteria | 3232 |
| 193 | Ga0075434_100096516 | 3300006871 | Bacteria | 2961 |
| 194 | Ga0075434_100142711 | 3300006871 | Bacteria | 2415 |
| 195 | Ga0075434_100283348 | 3300006871 | Bacteria | 1676 |
| 196 | Ga0075434_100823434 | 3300006871 | Bacteria | 944 |
| 197 | Ga0075429_100000006 | 3300006880 | Bacteria | 98571 |
| 198 | Ga0075429_100001526 | 3300006880 | Bacteria | 19045 |
| 199 | Ga0075429_100007453 | 3300006880 | Bacteria | 9494 |
| 200 | Ga0075429_100007721 | 3300006880 | Bacteria | 9338 |
| 201 | Ga0075429_100009193 | 3300006880 | Bacteria | 8580 |
| 202 | Ga0075429_100010942 | 3300006880 | Bacteria | 7850 |
| 203 | Ga0075429_100196690 | 3300006880 | Bacteria | 1766 |
| 204 | Ga0075429_100327380 | 3300006880 | Bacteria | 1341 |
| 205 | Ga0068865_100282995 | 3300006881 | Bacteria | 1321 |
| 206 | Ga0075436_100005968 | 3300006914 | Bacteria | 8367 |
| 207 | Ga0075436_100052367 | 3300006914 | Bacteria | 2817 |
| 208 | Ga0075436_100157523 | 3300006914 | Bacteria | 1600 |
| 209 | Ga0075436_100170575 | 3300006914 | Bacteria | 1536 |
| 210 | Ga0075436_100292802 | 3300006914 | Bacteria | 1165 |
| 211 | Ga0097620_100000348 | 3300006931 | Bacteria | 46023 |
| 212 | Ga0097620_100052361 | 3300006931 | Bacteria | 4104 |
| 213 | Ga0097620_100504860 | 3300006931 | Bacteria | 1304 |
| 214 | Ga0075435_100002475 | 3300007076 | Bacteria | 12279 |
| 215 | Ga0075435_100004315 | 3300007076 | Bacteria | 9776 |
| 216 | Ga0075435_100021302 | 3300007076 | Bacteria | 4983 |
| 217 | Ga0075435_100032600 | 3300007076 | Bacteria | 4115 |
| 218 | Ga0075435_100611377 | 3300007076 | Bacteria | 945 |
| 219 | Ga0099794_10003767 | 3300007265 | Bacteria | 5845 |
| 220 | Ga0099794_10005009 | 3300007265 | Bacteria | 5275 |
| 221 | Ga0099794_10034390 | 3300007265 | Bacteria | 2387 |
| 222 | Ga0111539_10006297 | 3300009094 | Bacteria | 15321 |
| 223 | Ga0111539_10016096 | 3300009094 | Bacteria | 9281 |
| 224 | Ga0111539_10028818 | 3300009094 | Bacteria | 6771 |
| 225 | Ga0111539_10321074 | 3300009094 | Bacteria | 1802 |
| 226 | Ga0105245_10784931 | 3300009098 | Unclassified | 990 |
| 227 | Ga0105247_10163505 | 3300009101 | Unclassified | 1475 |
| 228 | Ga0114129_10000053 | 3300009147 | Bacteria | 100477 |
| 229 | Ga0114129_10000182 | 3300009147 | Bacteria | 70001 |
| 230 | Ga0114129_10000454 | 3300009147 | Bacteria | 48898 |
| 231 | Ga0114129_10004798 | 3300009147 | Bacteria | 19109 |
| 232 | Ga0114129_10005559 | 3300009147 | Bacteria | 17830 |
| 233 | Ga0114129_10011655 | 3300009147 | Bacteria | 12515 |
| 234 | Ga0114129_10036137 | 3300009147 | Bacteria | 6976 |
| 235 | Ga0114129_10055460 | 3300009147 | Bacteria | 5553 |
| 236 | Ga0114129_10056921 | 3300009147 | Bacteria | 5474 |
| 237 | Ga0114129_10073458 | 3300009147 | Bacteria | 4765 |
| 238 | Ga0114129_10084238 | 3300009147 | Bacteria | 4415 |
| 239 | Ga0114129_10097091 | 3300009147 | Bacteria | 4079 |
| 240 | Ga0114129_10156876 | 3300009147 | Bacteria | 3111 |
| 241 | Ga0114129_10301204 | 3300009147 | Bacteria | 2137 |
| 242 | Ga0114129_10380014 | 3300009147 | Bacteria | 1866 |
| 243 | Ga0114129_10428723 | 3300009147 | Bacteria | 1738 |
| 244 | Ga0114129_10887056 | 3300009147 | Bacteria | 1131 |
| 245 | Ga0114129_10947783 | 3300009147 | Bacteria | 1087 |
| 246 | Ga0105243_10055485 | 3300009148 | Bacteria | 3148 |
| 247 | Ga0105243_10094370 | 3300009148 | Bacteria | 2470 |
| 248 | Ga0105243_10157637 | 3300009148 | Bacteria | 1954 |
| 249 | Ga0105241_10031744 | 3300009174 | Bacteria | 3955 |
| 250 | Ga0105241_10081797 | 3300009174 | Bacteria | 2530 |
| 251 | Ga0105242_10092043 | 3300009176 | Unclassified | 2554 |
| 252 | Ga0105242_10214481 | 3300009176 | Bacteria | 1717 |
| 253 | Ga0105248_10067618 | 3300009177 | Bacteria | 4012 |
| 254 | Ga0105248_10317192 | 3300009177 | Bacteria | 1756 |
| 255 | Ga0105249_10044073 | 3300009553 | Bacteria | 4058 |
| 256 | Ga0105249_10064946 | 3300009553 | Bacteria | 3356 |
| 257 | Ga0105246_10737164 | 3300011119 | Bacteria | 868 |
| 258 | Ga0157373_10000316 | 3300013100 | Bacteria | 38900 |
| 259 | Ga0157371_10075398 | 3300013102 | Bacteria | 2389 |
| 260 | Ga0157369_10008219 | 3300013105 | Bacteria | 11965 |
| 261 | Ga0157378_10168322 | 3300013297 | Bacteria | 2054 |
| 262 | Ga0163162_10006161 | 3300013306 | Bacteria | 11615 |
| 263 | Ga0163162_10614278 | 3300013306 | Unclassified | 1213 |
| 264 | Ga0157372_10000280 | 3300013307 | Bacteria | 56597 |
| 265 | Ga0157372_10094378 | 3300013307 | Bacteria | 3407 |
| 266 | Ga0157375_10439497 | 3300013308 | Bacteria | 1470 |
| 267 | Ga0157380_10024963 | 3300014326 | Bacteria | 4528 |
| 268 | Ga0163161_10285016 | 3300017792 | Bacteria | 1297 |
| 269 | Ga0207653_10003277 | 3300025885 | Bacteria | 5105 |
| 270 | Ga0207653_10006684 | 3300025885 | Unclassified | 3602 |
| 271 | Ga0207653_10119934 | 3300025885 | Bacteria | 946 |
| 272 | Ga0207642_10070914 | 3300025899 | Bacteria | 1658 |
| 273 | Ga0207688_10008008 | 3300025901 | Bacteria | 5751 |
| 274 | Ga0207647_10019631 | 3300025904 | Bacteria | 4543 |
| 275 | Ga0207645_10001727 | 3300025907 | Bacteria | 17713 |
| 276 | Ga0207643_10001135 | 3300025908 | Bacteria | 15834 |
| 277 | Ga0207643_10021877 | 3300025908 | Unclassified | 3518 |
| 278 | Ga0207684_10001398 | 3300025910 | Bacteria | 26216 |
| 279 | Ga0207684_10003869 | 3300025910 | Bacteria | 14379 |
| 280 | Ga0207684_10015250 | 3300025910 | Bacteria | 6620 |
| 281 | Ga0207684_10037779 | 3300025910 | Bacteria | 4097 |
| 282 | Ga0207684_10063626 | 3300025910 | Bacteria | 3132 |
| 283 | Ga0207684_10183616 | 3300025910 | Bacteria | 1804 |
| 284 | Ga0207684_10195228 | 3300025910 | Bacteria | 1746 |
| 285 | Ga0207684_10335781 | 3300025910 | Bacteria | 1301 |
| 286 | Ga0207684_10445655 | 3300025910 | Bacteria | 1112 |
| 287 | Ga0207654_10001729 | 3300025911 | Bacteria | 11365 |
| 288 | Ga0207654_10099656 | 3300025911 | Bacteria | 1788 |
| 289 | Ga0207707_10000034 | 3300025912 | Bacteria | 152677 |
| 290 | Ga0207671_10063819 | 3300025914 | Bacteria | 2737 |
| 291 | Ga0207693_10006771 | 3300025915 | Bacteria | 9462 |
| 292 | Ga0207693_10078261 | 3300025915 | Bacteria | 2588 |
| 293 | Ga0207663_10186000 | 3300025916 | Bacteria | 1487 |
| 294 | Ga0207660_10000382 | 3300025917 | Bacteria | 29017 |
| 295 | Ga0207660_10056472 | 3300025917 | Unclassified | 2809 |
| 296 | Ga0207660_10546421 | 3300025917 | Bacteria | 942 |
| 297 | Ga0207662_10121548 | 3300025918 | Bacteria | 1638 |
| 298 | Ga0207657_10002825 | 3300025919 | Bacteria | 18666 |
| 299 | Ga0207649_10002273 | 3300025920 | Bacteria | 10810 |
| 300 | Ga0207652_10000430 | 3300025921 | Bacteria | 43655 |
| 301 | Ga0207652_10200712 | 3300025921 | Bacteria | 1795 |
| 302 | Ga0207646_10001023 | 3300025922 | Bacteria | 35723 |
| 303 | Ga0207646_10007724 | 3300025922 | Bacteria | 10886 |
| 304 | Ga0207646_10016616 | 3300025922 | Bacteria | 6903 |
| 305 | Ga0207646_10020663 | 3300025922 | Bacteria | 6098 |
| 306 | Ga0207646_10045011 | 3300025922 | Bacteria | 3961 |
| 307 | Ga0207646_10103231 | 3300025922 | Bacteria | 2557 |
| 308 | Ga0207646_10290742 | 3300025922 | Bacteria | 1477 |
| 309 | Ga0207646_10317309 | 3300025922 | Bacteria | 1408 |
| 310 | Ga0207646_10341083 | 3300025922 | Bacteria | 1354 |
| 311 | Ga0207646_10514047 | 3300025922 | Unclassified | 1078 |
| 312 | Ga0207646_10657066 | 3300025922 | Bacteria | 939 |
| 313 | Ga0207650_10002719 | 3300025925 | Bacteria | 12204 |
| 314 | Ga0207659_10660870 | 3300025926 | Bacteria | 893 |
| 315 | Ga0207690_10003117 | 3300025932 | Bacteria | 9983 |
| 316 | Ga0207706_10077976 | 3300025933 | Bacteria | 2914 |
| 317 | Ga0207706_10136232 | 3300025933 | Bacteria | 2160 |
| 318 | Ga0207706_10713869 | 3300025933 | Bacteria | 856 |
| 319 | Ga0207686_10278618 | 3300025934 | Unclassified | 1233 |
| 320 | Ga0207709_10043293 | 3300025935 | Unclassified | 2713 |
| 321 | Ga0207709_10057711 | 3300025935 | Bacteria | 2408 |
| 322 | Ga0207709_10135297 | 3300025935 | Bacteria | 1686 |
| 323 | Ga0207670_10047938 | 3300025936 | Bacteria | 2848 |
| 324 | Ga0207704_10346380 | 3300025938 | Bacteria | 1155 |
| 325 | Ga0207665_10020047 | 3300025939 | Bacteria | 4392 |
| 326 | Ga0207691_10070576 | 3300025940 | Bacteria | 3154 |
| 327 | Ga0207711_10106718 | 3300025941 | Bacteria | 2485 |
| 328 | Ga0207711_10566277 | 3300025941 | Bacteria | 1060 |
| 329 | Ga0207689_10000153 | 3300025942 | Bacteria | 59635 |
| 330 | Ga0207689_10017750 | 3300025942 | Bacteria | 6013 |
| 331 | Ga0207689_10081732 | 3300025942 | Bacteria | 2656 |
| 332 | Ga0207689_10156706 | 3300025942 | Unclassified | 1877 |
| 333 | Ga0207661_10063648 | 3300025944 | Bacteria | 2988 |
| 334 | Ga0207679_10002005 | 3300025945 | Bacteria | 12641 |
| 335 | Ga0207667_10000308 | 3300025949 | Bacteria | 67806 |
| 336 | Ga0207651_10037435 | 3300025960 | Bacteria | 3178 |
| 337 | Ga0207712_10003979 | 3300025961 | Bacteria | 9327 |
| 338 | Ga0207712_10035886 | 3300025961 | Bacteria | 3372 |
| 339 | Ga0207712_10197381 | 3300025961 | Archaea | 1593 |
| 340 | Ga0207640_10003433 | 3300025981 | Bacteria | 8534 |
| 341 | Ga0207658_10319709 | 3300025986 | Bacteria | 1343 |
| 342 | Ga0207677_10053492 | 3300026023 | Bacteria | 2748 |
| 343 | Ga0207677_10503537 | 3300026023 | Bacteria | 1048 |
| 344 | Ga0207703_10006298 | 3300026035 | Bacteria | 9487 |
| 345 | Ga0207703_10203758 | 3300026035 | Unclassified | 1759 |
| 346 | Ga0207639_10000976 | 3300026041 | Bacteria | 19448 |
| 347 | Ga0207708_10104728 | 3300026075 | Unclassified | 2192 |
| 348 | Ga0207702_10000652 | 3300026078 | Bacteria | 37789 |
| 349 | Ga0207641_10025025 | 3300026088 | Bacteria | 4922 |
| 350 | Ga0207641_10154821 | 3300026088 | Bacteria | 2079 |
| 351 | Ga0207648_10000169 | 3300026089 | Bacteria | 67635 |
| 352 | Ga0207648_10115205 | 3300026089 | Bacteria | 2362 |
| 353 | Ga0207676_10033771 | 3300026095 | Bacteria | 3868 |
