F472789

General Info

Members Datasets Scaffolds Average Seq Length
653 302 518 231

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000430|Ga0453684_0000430_38207_38953
Length 248
Sequence LVNGDWQLPFTNRHLLEIEMLKKLKEQVFHANLQLPKHGLVTFTWGNVSGIDRERGLVVIKPSGVSYETMKASDMVVVELETGKVVDGELKPSSDTPTHLELYKAFANIGGVVHTHSRWATSFAQAGRGIAALGTTHGDYFYGEIPCTRKMTSAEIQGEYEKETGTVIIETFQGKNPDAIPGVLVHSHGPFTWGKDPADAVHNAVVLDEVAFMNFHTLMLNPDIQPMQQDLLNKHYLRKHGENAYYGQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
4 2547132181 Kosakonia sacchari SP1 Isolate Stem
5 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
6 2561511199 Enterobacter sp. R4-368 Isolate Nodule
7 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
8 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
9 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
10 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
11 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
12 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
13 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
14 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
15 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
16 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
17 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
18 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
19 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
20 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
21 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
22 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
23 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
24 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
25 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
26 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
27 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
28 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
29 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
30 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
31 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
32 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
33 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
34 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
35 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
36 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
37 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
38 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
39 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
40 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
41 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
42 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
43 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
44 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
45 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
46 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
47 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
48 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
49 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
50 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
51 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
52 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
53 2636415599 Klebsiella variicola DX120E Isolate Unclassified
54 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
55 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
56 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
57 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
58 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
59 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
60 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
61 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
62 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
63 2738541295 Bacillus sp. OK085 Isolate Unclassified
64 2738543010 Bacillus sp. YR335 Isolate Unclassified
65 2738543017 Bacillus sp. OV186 Isolate Unclassified
66 2751185917 Enterobacter sp. HK169 Isolate Unclassified
67 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
68 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
69 2775507074 Klebsiella sp. D5A Isolate Unclassified
70 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
71 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
72 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
73 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
74 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
75 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
76 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
77 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
78 2821118458 Enterobacter asburiae 609 Isolate Unclassified
79 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
80 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
81 2847085930 Erwinia persicina B64 Isolate Bulb
82 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
83 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
84 2857586860 Bacillus sp. R-71935 Isolate Unclassified
85 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
86 2860837431 Bacillus sp. WR11 Isolate Unclassified
87 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
88 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
89 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
90 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
91 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
92 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
93 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
94 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
95 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
96 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
97 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
98 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
99 2932406140 Serratia sp. 2723 Isolate Rhizosphere
100 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
101 2937539931 Pantoea sp. LS15 Isolate Unclassified
102 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
103 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
104 2939577877 Serratia sp. 509 Isolate Rhizosphere
105 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
106 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
107 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
108 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
109 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
110 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
111 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
112 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
113 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
114 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
115 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
116 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
117 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
118 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
119 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
120 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
121 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
122 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
123 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
124 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
125 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
126 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
127 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
128 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
129 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
130 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
131 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
132 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
133 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
134 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
135 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
136 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
137 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
138 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
139 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
142 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
143