| 354 | Ga0207676_10530760 | 3300026095 | Bacteria | 1122 |
| 355 | Ga0207674_10000050 | 3300026116 | Bacteria | 116782 |
| 356 | Ga0207674_10071805 | 3300026116 | Bacteria | 3478 |
| 357 | Ga0207674_10175770 | 3300026116 | Bacteria | 2093 |
| 358 | Ga0207675_100011174 | 3300026118 | Bacteria | 8406 |
| 359 | Ga0207675_100104588 | 3300026118 | Bacteria | 2668 |
| 360 | Ga0207675_100128949 | 3300026118 | Bacteria | 2398 |
| 361 | Ga0207698_10214271 | 3300026142 | Bacteria | 1735 |
| 362 | Ga0210000_1006161 | 3300027462 | Bacteria | 1746 |
| 363 | Ga0209995_1000557 | 3300027471 | Bacteria | 5671 |
| 364 | Ga0209968_1003187 | 3300027526 | Bacteria | 2460 |
| 365 | Ga0209999_1003564 | 3300027543 | Bacteria | 2789 |
| 366 | Ga0209970_1001167 | 3300027614 | Bacteria | 4626 |
| 367 | Ga0209983_1001441 | 3300027665 | Bacteria | 5283 |
| 368 | Ga0209588_1049838 | 3300027671 | Bacteria | 1355 |
| 369 | Ga0209971_1000103 | 3300027682 | Bacteria | 25109 |
| 370 | Ga0209971_1017624 | 3300027682 | Bacteria | 1693 |
| 371 | Ga0209966_1000042 | 3300027695 | Bacteria | 53500 |
| 372 | Ga0209998_10000127 | 3300027717 | Bacteria | 29842 |
| 373 | Ga0209974_10000436 | 3300027876 | Bacteria | 13888 |
| 374 | Ga0207428_10000054 | 3300027907 | Bacteria | 175237 |
| 375 | Ga0207428_10007442 | 3300027907 | Bacteria | 9982 |
| 376 | Ga0268265_10003808 | 3300028380 | Bacteria | 10690 |
| 377 | Ga0268265_10007220 | 3300028380 | Bacteria | 7507 |
| 378 | Ga0268265_10011871 | 3300028380 | Bacteria | 5889 |
| 379 | Ga0268265_10016149 | 3300028380 | Bacteria | 5125 |
| 380 | Ga0268265_10424943 | 3300028380 | Bacteria | 1235 |
| 381 | Ga0268264_10008214 | 3300028381 | Bacteria | 8668 |
| 382 | Ga0268264_10074280 | 3300028381 | Bacteria | 2887 |
| 383 | Ga0268264_10519338 | 3300028381 | Unclassified | 1164 |
| 384 | Ga0307408_100085026 | 3300031548 | Bacteria | 2374 |
| 385 | Ga0307413_10354035 | 3300031824 | Bacteria | 1134 |
| 386 | Ga0307407_10020838 | 3300031903 | Bacteria | 3368 |
| 387 | Ga0307412_10367363 | 3300031911 | Bacteria | 1161 |
| 388 | Ga0307409_100006456 | 3300031995 | Bacteria | 6893 |
| 389 | Ga0307409_100369120 | 3300031995 | Bacteria | 1360 |
| 390 | Ga0307416_100015112 | 3300032002 | Bacteria | 5318 |
| 391 | Ga0307416_100322510 | 3300032002 | Bacteria | 1548 |
| 392 | Ga0307416_100509513 | 3300032002 | Bacteria | 1269 |
| 393 | Ga0307411_10232251 | 3300032005 | Bacteria | 1438 |
| 394 | Ga0373948_0008669 | 3300034817 | Bacteria | 1737 |
| 395 | Ga0373959_0010524 | 3300034820 | Bacteria | 1617 |
| 396 | Ga0373949_0005449 | 3300035090 | Bacteria | 2837 |
| 397 | Ga0373951_0041814 | 3300035091 | Bacteria | 1107 |
| 398 | Ga0373952_0012965 | 3300035092 | Bacteria | 1648 |
| 399 | Ga0373932_0069502 | 3300035112 | Bacteria | 1089 |
| 400 | Ga0373960_0006606 | 3300035121 | Bacteria | 2725 |
| 401 | Ga0373960_0062503 | 3300035121 | Bacteria | 1133 |
| 402 | Ga0373961_0002388 | 3300035241 | Bacteria | 4886 |
| 403 | Ga0373962_0014767 | 3300035242 | Bacteria | 1994 |
| 404 | Ga0373931_0016937 | 3300035691 | Bacteria | 3595 |
| 405 | Ga0373931_0092001 | 3300035691 | Bacteria | 1691 |
| 406 | Ga0395899_0120663 | 3300037312 | Bacteria | 1878 |
| 407 | Ga0395900_0002528 | 3300037418 | Bacteria | 20031 |
| 408 | Ga0395900_0639401 | 3300037418 | Bacteria | 1001 |
| 409 | Ga0395898_0035517 | 3300037466 | Bacteria | 4954 |
| 410 | Ga0395898_0350806 | 3300037466 | Bacteria | 1407 |
| 411 | Ga0395901_0002359 | 3300038443 | Bacteria | 19205 |
| 412 | Ga0395901_0072757 | 3300038443 | Bacteria | 3584 |
| 413 | Ga0439448_0001261 | 3300042005 | Bacteria | 6474 |
| 414 | Ga0439448_0011765 | 3300042005 | Bacteria | 2610 |
| 415 | Ga0439450_014672 | 3300042008 | Bacteria | 1592 |
| 416 | Ga0439455_0051182 | 3300042012 | Bacteria | 1079 |
| 417 | Ga0439455_0094369 | 3300042012 | Bacteria | 822 |
| 418 | Ga0439463_055355 | 3300042016 | Bacteria | 1013 |
| 419 | Ga0439458_0023619 | 3300042157 | Bacteria | 1434 |
| 420 | Ga0439464_0003655 | 3300042439 | Bacteria | 3901 |
| 421 | Ga0439460_0013223 | 3300042461 | Bacteria | 2156 |
| 422 | Ga0451577_0028473 | 3300042876 | Bacteria | 5052 |
| 423 | Ga0451577_0033485 | 3300042876 | Bacteria | 4632 |
| 424 | Ga0451577_0053264 | 3300042876 | Bacteria | 3612 |
| 425 | Ga0451577_0084240 | 3300042876 | Bacteria | 2837 |
| 426 | Ga0451577_0090550 | 3300042876 | Bacteria | 2730 |
| 427 | Ga0451577_0136954 | 3300042876 | Bacteria | 2199 |
| 428 | Ga0451577_0357353 | 3300042876 | Bacteria | 1325 |
| 429 | Ga0451577_0463517 | 3300042876 | Bacteria | 1151 |
| 430 | Ga0453683_0012871 | 3300044673 | Bacteria | 5473 |
| 431 | Ga0453683_0021188 | 3300044673 | Bacteria | 4150 |
| 432 | Ga0453683_0033634 | 3300044673 | Bacteria | 3234 |
| 433 | Ga0453683_0270505 | 3300044673 | Bacteria | 1084 |
| 434 | Ga0453683_0348222 | 3300044673 | Bacteria | 951 |
| 435 | Ga0453683_0387675 | 3300044673 | Unclassified | 900 |
| 436 | Ga0453684_0022188 | 3300044712 | Bacteria | 9435 |
| 437 | Ga0453684_0059192 | 3300044712 | Bacteria | 4941 |
| 438 | Ga0453684_0105532 | 3300044712 | Bacteria | 3436 |
| 439 | Ga0453684_0675488 | 3300044712 | Bacteria | 1125 |
| 440 | Ga0451576_0003436 | 3300045051 | Bacteria | 21774 |
| 441 | Ga0451576_0041817 | 3300045051 | Bacteria | 4843 |
| 442 | Ga0451576_0075462 | 3300045051 | Bacteria | 3508 |
| 443 | Ga0451576_0090083 | 3300045051 | Bacteria | 3190 |
| 444 | Ga0451576_0100041 | 3300045051 | Bacteria | 3016 |
| 445 | Ga0451576_0176658 | 3300045051 | Bacteria | 2229 |
| 446 | Ga0451576_0221170 | 3300045051 | Bacteria | 1977 |
| 447 | Ga0451576_0417426 | 3300045051 | Bacteria | 1408 |
| 448 | Ga0451576_0474738 | 3300045051 | Bacteria | 1313 |
| 449 | Ga0451576_0733171 | 3300045051 | Bacteria | 1038 |
| 450 | Ga0495580_0001279 | 3300046472 | Bacteria | 22163 |
| 451 | Ga0495580_0059569 | 3300046472 | Bacteria | 2683 |
| 452 | Ga0495584_0044378 | 3300046491 | Bacteria | 2244 |
| 453 | Ga0495669_0029212 | 3300046684 | Bacteria | 2417 |
| 454 | Ga0495636_0152070 | 3300047318 | Bacteria | 1039 |
| 455 | Ga0496100_0128796 | 3300048903 | Bacteria | 1780 |
| 456 | Ga0496102_0023647 | 3300048905 | Bacteria | 5460 |
| 457 | Ga0496102_0034628 | 3300048905 | Bacteria | 4543 |
| 458 | Ga0496106_0050838 | 3300048909 | Bacteria | 3124 |
| 459 | Ga0496106_0243680 | 3300048909 | Bacteria | 1436 |
| 460 | Ga0496109_0307166 | 3300048912 | Bacteria | 1496 |
| 461 | Ga0496110_0315927 | 3300048913 | Bacteria | 1423 |
| 462 | Ga0496112_0038924 | 3300048915 | Bacteria | 4645 |
| 463 | Ga0496113_0097028 | 3300048916 | Bacteria | 2280 |
| 464 | Ga0501033_0040153 | 3300049570 | Bacteria | 3494 |
| 465 | Ga0501033_0423216 | 3300049570 | Bacteria | 927 |
| 466 | Ga0501036_0284355 | 3300049572 | Bacteria | 1384 |
| 467 | Ga0501036_0403086 | 3300049572 | Bacteria | 1141 |
| 468 | Ga0501037_0123863 | 3300049573 | Bacteria | 1857 |
| 469 | Ga0501038_0120984 | 3300049574 | Bacteria | 2159 |
| 470 | Ga0501038_0133303 | 3300049574 | Bacteria | 2037 |
| 471 | Ga0501039_0130183 | 3300049575 | Bacteria | 1975 |
| 472 | Ga0501039_0178787 | 3300049575 | Bacteria | 1669 |
| 473 | Ga0501039_0218665 | 3300049575 | Bacteria | 1498 |
| 474 | Ga0501040_0001692 | 3300049576 | Bacteria | 14136 |
| 475 | Ga0501040_0005881 | 3300049576 | Bacteria | 7941 |
| 476 | Ga0501040_0012970 | 3300049576 | Bacteria | 5479 |
| 477 | Ga0501040_0200330 | 3300049576 | Bacteria | 1417 |
| 478 | Ga0501041_0004951 | 3300049577 | Bacteria | 7748 |
| 479 | Ga0501041_0043353 | 3300049577 | Bacteria | 2735 |
| 480 | Ga0501041_0320854 | 3300049577 | Bacteria | 977 |
| 481 | Ga0501042_0001027 | 3300049578 | Bacteria | 15893 |
| 482 | Ga0501046_0000084 | 3300049580 | Bacteria | 100971 |
| 483 | Ga0501046_0142686 | 3300049580 | Bacteria | 1811 |
| 484 | Ga0501048_0006618 | 3300049582 | Bacteria | 8809 |
| 485 | Ga0501048_0133124 | 3300049582 | Bacteria | 1757 |
| 486 | Ga0501048_0158167 | 3300049582 | Bacteria | 1603 |
| 487 | Ga0501067_0025668 | 3300049583 | Bacteria | 3266 |
| 488 | Ga0501067_0292595 | 3300049583 | Bacteria | 907 |
| 489 | Ga0501068_0037970 | 3300049584 | Bacteria | 2884 |
| 490 | Ga0501068_0131366 | 3300049584 | Bacteria | 1566 |
| 491 | Ga0501068_0167254 | 3300049584 | Bacteria | 1387 |
| 492 | Ga0501069_0007030 | 3300049585 | Bacteria | 5892 |
| 493 | Ga0501069_0197984 | 3300049585 | Bacteria | 1164 |
| 494 | Ga0501071_0030163 | 3300049587 | Bacteria | 3834 |
| 495 | Ga0501072_0040433 | 3300049588 | Bacteria | 3661 |
| 496 | Ga0501072_0112021 | 3300049588 | Bacteria | 2172 |
| 497 | Ga0501072_0266859 | 3300049588 | Bacteria | 1362 |
| 498 | Ga0501072_0371239 | 3300049588 | Bacteria | 1135 |
| 499 | Ga0501072_0519080 | 3300049588 | Bacteria | 942 |
| 500 | Ga0501073_0233931 | 3300049589 | Bacteria | 1269 |
| 501 | Ga0501073_0386499 | 3300049589 | Bacteria | 967 |
| 502 | Ga0501074_0004066 | 3300049590 | Bacteria | 10435 |
| 503 | Ga0501074_0191215 | 3300049590 | Bacteria | 1459 |
| 504 | Ga0501074_0297225 | 3300049590 | Bacteria | 1147 |
| 505 | Ga0501075_0096900 | 3300049591 | Bacteria | 2238 |
| 506 | Ga0501075_0126192 | 3300049591 | Bacteria | 1948 |
| 507 | Ga0501075_0187806 | 3300049591 | Bacteria | 1576 |
| 508 | Ga0501075_0217779 | 3300049591 | Bacteria | 1456 |
| 509 | Ga0501075_0392875 | 3300049591 | Bacteria | 1057 |
| 510 | Ga0501075_0413290 | 3300049591 | Bacteria | 1029 |
| 511 | Ga0501076_0003680 | 3300049592 | Bacteria | 10779 |
| 512 | Ga0501076_0054077 | 3300049592 | Bacteria | 3182 |
| 513 | Ga0501076_0093822 | 3300049592 | Bacteria | 2416 |
| 514 | Ga0501076_0096684 | 3300049592 | Bacteria | 2379 |
| 515 | Ga0501076_0109213 | 3300049592 | Bacteria | 2235 |
| 516 | Ga0501076_0162086 | 3300049592 | Bacteria | 1822 |
| 517 | Ga0501076_0186499 | 3300049592 | Bacteria | 1692 |
| 518 | Ga0501076_0207813 | 3300049592 | Bacteria | 1599 |
| 519 | Ga0501077_0016948 | 3300049593 | Bacteria | 4596 |
| 520 | Ga0501077_0118093 | 3300049593 | Bacteria | 1681 |
| 521 | Ga0501077_0201160 | 3300049593 | Bacteria | 1265 |
| 522 | Ga0501077_0215906 | 3300049593 | Bacteria | 1219 |
| 523 | Ga0501077_0305462 | 3300049593 | Bacteria | 1014 |
| 524 | Ga0501079_0000126 | 3300049741 | Bacteria | 40724 |
| 525 | Ga0501079_0028751 | 3300049741 | Bacteria | 4267 |
| 526 | Ga0501079_0042598 | 3300049741 | Bacteria | 3505 |
| 527 | Ga0501079_0107054 | 3300049741 | Bacteria | 2170 |
| 528 | Ga0501079_0137499 | 3300049741 | Bacteria | 1903 |
| 529 | Ga0501079_0158042 | 3300049741 | Bacteria | 1767 |
| 530 | Ga0501079_0426215 | 3300049741 | Bacteria | 1041 |
| 531 | Ga0501080_0028768 | 3300049742 | Bacteria | 5174 |
| 532 | Ga0501080_0140161 | 3300049742 | Bacteria | 2236 |
| 533 | Ga0501080_0702384 | 3300049742 | Bacteria | 892 |
| 534 | Ga0501081_0002938 | 3300049743 | Bacteria | 10811 |
| 535 | Ga0501081_0005134 | 3300049743 | Bacteria | 8428 |
| 536 | Ga0501081_0013413 | 3300049743 | Bacteria | 5389 |
| 537 | Ga0501081_0015599 | 3300049743 | Bacteria | 5015 |
| 538 | Ga0501081_0015840 | 3300049743 | Bacteria | 4977 |
| 539 | Ga0501081_0068424 | 3300049743 | Bacteria | 2472 |
| 540 | Ga0501081_0168895 | 3300049743 | Bacteria | 1579 |
| 541 | Ga0501081_0281478 | 3300049743 | Bacteria | 1218 |
| 542 | Ga0501083_0301449 | 3300049744 | Bacteria | 1042 |
| 543 | Ga0501035_0290920 | 3300049822 | Bacteria | 1379 |
| 544 | Ga0501045_0000701 | 3300049824 | Bacteria | 21268 |
| 545 | Ga0501045_0068944 | 3300049824 | Bacteria | 2599 |
| 546 | Ga0501045_0074466 | 3300049824 | Bacteria | 2500 |
| 547 | Ga0501045_0095868 | 3300049824 | Bacteria | 2195 |
| 548 | Ga0501045_0124822 | 3300049824 | Bacteria | 1912 |
| 549 | Ga0501045_0357955 | 3300049824 | Bacteria | 1086 |
| 550 | Ga0501045_0358918 | 3300049824 | Bacteria | 1084 |
| 551 | Ga0501045_0372091 | 3300049824 | Bacteria | 1063 |
| 552 | nmdc:mga05p37_100710_c1 | 3300050507 | Bacteria | 3559 |
| 553 | nmdc:mga05p37_12948_c1 | 3300050507 | Bacteria | 9977 |
| 554 | nmdc:mga05p37_134317_c1 | 3300050507 | Bacteria | 3035 |
| 555 | nmdc:mga05p37_1427_c1 | 3300050507 | Bacteria | 27781 |
| 556 | nmdc:mga05p37_152101_c1 | 3300050507 | Bacteria | 2830 |
| 557 | nmdc:mga05p37_15303_c1 | 3300050507 | Bacteria | 9215 |
| 558 | nmdc:mga05p37_168271_c1 | 3300050507 | Bacteria | 2674 |
| 559 | nmdc:mga05p37_2575_c1 | 3300050507 | Bacteria | 21085 |
| 560 | nmdc:mga05p37_45733_c1 | 3300050507 | Bacteria | 5382 |
| 561 | nmdc:mga05p37_45908_c1 | 3300050507 | Bacteria | 5373 |
| 562 | nmdc:mga05p37_546896_c1 | 3300050507 | Bacteria | 1319 |
| 563 | nmdc:mga05p37_5969_c1 | 3300050507 | Bacteria | 5263 |
| 564 | nmdc:mga05p37_61012_c1 | 3300050507 | Bacteria | 4643 |
| 565 | nmdc:mga05p37_6660_c1 | 3300050507 | Bacteria | 13630 |
| 566 | nmdc:mga05p37_67273_c1 | 3300050507 | Bacteria | 4408 |
| 567 | nmdc:mga05p37_6_c1 | 3300050507 | Bacteria | 155503 |
| 568 | nmdc:mga05p37_768505_c1 | 3300050507 | Bacteria | 1059 |
| 569 | nmdc:mga09592_159_c1 | 3300050508 | Bacteria | 47011 |
| 570 | nmdc:mga09592_1747_c1 | 3300050508 | Bacteria | 17460 |
| 571 | nmdc:mga09592_25844_c1 | 3300050508 | Bacteria | 4863 |
| 572 | nmdc:mga09592_289732_c1 | 3300050508 | Bacteria | 1419 |
| 573 | nmdc:mga09592_3854_c1 | 3300050508 | Bacteria | 12072 |
| 574 | nmdc:mga09592_46347_c1 | 3300050508 | Bacteria | 3663 |
| 575 | nmdc:mga09592_8228_c1 | 3300050508 | Bacteria | 8481 |
| 576 | nmdc:mga0qj67_109653_c1 | 3300050509 | Bacteria | 2228 |
| 577 | nmdc:mga0qj67_154902_c1 | 3300050509 | Bacteria | 1859 |
| 578 | nmdc:mga0qj67_28180_c1 | 3300050509 | Bacteria | 4358 |
| 579 | nmdc:mga0qj67_474_c1 | 3300050509 | Bacteria | 27378 |
| 580 | nmdc:mga06r32_130290_c1 | 3300050510 | Bacteria | 2487 |
| 581 | nmdc:mga06r32_2028_c1 | 3300050510 | Bacteria | 18108 |
| 582 | nmdc:mga06r32_232747_c1 | 3300050510 | Bacteria | 1830 |
| 583 | nmdc:mga06r32_25044_c1 | 3300050510 | Bacteria | 5545 |
| 584 | nmdc:mga06r32_3585_c1 | 3300050510 | Bacteria | 13853 |
| 585 | nmdc:mga06r32_361_c1 | 3300050510 | Bacteria | 38128 |
| 586 | nmdc:mga06r32_362_c1 | 3300050510 | Bacteria | 38094 |
| 587 | nmdc:mga06r32_36558_c1 | 3300050510 | Bacteria | 4641 |
| 588 | nmdc:mga06r32_405047_c1 | 3300050510 | Bacteria | 1346 |
| 589 | nmdc:mga06r32_40567_c1 | 3300050510 | Bacteria | 4420 |
| 590 | nmdc:mga06r32_64638_c1 | 3300050510 | Bacteria | 3528 |
| 591 | nmdc:mga06r32_70576_c1 | 3300050510 | Bacteria | 3379 |
| 592 | nmdc:mga06r32_763548_c1 | 3300050510 | Unclassified | 929 |
| 593 | nmdc:mga06r32_9821_c1 | 3300050510 | Bacteria | 8634 |
| 594 | nmdc:mga08y16_233459_c1 | 3300050511 | Bacteria | 1902 |
| 595 | nmdc:mga08y16_2863_c1 | 3300050511 | Bacteria | 17747 |
| 596 | nmdc:mga08y16_4495_c1 | 3300050511 | Bacteria | 14572 |
| 597 | nmdc:mga08y16_46350_c1 | 3300050511 | Bacteria | 4551 |
| 598 | nmdc:mga0n895_13531_c1 | 3300050512 | Bacteria | 7368 |
| 599 | nmdc:mga0n895_141599_c1 | 3300050512 | Bacteria | 2434 |
| 600 | nmdc:mga0n895_16149_c1 | 3300050512 | Bacteria | 6843 |
| 601 | nmdc:mga0n895_20052_c1 | 3300050512 | Bacteria | 6226 |
| 602 | nmdc:mga0n895_226260_c1 | 3300050512 | Bacteria | 1899 |
| 603 | nmdc:mga0n895_287693_c1 | 3300050512 | Bacteria | 1666 |
| 604 | nmdc:mga0n895_48577_c1 | 3300050512 | Bacteria | 4154 |
| 605 | nmdc:mga0n895_528498_c1 | 3300050512 | Bacteria | 1187 |
| 606 | nmdc:mga0n895_66753_c1 | 3300050512 | Bacteria | 3562 |
| 607 | nmdc:mga0n895_66809_c1 | 3300050512 | Bacteria | 3560 |
| 608 | nmdc:mga0n895_713_c1 | 3300050512 | Bacteria | 23385 |
| 609 | nmdc:mga0n895_81594_c1 | 3300050512 | Bacteria | 3223 |
| 610 | nmdc:mga0n895_85666_c1 | 3300050512 | Bacteria | 3146 |
| 611 | nmdc:mga0n895_8963_c1 | 3300050512 | Bacteria | 8722 |
| 612 | nmdc:mga0rr50_1514_c1 | 3300050513 | Bacteria | 12803 |
| 613 | nmdc:mga0rr50_184105_c1 | 3300050513 | Bacteria | 1709 |
| 614 | nmdc:mga0rr50_228853_c1 | 3300050513 | Bacteria | 1538 |
| 615 | nmdc:mga0rr50_270921_c1 | 3300050513 | Bacteria | 1415 |
| 616 | nmdc:mga0rr50_292766_c1 | 3300050513 | Bacteria | 1361 |
| 617 | nmdc:mga0rr50_4899_c2 | 3300050513 | Bacteria | 6978 |
| 618 | nmdc:mga0rr50_49292_c1 | 3300050513 | Bacteria | 3118 |
| 619 | nmdc:mga0rr50_88857_c1 | 3300050513 | Bacteria | 2401 |
| 620 | nmdc:mga0rr50_9978_c1 | 3300050513 | Bacteria | 6005 |
| 621 | nmdc:mga08x19_112247_c1 | 3300050514 | Bacteria | 1819 |
| 622 | nmdc:mga08x19_27650_c1 | 3300050514 | Bacteria | 3548 |
| 623 | nmdc:mga08x19_43214_c1 | 3300050514 | Bacteria | 2875 |
| 624 | nmdc:mga08x19_6921_c1 | 3300050514 | Bacteria | 6735 |
| 625 | nmdc:mga08x19_963_c1 | 3300050514 | Bacteria | 18072 |
| 626 | nmdc:mga0a205_14189_c1 | 3300050515 | Bacteria | 7432 |
| 627 | nmdc:mga0a205_1824_c1 | 3300050515 | Bacteria | 18416 |
| 628 | nmdc:mga0a205_19278_c1 | 3300050515 | Bacteria | 6428 |
| 629 | nmdc:mga0a205_2149_c1 | 3300050515 | Bacteria | 17313 |
| 630 | nmdc:mga0a205_252626_c1 | 3300050515 | Bacteria | 1642 |
| 631 | nmdc:mga0a205_318363_c1 | 3300050515 | Bacteria | 1427 |
| 632 | nmdc:mga0a205_3835_c1 | 3300050515 | Bacteria | 13471 |
| 633 | nmdc:mga0a205_50847_c1 | 3300050515 | Bacteria | 4001 |
| 634 | nmdc:mga0a205_57545_c1 | 3300050515 | Bacteria | 3754 |
| 635 | nmdc:mga0a205_58846_c1 | 3300050515 | Bacteria | 3712 |
| 636 | nmdc:mga0a205_59855_c1 | 3300050515 | Bacteria | 3679 |
| 637 | nmdc:mga0a205_85539_c1 | 3300050515 | Bacteria | 3045 |
| 638 | Ga0501084_0000139 | 3300054114 | Bacteria | 54829 |
| 639 | Ga0501084_0042821 | 3300054114 | Bacteria | 3788 |
| 640 | Ga0501084_0062480 | 3300054114 | Bacteria | 3118 |
| 641 | Ga0501084_0095416 | 3300054114 | Bacteria | 2498 |
| 642 | Ga0501084_0110303 | 3300054114 | Bacteria | 2312 |
| 643 | Ga0501084_0135457 | 3300054114 | Bacteria | 2074 |
| 644 | Ga0501082_0000528 | 3300060353 | Bacteria | 34016 |
| 645 | Ga0501082_0058879 | 3300060353 | Bacteria | 3310 |
| 646 | Ga0501082_0086041 | 3300060353 | Bacteria | 2711 |
| 647 | Ga0530510_0065148 | 3300061734 | Bacteria | 2640 |
| 648 | Ga0530510_0128740 | 3300061734 | Bacteria | 1862 |
| 649 | Ga0530510_0159604 | 3300061734 | Bacteria | 1667 |
| 650 | Ga0530510_0214423 | 3300061734 | Bacteria | 1430 |
| 651 | Ga0530510_0217974 | 3300061734 | Bacteria | 1418 |
| 652 | Ga0530510_0227999 | 3300061734 | Bacteria | 1385 |
| 653 | Ga0530510_0356966 | 3300061734 | Bacteria | 1098 |
| 654 | Ga0530510_0358496 | 3300061734 | Bacteria | 1096 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10085682 | Ga0081538_100856823 | 256 |
| 2 | 3300006846 | Ga0075430_100070655 | Ga0075430_1000706553 | 256 |
| 3 | 3300006847 | Ga0075431_100002318 | Ga0075431_10000231819 | 256 |
| 4 | 3300006852 | Ga0075433_10010195 | Ga0075433_100101952 | 256 |
| 5 | 3300006852 | Ga0075433_10013834 | Ga0075433_100138346 | 256 |
| 6 | 3300006852 | Ga0075433_10024303 | Ga0075433_100243032 | 256 |
| 7 | 3300006871 | Ga0075434_100081534 | Ga0075434_1000815342 | 256 |
| 8 | 3300009094 | Ga0111539_10016096 | Ga0111539_100160964 | 256 |
| 9 | 3300025933 | Ga0207706_10713869 | Ga0207706_107138691 | 256 |
| 10 | 3300027907 | Ga0207428_10000054 | Ga0207428_1000005424 | 256 |
| 11 | 3300028380 | Ga0268265_10016149 | Ga0268265_100161494 | 256 |
| 12 | 3300042876 | Ga0451577_0028473 | Ga0451577_0028473_839_1609 | 256 |
| 13 | 3300044673 | Ga0453683_0021188 | Ga0453683_0021188_1631_2401 | 256 |
| 14 | 3300044712 | Ga0453684_0022188 | Ga0453684_0022188_7426_8196 | 256 |
| 15 | 3300045051 | Ga0451576_0176658 | Ga0451576_0176658_813_1583 | 256 |
| 16 | 3300045051 | Ga0451576_0221170 | Ga0451576_0221170_75_845 | 256 |
| 17 | 3300050510 | nmdc:mga06r32_362_c1 | nmdc:mga06r32_362_c1_20506_21276 | 256 |
| 18 | 3300050511 | nmdc:mga08y16_2863_c1 | nmdc:mga08y16_2863_c1_12481_13251 | 256 |
| 19 | 3300050512 | nmdc:mga0n895_48577_c1 | nmdc:mga0n895_48577_c1_2934_3704 | 256 |
| 20 | 3300050512 | nmdc:mga0n895_528498_c1 | nmdc:mga0n895_528498_c1_127_897 | 256 |
| 21 | 3300050512 | nmdc:mga0n895_66809_c1 | nmdc:mga0n895_66809_c1_716_1486 | 256 |
| 22 | 3300050513 | nmdc:mga0rr50_88857_c1 | nmdc:mga0rr50_88857_c1_1574_2344 | 256 |
| 23 | 3300050515 | nmdc:mga0a205_1824_c1 | nmdc:mga0a205_1824_c1_832_1602 | 256 |
| 24 | 3300050515 | nmdc:mga0a205_3835_c1 | nmdc:mga0a205_3835_c1_9354_10124 | 256 |
| 25 | 3300005295 | Ga0065707_10012903 | Ga0065707_100129031 | 257 |
| 26 | 3300005328 | Ga0070676_10005622 | Ga0070676_100056224 | 257 |
| 27 | 3300005329 | Ga0070683_100083081 | Ga0070683_1000830812 | 257 |
| 28 | 3300005330 | Ga0070690_100119744 | Ga0070690_1001197443 | 257 |
| 29 | 3300005331 | Ga0070670_100115006 | Ga0070670_1001150062 | 257 |
| 30 | 3300005334 | Ga0068869_100000012 | Ga0068869_10000001215 | 257 |
| 31 | 3300005336 | Ga0070680_100004085 | Ga0070680_10000408512 | 257 |
| 32 | 3300005336 | Ga0070680_100015564 | Ga0070680_1000155647 | 257 |
| 33 | 3300005336 | Ga0070680_100057128 | Ga0070680_1000571284 | 257 |
| 34 | 3300005337 | Ga0070682_100000192 | Ga0070682_10000019213 | 257 |
| 35 | 3300005339 | Ga0070660_100000614 | Ga0070660_10000061417 | 257 |
| 36 | 3300005340 | Ga0070689_100045755 | Ga0070689_1000457551 | 257 |
| 37 | 3300005341 | Ga0070691_10000893 | Ga0070691_1000089310 | 257 |
| 38 | 3300005341 | Ga0070691_10019301 | Ga0070691_100193012 | 257 |
| 39 | 3300005341 | Ga0070691_10028394 | Ga0070691_100283942 | 257 |
| 40 | 3300005343 | Ga0070687_100023875 | Ga0070687_1000238753 | 257 |
| 41 | 3300005344 | Ga0070661_100000917 | Ga0070661_10000091720 | 257 |
| 42 | 3300005345 | Ga0070692_10009036 | Ga0070692_100090364 | 257 |
| 43 | 3300005345 | Ga0070692_10105082 | Ga0070692_101050821 | 257 |
| 44 | 3300005347 | Ga0070668_100142255 | Ga0070668_1001422553 | 257 |
| 45 | 3300005353 | Ga0070669_100118814 | Ga0070669_1001188142 | 257 |
| 46 | 3300005354 | Ga0070675_100443568 | Ga0070675_1004435682 | 257 |
| 47 | 3300005364 | Ga0070673_100171677 | Ga0070673_1001716772 | 257 |
| 48 | 3300005366 | Ga0070659_100000328 | Ga0070659_10000032836 | 257 |
| 49 | 3300005406 | Ga0070703_10001692 | Ga0070703_100016924 | 257 |
| 50 | 3300005406 | Ga0070703_10003696 | Ga0070703_100036964 | 257 |
| 51 | 3300005406 | Ga0070703_10118539 | Ga0070703_101185391 | 257 |
| 52 | 3300005438 | Ga0070701_10045580 | Ga0070701_100455803 | 257 |
| 53 | 3300005438 | Ga0070701_10068686 | Ga0070701_100686862 | 257 |
| 54 | 3300005438 | Ga0070701_10089428 | Ga0070701_100894282 | 257 |
| 55 | 3300005440 | Ga0070705_100000714 | Ga0070705_10000071419 | 257 |
| 56 | 3300005440 | Ga0070705_100021749 | Ga0070705_1000217492 | 257 |
| 57 | 3300005440 | Ga0070705_100071245 | Ga0070705_1000712452 | 257 |
| 58 | 3300005444 | Ga0070694_100000221 | Ga0070694_1000002216 | 257 |
| 59 | 3300005444 | Ga0070694_100000708 | Ga0070694_10000070815 | 257 |
| 60 | 3300005444 | Ga0070694_100043253 | Ga0070694_1000432533 | 257 |
| 61 | 3300005444 | Ga0070694_100093269 | Ga0070694_1000932692 | 257 |
| 62 | 3300005444 | Ga0070694_100161904 | Ga0070694_1001619042 | 257 |
| 63 | 3300005444 | Ga0070694_100176718 | Ga0070694_1001767182 | 257 |
| 64 | 3300005445 | Ga0070708_100022076 | Ga0070708_1000220764 | 257 |
| 65 | 3300005445 | Ga0070708_100029245 | Ga0070708_1000292455 | 257 |
| 66 | 3300005445 | Ga0070708_100057003 | Ga0070708_1000570032 | 257 |
| 67 | 3300005445 | Ga0070708_100171376 | Ga0070708_1001713762 | 257 |
| 68 | 3300005445 | Ga0070708_100232125 | Ga0070708_1002321253 | 257 |
| 69 | 3300005445 | Ga0070708_100240439 | Ga0070708_1002404392 | 257 |
| 70 | 3300005445 | Ga0070708_100264015 | Ga0070708_1002640152 | 257 |
| 71 | 3300005457 | Ga0070662_100227690 | Ga0070662_1002276902 | 257 |
| 72 | 3300005458 | Ga0070681_10003830 | Ga0070681_1000383012 | 257 |
| 73 | 3300005459 | Ga0068867_100002111 | Ga0068867_10000211112 | 257 |
| 74 | 3300005459 | Ga0068867_100621964 | Ga0068867_1006219641 | 257 |
| 75 | 3300005467 | Ga0070706_100002217 | Ga0070706_1000022175 | 257 |
| 76 | 3300005467 | Ga0070706_100029148 | Ga0070706_1000291484 | 257 |
| 77 | 3300005467 | Ga0070706_100202998 | Ga0070706_1002029982 | 257 |
| 78 | 3300005467 | Ga0070706_100280036 | Ga0070706_1002800362 | 257 |
| 79 | 3300005467 | Ga0070706_100336058 | Ga0070706_1003360581 | 257 |
| 80 | 3300005468 | Ga0070707_100022952 | Ga0070707_1000229525 | 257 |
| 81 | 3300005468 | Ga0070707_100049522 | Ga0070707_1000495223 | 257 |
| 82 | 3300005468 | Ga0070707_100066131 | Ga0070707_1000661313 | 257 |
| 83 | 3300005468 | Ga0070707_100067507 | Ga0070707_1000675074 | 257 |
| 84 | 3300005468 | Ga0070707_100078244 | Ga0070707_1000782442 | 257 |
| 85 | 3300005468 | Ga0070707_100193981 | Ga0070707_1001939812 | 257 |
| 86 | 3300005468 | Ga0070707_100408190 | Ga0070707_1004081901 | 257 |
| 87 | 3300005468 | Ga0070707_100677776 | Ga0070707_1006777761 | 257 |
| 88 | 3300005471 | Ga0070698_100017214 | Ga0070698_1000172146 | 257 |
| 89 | 3300005471 | Ga0070698_100039179 | Ga0070698_1000391793 | 257 |
| 90 | 3300005471 | Ga0070698_100049290 | Ga0070698_1000492906 | 257 |
| 91 | 3300005471 | Ga0070698_100091467 | Ga0070698_1000914674 | 257 |
| 92 | 3300005471 | Ga0070698_100205367 | Ga0070698_1002053672 | 257 |
| 93 | 3300005471 | Ga0070698_100245473 | Ga0070698_1002454733 | 257 |
| 94 | 3300005471 | Ga0070698_100262409 | Ga0070698_1002624092 | 257 |
| 95 | 3300005471 | Ga0070698_100333828 | Ga0070698_1003338281 | 257 |
| 96 | 3300005518 | Ga0070699_100001395 | Ga0070699_1000013959 | 257 |
| 97 | 3300005518 | Ga0070699_100023904 | Ga0070699_1000239043 | 257 |
| 98 | 3300005518 | Ga0070699_100045128 | Ga0070699_1000451282 | 257 |
| 99 | 3300005518 | Ga0070699_100065744 | Ga0070699_1000657443 | 257 |
| 100 | 3300005518 | Ga0070699_100103209 | Ga0070699_1001032093 | 257 |
| 101 | 3300005518 | Ga0070699_100184565 | Ga0070699_1001845652 | 257 |
| 102 | 3300005518 | Ga0070699_100203064 | Ga0070699_1002030642 | 257 |
| 103 | 3300005518 | Ga0070699_100388053 | Ga0070699_1003880532 | 257 |
| 104 | 3300005530 | Ga0070679_100005622 | Ga0070679_1000056224 | 257 |
| 105 | 3300005530 | Ga0070679_100255469 | Ga0070679_1002554692 | 257 |
| 106 | 3300005535 | Ga0070684_100023397 | Ga0070684_1000233975 | 257 |
| 107 | 3300005536 | Ga0070697_100001688 | Ga0070697_10000168820 | 257 |
| 108 | 3300005536 | Ga0070697_100003552 | Ga0070697_1000035527 | 257 |
| 109 | 3300005536 | Ga0070697_100004819 | Ga0070697_10000481912 | 257 |
| 110 | 3300005536 | Ga0070697_100018024 | Ga0070697_1000180246 | 257 |
| 111 | 3300005536 | Ga0070697_100069620 | Ga0070697_1000696204 | 257 |
| 112 | 3300005536 | Ga0070697_100096985 | Ga0070697_1000969852 | 257 |
| 113 | 3300005536 | Ga0070697_100411272 | Ga0070697_1004112722 | 257 |
| 114 | 3300005539 | Ga0068853_100000637 | Ga0068853_10000063719 | 257 |
| 115 | 3300005543 | Ga0070672_100148379 | Ga0070672_1001483793 | 257 |
| 116 | 3300005544 | Ga0070686_100043725 | Ga0070686_1000437252 | 257 |
| 117 | 3300005545 | Ga0070695_100002800 | Ga0070695_1000028008 | 257 |
| 118 | 3300005545 | Ga0070695_100003216 | Ga0070695_10000321610 | 257 |
| 119 | 3300005545 | Ga0070695_100006214 | Ga0070695_1000062144 | 257 |
| 120 | 3300005545 | Ga0070695_100011346 | Ga0070695_1000113465 | 257 |
| 121 | 3300005545 | Ga0070695_100101955 | Ga0070695_1001019553 | 257 |
| 122 | 3300005545 | Ga0070695_100186614 | Ga0070695_1001866142 | 257 |
| 123 | 3300005545 | Ga0070695_100254997 | Ga0070695_1002549971 | 257 |
| 124 | 3300005545 | Ga0070695_100369913 | Ga0070695_1003699132 | 257 |
| 125 | 3300005546 | Ga0070696_100004086 | Ga0070696_1000040862 | 257 |
| 126 | 3300005546 | Ga0070696_100007298 | Ga0070696_1000072984 | 257 |
| 127 | 3300005546 | Ga0070696_100182700 | Ga0070696_1001827002 | 257 |
| 128 | 3300005546 | Ga0070696_100183129 | Ga0070696_1001831292 | 257 |
| 129 | 3300005546 | Ga0070696_100288061 | Ga0070696_1002880612 | 257 |
| 130 | 3300005546 | Ga0070696_100594406 | Ga0070696_1005944061 | 257 |
| 131 | 3300005547 | Ga0070693_100000097 | Ga0070693_1000000975 | 257 |
| 132 | 3300005549 | Ga0070704_100001786 | Ga0070704_10000178611 | 257 |
| 133 | 3300005549 | Ga0070704_100049550 | Ga0070704_1000495504 | 257 |
| 134 | 3300005549 | Ga0070704_100070456 | Ga0070704_1000704561 | 257 |
| 135 | 3300005549 | Ga0070704_100188220 | Ga0070704_1001882202 | 257 |
| 136 | 3300005549 | Ga0070704_100354285 | Ga0070704_1003542852 | 257 |
| 137 | 3300005563 | Ga0068855_100000362 | Ga0068855_10000036221 | 257 |
| 138 | 3300005577 | Ga0068857_100004826 | Ga0068857_1000048264 | 257 |
| 139 | 3300005577 | Ga0068857_100128089 | Ga0068857_1001280893 | 257 |
| 140 | 3300005577 | Ga0068857_100144389 | Ga0068857_1001443893 | 257 |
| 141 | 3300005577 | Ga0068857_100223363 | Ga0068857_1002233632 | 257 |
| 142 | 3300005578 | Ga0068854_100000762 | Ga0068854_10000076220 | 257 |
| 143 | 3300005578 | Ga0068854_100170710 | Ga0068854_1001707103 | 257 |
| 144 | 3300005578 | Ga0068854_100220617 | Ga0068854_1002206172 | 257 |
| 145 | 3300005615 | Ga0070702_100001731 | Ga0070702_1000017315 | 257 |
| 146 | 3300005615 | Ga0070702_100184973 | Ga0070702_1001849732 | 257 |
| 147 | 3300005616 | Ga0068852_100277289 | Ga0068852_1002772892 | 257 |
| 148 | 3300005617 | Ga0068859_100000348 | Ga0068859_10000034840 | 257 |
| 149 | 3300005617 | Ga0068859_100052363 | Ga0068859_1000523634 | 257 |
| 150 | 3300005617 | Ga0068859_100504862 | Ga0068859_1005048622 | 257 |
| 151 | 3300005718 | Ga0068866_10032193 | Ga0068866_100321934 | 257 |
| 152 | 3300005719 | Ga0068861_100010479 | Ga0068861_1000104796 | 257 |
| 153 | 3300005840 | Ga0068870_10000443 | Ga0068870_100004433 | 257 |
| 154 | 3300005840 | Ga0068870_10005194 | Ga0068870_100051946 | 257 |
| 155 | 3300005841 | Ga0068863_100010811 | Ga0068863_1000108116 | 257 |
| 156 | 3300005841 | Ga0068863_100178034 | Ga0068863_1001780343 | 257 |
| 157 | 3300005842 | Ga0068858_100021860 | Ga0068858_1000218603 | 257 |
| 158 | 3300005843 | Ga0068860_100004134 | Ga0068860_1000041348 | 257 |
| 159 | 3300005843 | Ga0068860_100008783 | Ga0068860_1000087838 | 257 |
| 160 | 3300005843 | Ga0068860_100167050 | Ga0068860_1001670502 | 257 |
| 161 | 3300005843 | Ga0068860_100595111 | Ga0068860_1005951111 | 257 |
| 162 | 3300005844 | Ga0068862_100003329 | Ga0068862_10000332912 | 257 |
| 163 | 3300005844 | Ga0068862_100130474 | Ga0068862_1001304742 | 257 |
| 164 | 3300005844 | Ga0068862_100212158 | Ga0068862_1002121582 | 257 |
| 165 | 3300005844 | Ga0068862_100320213 | Ga0068862_1003202132 | 257 |
| 166 | 3300005844 | Ga0068862_100603583 | Ga0068862_1006035832 | 257 |
| 167 | 3300005844 | Ga0068862_100743257 | Ga0068862_1007432572 | 257 |
| 168 | 3300005937 | Ga0081455_10000499 | Ga0081455_1000049951 | 257 |
| 169 | 3300005937 | Ga0081455_10320932 | Ga0081455_103209322 | 257 |
| 170 | 3300005981 | Ga0081538_10176870 | Ga0081538_101768701 | 257 |
| 171 | 3300005985 | Ga0081539_10000002 | Ga0081539_1000000248 | 257 |
| 172 | 3300006175 | Ga0070712_100003614 | Ga0070712_1000036148 | 257 |
| 173 | 3300006358 | Ga0068871_100342696 | Ga0068871_1003426961 | 257 |
| 174 | 3300006844 | Ga0075428_100000032 | Ga0075428_100000032121 | 257 |
| 175 | 3300006844 | Ga0075428_100000837 | Ga0075428_10000083725 | 257 |
| 176 | 3300006844 | Ga0075428_100004443 | Ga0075428_10000444312 | 257 |
| 177 | 3300006844 | Ga0075428_100050842 | Ga0075428_1000508427 | 257 |
| 178 | 3300006844 | Ga0075428_100126209 | Ga0075428_1001262094 | 257 |
| 179 | 3300006846 | Ga0075430_100000002 | Ga0075430_100000002107 | 257 |
| 180 | 3300006846 | Ga0075430_100000030 | Ga0075430_10000003078 | 257 |
| 181 | 3300006846 | Ga0075430_100014005 | Ga0075430_1000140053 | 257 |
| 182 | 3300006846 | Ga0075430_100135124 | Ga0075430_1001351242 | 257 |
| 183 | 3300006847 | Ga0075431_100000009 | Ga0075431_10000000982 | 257 |
| 184 | 3300006847 | Ga0075431_100000013 | Ga0075431_10000001321 | 257 |
| 185 | 3300006847 | Ga0075431_100001893 | Ga0075431_10000189317 | 257 |
| 186 | 3300006847 | Ga0075431_100003218 | Ga0075431_10000321813 | 257 |
| 187 | 3300006847 | Ga0075431_100004225 | Ga0075431_1000042255 | 257 |
| 188 | 3300006847 | Ga0075431_100005455 | Ga0075431_10000545512 | 257 |
| 189 | 3300006847 | Ga0075431_100018582 | Ga0075431_1000185827 | 257 |
| 190 | 3300006847 | Ga0075431_100022755 | Ga0075431_1000227559 | 257 |
| 191 | 3300006847 | Ga0075431_100027671 | Ga0075431_1000276712 | 257 |
| 192 | 3300006847 | Ga0075431_100175333 | Ga0075431_1001753333 | 257 |
| 193 | 3300006847 | Ga0075431_100182461 | Ga0075431_1001824613 | 257 |
| 194 | 3300006847 | Ga0075431_100330305 | Ga0075431_1003303052 | 257 |
| 195 | 3300006852 | Ga0075433_10000017 | Ga0075433_100000174 | 257 |
| 196 | 3300006852 | Ga0075433_10000121 | Ga0075433_1000012135 | 257 |
| 197 | 3300006852 | Ga0075433_10080101 | Ga0075433_100801013 | 257 |
| 198 | 3300006852 | Ga0075433_10082823 | Ga0075433_100828232 | 257 |
| 199 | 3300006852 | Ga0075433_10083173 | Ga0075433_100831734 | 257 |
| 200 | 3300006852 | Ga0075433_10102909 | Ga0075433_101029094 | 257 |
| 201 | 3300006852 | Ga0075433_10120121 | Ga0075433_101201212 | 257 |
| 202 | 3300006852 | Ga0075433_10216856 | Ga0075433_102168562 | 257 |
| 203 | 3300006852 | Ga0075433_10261963 | Ga0075433_102619632 | 257 |
| 204 | 3300006871 | Ga0075434_100001334 | Ga0075434_10000133417 | 257 |
| 205 | 3300006871 | Ga0075434_100013675 | Ga0075434_1000136751 | 257 |
| 206 | 3300006871 | Ga0075434_100021778 | Ga0075434_1000217786 | 257 |
| 207 | 3300006871 | Ga0075434_100036779 | Ga0075434_1000367797 | 257 |
| 208 | 3300006871 | Ga0075434_100049904 | Ga0075434_1000499042 | 257 |
| 209 | 3300006871 | Ga0075434_100065440 | Ga0075434_1000654404 | 257 |
| 210 | 3300006871 | Ga0075434_100096516 | Ga0075434_1000965163 | 257 |
| 211 | 3300006871 | Ga0075434_100142711 | Ga0075434_1001427114 | 257 |
| 212 | 3300006871 | Ga0075434_100283348 | Ga0075434_1002833482 | 257 |
| 213 | 3300006871 | Ga0075434_100823434 | Ga0075434_1008234342 | 257 |
| 214 | 3300006880 | Ga0075429_100000006 | Ga0075429_10000000617 | 257 |
| 215 | 3300006880 | Ga0075429_100001526 | Ga0075429_10000152612 | 257 |
| 216 | 3300006880 | Ga0075429_100007453 | Ga0075429_10000745311 | 257 |
| 217 | 3300006880 | Ga0075429_100007721 | Ga0075429_1000077219 | 257 |
| 218 | 3300006880 | Ga0075429_100009193 | Ga0075429_1000091939 | 257 |
| 219 | 3300006880 | Ga0075429_100010942 | Ga0075429_1000109425 | 257 |
| 220 | 3300006880 | Ga0075429_100196690 | Ga0075429_1001966903 | 257 |
| 221 | 3300006880 | Ga0075429_100327380 | Ga0075429_1003273801 | 257 |
| 222 | 3300006881 | Ga0068865_100282995 | Ga0068865_1002829951 | 257 |
| 223 | 3300006914 | Ga0075436_100005968 | Ga0075436_1000059682 | 257 |
| 224 | 3300006914 | Ga0075436_100052367 | Ga0075436_1000523674 | 257 |
| 225 | 3300006914 | Ga0075436_100157523 | Ga0075436_1001575231 | 257 |
| 226 | 3300006914 | Ga0075436_100170575 | Ga0075436_1001705752 | 257 |
| 227 | 3300006914 | Ga0075436_100292802 | Ga0075436_1002928022 | 257 |
| 228 | 3300006931 | Ga0097620_100000348 | Ga0097620_10000034840 | 257 |
| 229 | 3300006931 | Ga0097620_100052361 | Ga0097620_1000523613 | 257 |
| 230 | 3300006931 | Ga0097620_100504860 | Ga0097620_1005048602 | 257 |
| 231 | 3300007076 | Ga0075435_100002475 | Ga0075435_10000247513 | 257 |
| 232 | 3300007076 | Ga0075435_100004315 | Ga0075435_1000043157 | 257 |
| 233 | 3300007076 | Ga0075435_100021302 | Ga0075435_1000213024 | 257 |
| 234 | 3300007076 | Ga0075435_100032600 | Ga0075435_1000326004 | 257 |
| 235 | 3300007076 | Ga0075435_100611377 | Ga0075435_1006113771 | 257 |
| 236 | 3300007265 | Ga0099794_10003767 | Ga0099794_100037672 | 257 |
| 237 | 3300007265 | Ga0099794_10005009 | Ga0099794_100050095 | 257 |
| 238 | 3300007265 | Ga0099794_10034390 | Ga0099794_100343902 | 257 |
| 239 | 3300009094 | Ga0111539_10006297 | Ga0111539_1000629715 | 257 |
| 240 | 3300009094 | Ga0111539_10028818 | Ga0111539_100288186 | 257 |
| 241 | 3300009094 | Ga0111539_10321074 | Ga0111539_103210742 | 257 |
| 242 | 3300009098 | Ga0105245_10784931 | Ga0105245_107849311 | 257 |
| 243 | 3300009101 | Ga0105247_10163505 | Ga0105247_101635052 | 257 |
| 244 | 3300009147 | Ga0114129_10000053 | Ga0114129_1000005343 | 257 |
| 245 | 3300009147 | Ga0114129_10000182 | Ga0114129_1000018225 | 257 |
| 246 | 3300009147 | Ga0114129_10000454 | Ga0114129_1000045431 | 257 |
| 247 | 3300009147 | Ga0114129_10004798 | Ga0114129_1000479818 | 257 |
| 248 | 3300009147 | Ga0114129_10005559 | Ga0114129_1000555916 | 257 |
| 249 | 3300009147 | Ga0114129_10011655 | Ga0114129_100116557 | 257 |
| 250 | 3300009147 | Ga0114129_10036137 | Ga0114129_100361379 | 257 |
| 251 | 3300009147 | Ga0114129_10055460 | Ga0114129_100554606 | 257 |
| 252 | 3300009147 | Ga0114129_10056921 | Ga0114129_100569213 | 257 |
| 253 | 3300009147 | Ga0114129_10073458 | Ga0114129_100734586 | 257 |
| 254 | 3300009147 | Ga0114129_10084238 | Ga0114129_100842383 | 257 |
| 255 | 3300009147 | Ga0114129_10097091 | Ga0114129_100970915 | 257 |
| 256 | 3300009147 | Ga0114129_10156876 | Ga0114129_101568761 | 257 |
| 257 | 3300009147 | Ga0114129_10301204 | Ga0114129_103012042 | 257 |
| 258 | 3300009147 | Ga0114129_10380014 | Ga0114129_103800143 | 257 |
| 259 | 3300009147 | Ga0114129_10428723 | Ga0114129_104287232 | 257 |
| 260 | 3300009147 | Ga0114129_10887056 | Ga0114129_108870562 | 257 |
| 261 | 3300009147 | Ga0114129_10947783 | Ga0114129_109477831 | 257 |
| 262 | 3300009148 | Ga0105243_10055485 | Ga0105243_100554852 | 257 |
| 263 | 3300009148 | Ga0105243_10094370 | Ga0105243_100943702 | 257 |
| 264 | 3300009148 | Ga0105243_10157637 | Ga0105243_101576372 | 257 |
| 265 | 3300009174 | Ga0105241_10031744 | Ga0105241_100317443 | 257 |
| 266 | 3300009174 | Ga0105241_10081797 | Ga0105241_100817972 | 257 |
| 267 | 3300009176 | Ga0105242_10092043 | Ga0105242_100920434 | 257 |
| 268 | 3300009176 | Ga0105242_10214481 | Ga0105242_102144812 | 257 |
| 269 | 3300009177 | Ga0105248_10067618 | Ga0105248_100676184 | 257 |
| 270 | 3300009177 | Ga0105248_10317192 | Ga0105248_103171922 | 257 |
| 271 | 3300009553 | Ga0105249_10044073 | Ga0105249_100440734 | 257 |
| 272 | 3300009553 | Ga0105249_10064946 | Ga0105249_100649463 | 257 |
| 273 | 3300011119 | Ga0105246_10737164 | Ga0105246_107371641 | 257 |
| 274 | 3300013100 | Ga0157373_10000316 | Ga0157373_100003164 | 257 |
| 275 | 3300013102 | Ga0157371_10075398 | Ga0157371_100753982 | 257 |
| 276 | 3300013105 | Ga0157369_10008219 | Ga0157369_1000821911 | 257 |
| 277 | 3300013297 | Ga0157378_10168322 | Ga0157378_101683223 | 257 |
| 278 | 3300013306 | Ga0163162_10006161 | Ga0163162_100061617 | 257 |
| 279 | 3300013306 | Ga0163162_10614278 | Ga0163162_106142781 | 257 |
| 280 | 3300013307 | Ga0157372_10000280 | Ga0157372_1000028021 | 257 |
| 281 | 3300013307 | Ga0157372_10094378 | Ga0157372_100943784 | 257 |
| 282 | 3300013308 | Ga0157375_10439497 | Ga0157375_104394972 | 257 |
| 283 | 3300014326 | Ga0157380_10024963 | Ga0157380_100249634 | 257 |
| 284 | 3300017792 | Ga0163161_10285016 | Ga0163161_102850162 | 257 |
| 285 | 3300025885 | Ga0207653_10003277 | Ga0207653_100032776 | 257 |
| 286 | 3300025885 | Ga0207653_10006684 | Ga0207653_100066843 | 257 |
| 287 | 3300025885 | Ga0207653_10119934 | Ga0207653_101199341 | 257 |
| 288 | 3300025899 | Ga0207642_10070914 | Ga0207642_100709141 | 257 |
| 289 | 3300025901 | Ga0207688_10008008 | Ga0207688_100080084 | 257 |
| 290 | 3300025904 | Ga0207647_10019631 | Ga0207647_100196316 | 257 |
| 291 | 3300025907 | Ga0207645_10001727 | Ga0207645_1000172710 | 257 |
| 292 | 3300025908 | Ga0207643_10001135 | Ga0207643_1000113516 | 257 |
| 293 | 3300025908 | Ga0207643_10021877 | Ga0207643_100218774 | 257 |
| 294 | 3300025910 | Ga0207684_10001398 | Ga0207684_1000139812 | 257 |
| 295 | 3300025910 | Ga0207684_10003869 | Ga0207684_100038696 | 257 |
| 296 | 3300025910 | Ga0207684_10015250 | Ga0207684_100152505 | 257 |
| 297 | 3300025910 | Ga0207684_10037779 | Ga0207684_100377794 | 257 |
| 298 | 3300025910 | Ga0207684_10063626 | Ga0207684_100636262 | 257 |
| 299 | 3300025910 | Ga0207684_10183616 | Ga0207684_101836162 | 257 |
| 300 | 3300025910 | Ga0207684_10195228 | Ga0207684_101952282 | 257 |
| 301 | 3300025910 | Ga0207684_10335781 | Ga0207684_103357812 | 257 |
| 302 | 3300025910 | Ga0207684_10445655 | Ga0207684_104456552 | 257 |
| 303 | 3300025911 | Ga0207654_10001729 | Ga0207654_100017299 | 257 |
| 304 | 3300025911 | Ga0207654_10099656 | Ga0207654_100996563 | 257 |
| 305 | 3300025912 | Ga0207707_10000034 | Ga0207707_1000003465 | 257 |
| 306 | 3300025914 | Ga0207671_10063819 | Ga0207671_100638192 | 257 |
| 307 | 3300025915 | Ga0207693_10006771 | Ga0207693_100067716 | 257 |
| 308 | 3300025915 | Ga0207693_10078261 | Ga0207693_100782612 | 257 |
| 309 | 3300025916 | Ga0207663_10186000 | Ga0207663_101860002 | 257 |
| 310 | 3300025917 | Ga0207660_10000382 | Ga0207660_1000038223 | 257 |
| 311 | 3300025917 | Ga0207660_10056472 | Ga0207660_100564723 | 257 |
| 312 | 3300025917 | Ga0207660_10546421 | Ga0207660_105464212 | 257 |
| 313 | 3300025918 | Ga0207662_10121548 | Ga0207662_101215482 | 257 |
| 314 | 3300025919 | Ga0207657_10002825 | Ga0207657_100028252 | 257 |
| 315 | 3300025920 | Ga0207649_10002273 | Ga0207649_1000227313 | 257 |
| 316 | 3300025921 | Ga0207652_10000430 | Ga0207652_1000043010 | 257 |
| 317 | 3300025921 | Ga0207652_10200712 | Ga0207652_102007122 | 257 |
| 318 | 3300025922 | Ga0207646_10001023 | Ga0207646_1000102331 | 257 |
| 319 | 3300025922 | Ga0207646_10007724 | Ga0207646_1000772412 | 257 |
| 320 | 3300025922 | Ga0207646_10016616 | Ga0207646_100166163 | 257 |
| 321 | 3300025922 | Ga0207646_10020663 | Ga0207646_100206638 | 257 |
| 322 | 3300025922 | Ga0207646_10045011 | Ga0207646_100450114 | 257 |
| 323 | 3300025922 | Ga0207646_10103231 | Ga0207646_101032311 | 257 |
| 324 | 3300025922 | Ga0207646_10290742 | Ga0207646_102907421 | 257 |
| 325 | 3300025922 | Ga0207646_10317309 | Ga0207646_103173092 | 257 |
| 326 | 3300025922 | Ga0207646_10341083 | Ga0207646_103410832 | 257 |
| 327 | 3300025922 | Ga0207646_10514047 | Ga0207646_105140471 | 257 |
| 328 | 3300025922 | Ga0207646_10657066 | Ga0207646_106570661 | 257 |
| 329 | 3300025925 | Ga0207650_10002719 | Ga0207650_1000271913 | 257 |
| 330 | 3300025926 | Ga0207659_10660870 | Ga0207659_106608701 | 257 |
| 331 | 3300025932 | Ga0207690_10003117 | Ga0207690_100031174 | 257 |
| 332 | 3300025933 | Ga0207706_10077976 | Ga0207706_100779764 | 257 |
| 333 | 3300025933 | Ga0207706_10136232 | Ga0207706_101362322 | 257 |
| 334 | 3300025934 | Ga0207686_10278618 | Ga0207686_102786182 | 257 |
| 335 | 3300025935 | Ga0207709_10043293 | Ga0207709_100432933 | 257 |
| 336 | 3300025935 | Ga0207709_10057711 | Ga0207709_100577112 | 257 |
| 337 | 3300025935 | Ga0207709_10135297 | Ga0207709_101352971 | 257 |
| 338 | 3300025936 | Ga0207670_10047938 | Ga0207670_100479384 | 257 |
| 339 | 3300025938 | Ga0207704_10346380 | Ga0207704_103463801 | 257 |
| 340 | 3300025939 | Ga0207665_10020047 | Ga0207665_100200472 | 257 |
| 341 | 3300025940 | Ga0207691_10070576 | Ga0207691_100705762 | 257 |
| 342 | 3300025941 | Ga0207711_10106718 | Ga0207711_101067184 | 257 |
| 343 | 3300025941 | Ga0207711_10566277 | Ga0207711_105662772 | 257 |
| 344 | 3300025942 | Ga0207689_10000153 | Ga0207689_1000015346 | 257 |
| 345 | 3300025942 | Ga0207689_10017750 | Ga0207689_100177502 | 257 |
| 346 | 3300025942 | Ga0207689_10081732 | Ga0207689_100817322 | 257 |
| 347 | 3300025942 | Ga0207689_10156706 | Ga0207689_101567063 | 257 |
| 348 | 3300025944 | Ga0207661_10063648 | Ga0207661_100636484 | 257 |
| 349 | 3300025945 | Ga0207679_10002005 | Ga0207679_1000200511 | 257 |
| 350 | 3300025949 | Ga0207667_10000308 | Ga0207667_100003085 | 257 |
| 351 | 3300025960 | Ga0207651_10037435 | Ga0207651_100374354 | 257 |
| 352 | 3300025961 | Ga0207712_10003979 | Ga0207712_100039797 | 257 |
| 353 | 3300025961 | Ga0207712_10035886 | Ga0207712_100358863 | 257 |
| 354 | 3300025961 | Ga0207712_10197381 | Ga0207712_101973812 | 257 |
| 355 | 3300025981 | Ga0207640_10003433 | Ga0207640_100034336 | 257 |
| 356 | 3300025986 | Ga0207658_10319709 | Ga0207658_103197092 | 257 |
| 357 | 3300026023 | Ga0207677_10053492 | Ga0207677_100534922 | 257 |
| 358 | 3300026023 | Ga0207677_10503537 | Ga0207677_105035371 | 257 |
| 359 | 3300026035 | Ga0207703_10006298 | Ga0207703_100062983 | 257 |
| 360 | 3300026035 | Ga0207703_10203758 | Ga0207703_102037581 | 257 |
| 361 | 3300026041 | Ga0207639_10000976 | Ga0207639_1000097614 | 257 |
| 362 | 3300026075 | Ga0207708_10104728 | Ga0207708_101047282 | 257 |
| 363 | 3300026078 | Ga0207702_10000652 | Ga0207702_1000065216 | 257 |
| 364 | 3300026088 | Ga0207641_10025025 | Ga0207641_100250253 | 257 |
| 365 | 3300026088 | Ga0207641_10154821 | Ga0207641_101548212 | 257 |
| 366 | 3300026089 | Ga0207648_10000169 | Ga0207648_1000016927 | 257 |
| 367 | 3300026089 | Ga0207648_10115205 | Ga0207648_101152051 | 257 |
| 368 | 3300026095 | Ga0207676_10033771 | Ga0207676_100337714 | 257 |
| 369 | 3300026095 | Ga0207676_10530760 | Ga0207676_105307602 | 257 |
| 370 | 3300026116 | Ga0207674_10000050 | Ga0207674_1000005020 | 257 |
| 371 | 3300026116 | Ga0207674_10071805 | Ga0207674_100718054 | 257 |
| 372 | 3300026116 | Ga0207674_10175770 | Ga0207674_101757703 | 257 |
| 373 | 3300026118 | Ga0207675_100011174 | Ga0207675_1000111748 | 257 |
| 374 | 3300026118 | Ga0207675_100104588 | Ga0207675_1001045882 | 257 |
| 375 | 3300026118 | Ga0207675_100128949 | Ga0207675_1001289493 | 257 |
| 376 | 3300026142 | Ga0207698_10214271 | Ga0207698_102142712 | 257 |
| 377 | 3300027462 | Ga0210000_1006161 | Ga0210000_10061613 | 257 |
| 378 | 3300027471 | Ga0209995_1000557 | Ga0209995_10005577 | 257 |
| 379 | 3300027526 | Ga0209968_1003187 | Ga0209968_10031872 | 257 |
| 380 | 3300027543 | Ga0209999_1003564 | Ga0209999_10035643 | 257 |
| 381 | 3300027614 | Ga0209970_1001167 | Ga0209970_10011673 | 257 |
| 382 | 3300027665 | Ga0209983_1001441 | Ga0209983_10014415 | 257 |
| 383 | 3300027671 | Ga0209588_1049838 | Ga0209588_10498382 | 257 |
| 384 | 3300027682 | Ga0209971_1000103 | Ga0209971_100010322 | 257 |
| 385 | 3300027682 | Ga0209971_1017624 | Ga0209971_10176242 | 257 |
| 386 | 3300027695 | Ga0209966_1000042 | Ga0209966_100004228 | 257 |
| 387 | 3300027717 | Ga0209998_10000127 | Ga0209998_1000012722 | 257 |
| 388 | 3300027876 | Ga0209974_10000436 | Ga0209974_1000043610 | 257 |
| 389 | 3300027907 | Ga0207428_10007442 | Ga0207428_1000744210 | 257 |
| 390 | 3300028380 | Ga0268265_10003808 | Ga0268265_100038082 | 257 |
| 391 | 3300028380 | Ga0268265_10007220 | Ga0268265_100072202 | 257 |
| 392 | 3300028380 | Ga0268265_10011871 | Ga0268265_100118715 | 257 |
| 393 | 3300028380 | Ga0268265_10424943 | Ga0268265_104249431 | 257 |
| 394 | 3300028381 | Ga0268264_10008214 | Ga0268264_100082148 | 257 |
| 395 | 3300028381 | Ga0268264_10074280 | Ga0268264_100742803 | 257 |
| 396 | 3300028381 | Ga0268264_10519338 | Ga0268264_105193382 | 257 |
| 397 | 3300031548 | Ga0307408_100085026 | Ga0307408_1000850262 | 257 |
| 398 | 3300031824 | Ga0307413_10354035 | Ga0307413_103540352 | 257 |
| 399 | 3300031903 | Ga0307407_10020838 | Ga0307407_100208383 | 257 |
| 400 | 3300031911 | Ga0307412_10367363 | Ga0307412_103673632 | 257 |
| 401 | 3300031995 | Ga0307409_100006456 | Ga0307409_1000064562 | 257 |
| 402 | 3300031995 | Ga0307409_100369120 | Ga0307409_1003691202 | 257 |
| 403 | 3300032002 | Ga0307416_100015112 | Ga0307416_1000151127 | 257 |
| 404 | 3300032002 | Ga0307416_100322510 | Ga0307416_1003225102 | 257 |
| 405 | 3300032002 | Ga0307416_100509513 | Ga0307416_1005095132 | 257 |
| 406 | 3300032005 | Ga0307411_10232251 | Ga0307411_102322512 | 257 |
| 407 | 3300034817 | Ga0373948_0008669 | Ga0373948_0008669_823_1596 | 257 |
| 408 | 3300034820 | Ga0373959_0010524 | Ga0373959_0010524_611_1384 | 257 |
| 409 | 3300035090 | Ga0373949_0005449 | Ga0373949_0005449_1263_2036 | 257 |
| 410 | 3300035091 | Ga0373951_0041814 | Ga0373951_0041814_254_1027 | 257 |
| 411 | 3300035092 | Ga0373952_0012965 | Ga0373952_0012965_224_997 | 257 |
| 412 | 3300035112 | Ga0373932_0069502 | Ga0373932_0069502_40_813 | 257 |
| 413 | 3300035121 | Ga0373960_0006606 | Ga0373960_0006606_1066_1839 | 257 |
| 414 | 3300035121 | Ga0373960_0062503 | Ga0373960_0062503_332_1105 | 257 |
| 415 | 3300035241 | Ga0373961_0002388 | Ga0373961_0002388_2180_2953 | 257 |
| 416 | 3300035242 | Ga0373962_0014767 | Ga0373962_0014767_863_1636 | 257 |
| 417 | 3300035691 | Ga0373931_0016937 | Ga0373931_0016937_1202_1975 | 257 |
| 418 | 3300035691 | Ga0373931_0092001 | Ga0373931_0092001_159_932 | 257 |
| 419 | 3300037312 | Ga0395899_0120663 | Ga0395899_0120663_264_1037 | 257 |
| 420 | 3300037418 | Ga0395900_0002528 | Ga0395900_0002528_18500_19273 | 257 |
| 421 | 3300037418 | Ga0395900_0639401 | Ga0395900_0639401_83_856 | 257 |
| 422 | 3300037466 | Ga0395898_0035517 | Ga0395898_0035517_2768_3541 | 257 |
| 423 | 3300037466 | Ga0395898_0350806 | Ga0395898_0350806_407_1180 | 257 |
| 424 | 3300038443 | Ga0395901_0002359 | Ga0395901_0002359_685_1458 | 257 |
| 425 | 3300038443 | Ga0395901_0072757 | Ga0395901_0072757_1606_2379 | 257 |
| 426 | 3300042005 | Ga0439448_0001261 | Ga0439448_0001261_2072_2845 | 257 |
| 427 | 3300042005 | Ga0439448_0011765 | Ga0439448_0011765_457_1230 | 257 |
| 428 | 3300042008 | Ga0439450_014672 | Ga0439450_014672_43_816 | 257 |
| 429 | 3300042012 | Ga0439455_0051182 | Ga0439455_0051182_218_991 | 257 |
| 430 | 3300042012 | Ga0439455_0094369 | Ga0439455_0094369_12_785 | 257 |
| 431 | 3300042016 | Ga0439463_055355 | Ga0439463_055355_160_933 | 257 |
| 432 | 3300042157 | Ga0439458_0023619 | Ga0439458_0023619_548_1321 | 257 |
| 433 | 3300042439 | Ga0439464_0003655 | Ga0439464_0003655_1230_2003 | 257 |
| 434 | 3300042461 | Ga0439460_0013223 | Ga0439460_0013223_499_1272 | 257 |
| 435 | 3300042876 | Ga0451577_0033485 | Ga0451577_0033485_3522_4295 | 257 |
| 436 | 3300042876 | Ga0451577_0053264 | Ga0451577_0053264_2388_3161 | 257 |
| 437 | 3300042876 | Ga0451577_0084240 | Ga0451577_0084240_1953_2726 | 257 |
| 438 | 3300042876 | Ga0451577_0090550 | Ga0451577_0090550_1241_2014 | 257 |
| 439 | 3300042876 | Ga0451577_0136954 | Ga0451577_0136954_1174_1947 | 257 |
| 440 | 3300042876 | Ga0451577_0357353 | Ga0451577_0357353_171_944 | 257 |
| 441 | 3300042876 | Ga0451577_0463517 | Ga0451577_0463517_70_843 | 257 |
| 442 | 3300044673 | Ga0453683_0012871 | Ga0453683_0012871_2975_3748 | 257 |
| 443 | 3300044673 | Ga0453683_0033634 | Ga0453683_0033634_2441_3214 | 257 |
| 444 | 3300044673 | Ga0453683_0270505 | Ga0453683_0270505_147_920 | 257 |
| 445 | 3300044673 | Ga0453683_0348222 | Ga0453683_0348222_94_867 | 257 |
| 446 | 3300044673 | Ga0453683_0387675 | Ga0453683_0387675_17_790 | 257 |
| 447 | 3300044712 | Ga0453684_0059192 | Ga0453684_0059192_38_811 | 257 |
| 448 | 3300044712 | Ga0453684_0105532 | Ga0453684_0105532_802_1575 | 257 |
| 449 | 3300044712 | Ga0453684_0675488 | Ga0453684_0675488_30_803 | 257 |
| 450 | 3300045051 | Ga0451576_0003436 | Ga0451576_0003436_14697_15470 | 257 |
| 451 | 3300045051 | Ga0451576_0041817 | Ga0451576_0041817_2699_3472 | 257 |
| 452 | 3300045051 | Ga0451576_0075462 | Ga0451576_0075462_2434_3207 | 257 |
| 453 | 3300045051 | Ga0451576_0090083 | Ga0451576_0090083_1271_2044 | 257 |
| 454 | 3300045051 | Ga0451576_0100041 | Ga0451576_0100041_1540_2313 | 257 |
| 455 | 3300045051 | Ga0451576_0417426 | Ga0451576_0417426_21_794 | 257 |
| 456 | 3300045051 | Ga0451576_0474738 | Ga0451576_0474738_337_1110 | 257 |
| 457 | 3300045051 | Ga0451576_0733171 | Ga0451576_0733171_24_797 | 257 |
| 458 | 3300046472 | Ga0495580_0001279 | Ga0495580_0001279_13345_14118 | 257 |
| 459 | 3300046472 | Ga0495580_0059569 | Ga0495580_0059569_1115_1888 | 257 |
| 460 | 3300046491 | Ga0495584_0044378 | Ga0495584_0044378_1250_2023 | 257 |
| 461 | 3300046684 | Ga0495669_0029212 | Ga0495669_0029212_308_1081 | 257 |
| 462 | 3300047318 | Ga0495636_0152070 | Ga0495636_0152070_170_943 | 257 |
| 463 | 3300048903 | Ga0496100_0128796 | Ga0496100_0128796_187_960 | 257 |
| 464 | 3300048905 | Ga0496102_0023647 | Ga0496102_0023647_849_1622 | 257 |
| 465 | 3300048905 | Ga0496102_0034628 | Ga0496102_0034628_711_1484 | 257 |
| 466 | 3300048909 | Ga0496106_0050838 | Ga0496106_0050838_1475_2248 | 257 |
| 467 | 3300048909 | Ga0496106_0243680 | Ga0496106_0243680_91_864 | 257 |
| 468 | 3300048912 | Ga0496109_0307166 | Ga0496109_0307166_305_1078 | 257 |
| 469 | 3300048913 | Ga0496110_0315927 | Ga0496110_0315927_541_1314 | 257 |
| 470 | 3300048915 | Ga0496112_0038924 | Ga0496112_0038924_3529_4302 | 257 |
| 471 | 3300048916 | Ga0496113_0097028 | Ga0496113_0097028_890_1663 | 257 |
| 472 | 3300049570 | Ga0501033_0040153 | Ga0501033_0040153_10_783 | 257 |
| 473 | 3300049570 | Ga0501033_0423216 | Ga0501033_0423216_12_785 | 257 |
| 474 | 3300049572 | Ga0501036_0284355 | Ga0501036_0284355_88_861 | 257 |
| 475 | 3300049572 | Ga0501036_0403086 | Ga0501036_0403086_315_1088 | 257 |
| 476 | 3300049573 | Ga0501037_0123863 | Ga0501037_0123863_746_1519 | 257 |
| 477 | 3300049574 | Ga0501038_0120984 | Ga0501038_0120984_39_812 | 257 |
| 478 | 3300049574 | Ga0501038_0133303 | Ga0501038_0133303_1100_1873 | 257 |
| 479 | 3300049575 | Ga0501039_0130183 | Ga0501039_0130183_570_1343 | 257 |
| 480 | 3300049575 | Ga0501039_0178787 | Ga0501039_0178787_144_917 | 257 |
| 481 | 3300049575 | Ga0501039_0218665 | Ga0501039_0218665_469_1242 | 257 |
| 482 | 3300049576 | Ga0501040_0001692 | Ga0501040_0001692_3150_3923 | 257 |
| 483 | 3300049576 | Ga0501040_0005881 | Ga0501040_0005881_5153_5926 | 257 |
| 484 | 3300049576 | Ga0501040_0012970 | Ga0501040_0012970_3789_4562 | 257 |
| 485 | 3300049576 | Ga0501040_0200330 | Ga0501040_0200330_72_845 | 257 |
| 486 | 3300049577 | Ga0501041_0004951 | Ga0501041_0004951_6596_7369 | 257 |
| 487 | 3300049577 | Ga0501041_0043353 | Ga0501041_0043353_1172_1945 | 257 |
| 488 | 3300049577 | Ga0501041_0320854 | Ga0501041_0320854_168_941 | 257 |
| 489 | 3300049578 | Ga0501042_0001027 | Ga0501042_0001027_7495_8268 | 257 |
| 490 | 3300049580 | Ga0501046_0000084 | Ga0501046_0000084_72438_73211 | 257 |
| 491 | 3300049580 | Ga0501046_0142686 | Ga0501046_0142686_253_1026 | 257 |
| 492 | 3300049582 | Ga0501048_0006618 | Ga0501048_0006618_5491_6264 | 257 |
| 493 | 3300049582 | Ga0501048_0133124 | Ga0501048_0133124_92_865 | 257 |
| 494 | 3300049582 | Ga0501048_0158167 | Ga0501048_0158167_187_960 | 257 |
| 495 | 3300049583 | Ga0501067_0025668 | Ga0501067_0025668_1265_2038 | 257 |
| 496 | 3300049583 | Ga0501067_0292595 | Ga0501067_0292595_83_856 | 257 |
| 497 | 3300049584 | Ga0501068_0037970 | Ga0501068_0037970_37_810 | 257 |
| 498 | 3300049584 | Ga0501068_0131366 | Ga0501068_0131366_595_1368 | 257 |
| 499 | 3300049584 | Ga0501068_0167254 | Ga0501068_0167254_288_1061 | 257 |
| 500 | 3300049585 | Ga0501069_0007030 | Ga0501069_0007030_969_1742 | 257 |
| 501 | 3300049585 | Ga0501069_0197984 | Ga0501069_0197984_257_1030 | 257 |
| 502 | 3300049587 | Ga0501071_0030163 | Ga0501071_0030163_1702_2475 | 257 |
| 503 | 3300049588 | Ga0501072_0040433 | Ga0501072_0040433_357_1130 | 257 |
| 504 | 3300049588 | Ga0501072_0112021 | Ga0501072_0112021_773_1546 | 257 |
| 505 | 3300049588 | Ga0501072_0266859 | Ga0501072_0266859_17_790 | 257 |
| 506 | 3300049588 | Ga0501072_0371239 | Ga0501072_0371239_36_809 | 257 |
| 507 | 3300049588 | Ga0501072_0519080 | Ga0501072_0519080_87_860 | 257 |
| 508 | 3300049589 | Ga0501073_0233931 | Ga0501073_0233931_229_1002 | 257 |
| 509 | 3300049589 | Ga0501073_0386499 | Ga0501073_0386499_24_797 | 257 |
| 510 | 3300049590 | Ga0501074_0004066 | Ga0501074_0004066_9620_10393 | 257 |
| 511 | 3300049590 | Ga0501074_0191215 | Ga0501074_0191215_283_1056 | 257 |
| 512 | 3300049590 | Ga0501074_0297225 | Ga0501074_0297225_93_866 | 257 |
| 513 | 3300049591 | Ga0501075_0096900 | Ga0501075_0096900_123_896 | 257 |
| 514 | 3300049591 | Ga0501075_0126192 | Ga0501075_0126192_240_1013 | 257 |
| 515 | 3300049591 | Ga0501075_0187806 | Ga0501075_0187806_621_1394 | 257 |
| 516 | 3300049591 | Ga0501075_0217779 | Ga0501075_0217779_448_1221 | 257 |
| 517 | 3300049591 | Ga0501075_0392875 | Ga0501075_0392875_144_917 | 257 |
| 518 | 3300049591 | Ga0501075_0413290 | Ga0501075_0413290_235_1008 | 257 |
| 519 | 3300049592 | Ga0501076_0003680 | Ga0501076_0003680_6912_7685 | 257 |
| 520 | 3300049592 | Ga0501076_0054077 | Ga0501076_0054077_1300_2073 | 257 |
| 521 | 3300049592 | Ga0501076_0093822 | Ga0501076_0093822_486_1259 | 257 |
| 522 | 3300049592 | Ga0501076_0096684 | Ga0501076_0096684_1179_1952 | 257 |
| 523 | 3300049592 | Ga0501076_0109213 | Ga0501076_0109213_758_1531 | 257 |
| 524 | 3300049592 | Ga0501076_0162086 | Ga0501076_0162086_395_1168 | 257 |
| 525 | 3300049592 | Ga0501076_0186499 | Ga0501076_0186499_143_916 | 257 |
| 526 | 3300049592 | Ga0501076_0207813 | Ga0501076_0207813_390_1163 | 257 |
| 527 | 3300049593 | Ga0501077_0016948 | Ga0501077_0016948_2164_2937 | 257 |
| 528 | 3300049593 | Ga0501077_0118093 | Ga0501077_0118093_840_1613 | 257 |
| 529 | 3300049593 | Ga0501077_0201160 | Ga0501077_0201160_274_1047 | 257 |
| 530 | 3300049593 | Ga0501077_0215906 | Ga0501077_0215906_372_1145 | 257 |
| 531 | 3300049593 | Ga0501077_0305462 | Ga0501077_0305462_30_803 | 257 |
| 532 | 3300049741 | Ga0501079_0000126 | Ga0501079_0000126_17248_18021 | 257 |
| 533 | 3300049741 | Ga0501079_0028751 | Ga0501079_0028751_1934_2707 | 257 |
| 534 | 3300049741 | Ga0501079_0042598 | Ga0501079_0042598_1098_1871 | 257 |
| 535 | 3300049741 | Ga0501079_0107054 | Ga0501079_0107054_1270_2043 | 257 |
| 536 | 3300049741 | Ga0501079_0137499 | Ga0501079_0137499_71_844 | 257 |
| 537 | 3300049741 | Ga0501079_0158042 | Ga0501079_0158042_793_1566 | 257 |
| 538 | 3300049741 | Ga0501079_0426215 | Ga0501079_0426215_175_948 | 257 |
| 539 | 3300049742 | Ga0501080_0028768 | Ga0501080_0028768_1358_2131 | 257 |
| 540 | 3300049742 | Ga0501080_0140161 | Ga0501080_0140161_1139_1912 | 257 |
| 541 | 3300049742 | Ga0501080_0702384 | Ga0501080_0702384_37_810 | 257 |
| 542 | 3300049743 | Ga0501081_0002938 | Ga0501081_0002938_5030_5803 | 257 |
| 543 | 3300049743 | Ga0501081_0005134 | Ga0501081_0005134_6663_7436 | 257 |
| 544 | 3300049743 | Ga0501081_0013413 | Ga0501081_0013413_517_1290 | 257 |
| 545 | 3300049743 | Ga0501081_0015599 | Ga0501081_0015599_2272_3045 | 257 |
| 546 | 3300049743 | Ga0501081_0015840 | Ga0501081_0015840_474_1247 | 257 |
| 547 | 3300049743 | Ga0501081_0068424 | Ga0501081_0068424_729_1502 | 257 |
| 548 | 3300049743 | Ga0501081_0168895 | Ga0501081_0168895_177_950 | 257 |
| 549 | 3300049743 | Ga0501081_0281478 | Ga0501081_0281478_258_1031 | 257 |
| 550 | 3300049744 | Ga0501083_0301449 | Ga0501083_0301449_180_953 | 257 |
| 551 | 3300049822 | Ga0501035_0290920 | Ga0501035_0290920_549_1322 | 257 |
| 552 | 3300049824 | Ga0501045_0000701 | Ga0501045_0000701_8842_9615 | 257 |
| 553 | 3300049824 | Ga0501045_0068944 | Ga0501045_0068944_809_1582 | 257 |
| 554 | 3300049824 | Ga0501045_0074466 | Ga0501045_0074466_577_1350 | 257 |
| 555 | 3300049824 | Ga0501045_0095868 | Ga0501045_0095868_496_1269 | 257 |
| 556 | 3300049824 | Ga0501045_0124822 | Ga0501045_0124822_56_829 | 257 |
| 557 | 3300049824 | Ga0501045_0357955 | Ga0501045_0357955_68_841 | 257 |
| 558 | 3300049824 | Ga0501045_0358918 | Ga0501045_0358918_293_1066 | 257 |
| 559 | 3300049824 | Ga0501045_0372091 | Ga0501045_0372091_49_822 | 257 |
| 560 | 3300050507 | nmdc:mga05p37_100710_c1 | nmdc:mga05p37_100710_c1_2694_3467 | 257 |
| 561 | 3300050507 | nmdc:mga05p37_12948_c1 | nmdc:mga05p37_12948_c1_1135_1908 | 257 |
| 562 | 3300050507 | nmdc:mga05p37_134317_c1 | nmdc:mga05p37_134317_c1_2210_2983 | 257 |
| 563 | 3300050507 | nmdc:mga05p37_1427_c1 | nmdc:mga05p37_1427_c1_20213_20986 | 257 |
| 564 | 3300050507 | nmdc:mga05p37_152101_c1 | nmdc:mga05p37_152101_c1_532_1305 | 257 |
| 565 | 3300050507 | nmdc:mga05p37_15303_c1 | nmdc:mga05p37_15303_c1_3483_4256 | 257 |
| 566 | 3300050507 | nmdc:mga05p37_168271_c1 | nmdc:mga05p37_168271_c1_1370_2143 | 257 |
| 567 | 3300050507 | nmdc:mga05p37_2575_c1 | nmdc:mga05p37_2575_c1_11920_12693 | 257 |
| 568 | 3300050507 | nmdc:mga05p37_45733_c1 | nmdc:mga05p37_45733_c1_4039_4812 | 257 |
| 569 | 3300050507 | nmdc:mga05p37_45908_c1 | nmdc:mga05p37_45908_c1_2435_3208 | 257 |
| 570 | 3300050507 | nmdc:mga05p37_546896_c1 | nmdc:mga05p37_546896_c1_42_815 | 257 |
| 571 | 3300050507 | nmdc:mga05p37_5969_c1 | nmdc:mga05p37_5969_c1_4078_4851 | 257 |
| 572 | 3300050507 | nmdc:mga05p37_61012_c1 | nmdc:mga05p37_61012_c1_1183_1956 | 257 |
| 573 | 3300050507 | nmdc:mga05p37_6660_c1 | nmdc:mga05p37_6660_c1_10850_11623 | 257 |
| 574 | 3300050507 | nmdc:mga05p37_67273_c1 | nmdc:mga05p37_67273_c1_1973_2746 | 257 |
| 575 | 3300050507 | nmdc:mga05p37_6_c1 | nmdc:mga05p37_6_c1_132445_133218 | 257 |
| 576 | 3300050507 | nmdc:mga05p37_768505_c1 | nmdc:mga05p37_768505_c1_191_964 | 257 |
| 577 | 3300050508 | nmdc:mga09592_159_c1 | nmdc:mga09592_159_c1_32500_33273 | 257 |
| 578 | 3300050508 | nmdc:mga09592_1747_c1 | nmdc:mga09592_1747_c1_11176_11949 | 257 |
| 579 | 3300050508 | nmdc:mga09592_25844_c1 | nmdc:mga09592_25844_c1_2137_2910 | 257 |
| 580 | 3300050508 | nmdc:mga09592_289732_c1 | nmdc:mga09592_289732_c1_519_1292 | 257 |
| 581 | 3300050508 | nmdc:mga09592_3854_c1 | nmdc:mga09592_3854_c1_8394_9167 | 257 |
| 582 | 3300050508 | nmdc:mga09592_46347_c1 | nmdc:mga09592_46347_c1_798_1571 | 257 |
| 583 | 3300050508 | nmdc:mga09592_8228_c1 | nmdc:mga09592_8228_c1_6941_7714 | 257 |
| 584 | 3300050509 | nmdc:mga0qj67_109653_c1 | nmdc:mga0qj67_109653_c1_869_1642 | 257 |
| 585 | 3300050509 | nmdc:mga0qj67_154902_c1 | nmdc:mga0qj67_154902_c1_775_1548 | 257 |
| 586 | 3300050509 | nmdc:mga0qj67_28180_c1 | nmdc:mga0qj67_28180_c1_1475_2248 | 257 |
| 587 | 3300050509 | nmdc:mga0qj67_474_c1 | nmdc:mga0qj67_474_c1_25857_26630 | 257 |
| 588 | 3300050510 | nmdc:mga06r32_130290_c1 | nmdc:mga06r32_130290_c1_1189_1962 | 257 |
| 589 | 3300050510 | nmdc:mga06r32_2028_c1 | nmdc:mga06r32_2028_c1_10170_10943 | 257 |
| 590 | 3300050510 | nmdc:mga06r32_232747_c1 | nmdc:mga06r32_232747_c1_864_1637 | 257 |
| 591 | 3300050510 | nmdc:mga06r32_25044_c1 | nmdc:mga06r32_25044_c1_3626_4399 | 257 |
| 592 | 3300050510 | nmdc:mga06r32_3585_c1 | nmdc:mga06r32_3585_c1_3255_4028 | 257 |
| 593 | 3300050510 | nmdc:mga06r32_361_c1 | nmdc:mga06r32_361_c1_574_1347 | 257 |
| 594 | 3300050510 | nmdc:mga06r32_36558_c1 | nmdc:mga06r32_36558_c1_694_1467 | 257 |
| 595 | 3300050510 | nmdc:mga06r32_405047_c1 | nmdc:mga06r32_405047_c1_529_1302 | 257 |
| 596 | 3300050510 | nmdc:mga06r32_40567_c1 | nmdc:mga06r32_40567_c1_997_1770 | 257 |
| 597 | 3300050510 | nmdc:mga06r32_64638_c1 | nmdc:mga06r32_64638_c1_966_1739 | 257 |
| 598 | 3300050510 | nmdc:mga06r32_70576_c1 | nmdc:mga06r32_70576_c1_402_1175 | 257 |
| 599 | 3300050510 | nmdc:mga06r32_763548_c1 | nmdc:mga06r32_763548_c1_19_792 | 257 |
| 600 | 3300050510 | nmdc:mga06r32_9821_c1 | nmdc:mga06r32_9821_c1_1464_2237 | 257 |
| 601 | 3300050511 | nmdc:mga08y16_233459_c1 | nmdc:mga08y16_233459_c1_483_1256 | 257 |
| 602 | 3300050511 | nmdc:mga08y16_4495_c1 | nmdc:mga08y16_4495_c1_11916_12689 | 257 |
| 603 | 3300050511 | nmdc:mga08y16_46350_c1 | nmdc:mga08y16_46350_c1_1442_2215 | 257 |
| 604 | 3300050512 | nmdc:mga0n895_13531_c1 | nmdc:mga0n895_13531_c1_2613_3386 | 257 |
| 605 | 3300050512 | nmdc:mga0n895_141599_c1 | nmdc:mga0n895_141599_c1_369_1142 | 257 |
| 606 | 3300050512 | nmdc:mga0n895_16149_c1 | nmdc:mga0n895_16149_c1_988_1761 | 257 |
| 607 | 3300050512 | nmdc:mga0n895_20052_c1 | nmdc:mga0n895_20052_c1_5127_5900 | 257 |
| 608 | 3300050512 | nmdc:mga0n895_226260_c1 | nmdc:mga0n895_226260_c1_233_1006 | 257 |
| 609 | 3300050512 | nmdc:mga0n895_287693_c1 | nmdc:mga0n895_287693_c1_807_1580 | 257 |
| 610 | 3300050512 | nmdc:mga0n895_66753_c1 | nmdc:mga0n895_66753_c1_2667_3440 | 257 |
| 611 | 3300050512 | nmdc:mga0n895_713_c1 | nmdc:mga0n895_713_c1_10244_11017 | 257 |
| 612 | 3300050512 | nmdc:mga0n895_81594_c1 | nmdc:mga0n895_81594_c1_520_1293 | 257 |
| 613 | 3300050512 | nmdc:mga0n895_85666_c1 | nmdc:mga0n895_85666_c1_686_1459 | 257 |
| 614 | 3300050512 | nmdc:mga0n895_8963_c1 | nmdc:mga0n895_8963_c1_5023_5796 | 257 |
| 615 | 3300050513 | nmdc:mga0rr50_1514_c1 | nmdc:mga0rr50_1514_c1_1193_1966 | 257 |
| 616 | 3300050513 | nmdc:mga0rr50_184105_c1 | nmdc:mga0rr50_184105_c1_539_1312 | 257 |
| 617 | 3300050513 | nmdc:mga0rr50_228853_c1 | nmdc:mga0rr50_228853_c1_564_1337 | 257 |
| 618 | 3300050513 | nmdc:mga0rr50_270921_c1 | nmdc:mga0rr50_270921_c1_260_1033 | 257 |
| 619 | 3300050513 | nmdc:mga0rr50_292766_c1 | nmdc:mga0rr50_292766_c1_50_823 | 257 |
| 620 | 3300050513 | nmdc:mga0rr50_4899_c2 | nmdc:mga0rr50_4899_c2_3530_4303 | 257 |
| 621 | 3300050513 | nmdc:mga0rr50_49292_c1 | nmdc:mga0rr50_49292_c1_539_1312 | 257 |
| 622 | 3300050513 | nmdc:mga0rr50_9978_c1 | nmdc:mga0rr50_9978_c1_3266_4039 | 257 |
| 623 | 3300050514 | nmdc:mga08x19_112247_c1 | nmdc:mga08x19_112247_c1_300_1073 | 257 |
| 624 | 3300050514 | nmdc:mga08x19_27650_c1 | nmdc:mga08x19_27650_c1_2415_3188 | 257 |
| 625 | 3300050514 | nmdc:mga08x19_43214_c1 | nmdc:mga08x19_43214_c1_40_813 | 257 |
| 626 | 3300050514 | nmdc:mga08x19_6921_c1 | nmdc:mga08x19_6921_c1_5067_5840 | 257 |
| 627 | 3300050514 | nmdc:mga08x19_963_c1 | nmdc:mga08x19_963_c1_7136_7909 | 257 |
| 628 | 3300050515 | nmdc:mga0a205_14189_c1 | nmdc:mga0a205_14189_c1_1709_2482 | 257 |
| 629 | 3300050515 | nmdc:mga0a205_19278_c1 | nmdc:mga0a205_19278_c1_3736_4509 | 257 |
| 630 | 3300050515 | nmdc:mga0a205_2149_c1 | nmdc:mga0a205_2149_c1_592_1365 | 257 |
| 631 | 3300050515 | nmdc:mga0a205_252626_c1 | nmdc:mga0a205_252626_c1_84_857 | 257 |
| 632 | 3300050515 | nmdc:mga0a205_318363_c1 | nmdc:mga0a205_318363_c1_358_1131 | 257 |
| 633 | 3300050515 | nmdc:mga0a205_50847_c1 | nmdc:mga0a205_50847_c1_582_1355 | 257 |
| 634 | 3300050515 | nmdc:mga0a205_57545_c1 | nmdc:mga0a205_57545_c1_849_1622 | 257 |
| 635 | 3300050515 | nmdc:mga0a205_58846_c1 | nmdc:mga0a205_58846_c1_547_1320 | 257 |
| 636 | 3300050515 | nmdc:mga0a205_59855_c1 | nmdc:mga0a205_59855_c1_337_1110 | 257 |
| 637 | 3300050515 | nmdc:mga0a205_85539_c1 | nmdc:mga0a205_85539_c1_1459_2232 | 257 |
| 638 | 3300054114 | Ga0501084_0000139 | Ga0501084_0000139_40666_41439 | 257 |
| 639 | 3300054114 | Ga0501084_0042821 | Ga0501084_0042821_1079_1852 | 257 |
| 640 | 3300054114 | Ga0501084_0062480 | Ga0501084_0062480_876_1649 | 257 |
| 641 | 3300054114 | Ga0501084_0095416 | Ga0501084_0095416_567_1340 | 257 |
| 642 | 3300054114 | Ga0501084_0110303 | Ga0501084_0110303_243_1016 | 257 |
| 643 | 3300054114 | Ga0501084_0135457 | Ga0501084_0135457_593_1366 | 257 |
| 644 | 3300060353 | Ga0501082_0000528 | Ga0501082_0000528_28747_29520 | 257 |
| 645 | 3300060353 | Ga0501082_0058879 | Ga0501082_0058879_542_1315 | 257 |
| 646 | 3300060353 | Ga0501082_0086041 | Ga0501082_0086041_1922_2695 | 257 |
| 647 | 3300061734 | Ga0530510_0065148 | Ga0530510_0065148_373_1146 | 257 |
| 648 | 3300061734 | Ga0530510_0128740 | Ga0530510_0128740_295_1068 | 257 |
| 649 | 3300061734 | Ga0530510_0159604 | Ga0530510_0159604_661_1434 | 257 |
| 650 | 3300061734 | Ga0530510_0214423 | Ga0530510_0214423_515_1288 | 257 |
| 651 | 3300061734 | Ga0530510_0217974 | Ga0530510_0217974_462_1235 | 257 |
| 652 | 3300061734 | Ga0530510_0227999 | Ga0530510_0227999_120_893 | 257 |
| 653 | 3300061734 | Ga0530510_0356966 | Ga0530510_0356966_42_815 | 257 |
| 654 | 3300061734 | Ga0530510_0358496 | Ga0530510_0358496_234_1007 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z7r-assembly1.cif.gz_A | crystal structure of crotonase from clostridium acetobutylicum | 0.9597 | 1 | 248 |
| 6lvp-assembly1.cif.gz_C | enoyl-coa hydratase (hyech) from hymenobacter sp. pamc 26628 | 0.9578 | 2 | 256 |
| 2ppy-assembly1.cif.gz_A | crystal structure of enoyl-coa hydrates (gk_1992) from geobacillus kaustophilus hta426 | 0.9572 | 1 | 256 |
| 5zai-assembly1.cif.gz_D | crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula | 0.9566 | 1 | 255 |
| 3kqf-assembly1.cif.gz_B | 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. | 0.9549 | 4 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1hzdF02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9787 | 198 | 256 | 1.10.12.10 |
| 1hzdE02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9785 | 198 | 256 | 1.10.12.10 |
| 2zqqC02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9785 | 198 | 256 | 1.10.12.10 |
| 2zqrE02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9778 | 198 | 256 | 1.10.12.10 |
| 2zqqA02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9765 | 198 | 256 | 1.10.12.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G9XP34-F1-model_v4 | Crotonase | 0.9756 | 32 | 256 |
GO:0006635
GO:0016836 |
| AF-A0A2V8NUW7-F1-model_v4 | Enoyl-CoA hydratase | 0.973 | 2 | 256 |
GO:0006635
GO:0016829 |
| AF-A0A0L8MY38-F1-model_v4 | deleted | 0.9726 | 95 | 194 |
|
| AF-A0A7W1LYZ4-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9716 | 103 | 256 |
GO:0006635
GO:0016829 GO:0016853 |
| AF-A0A419EUR1-F1-model_v4 | Enoyl-CoA hydratase | 0.9713 | 1 | 256 |
GO:0006635
GO:0016836 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar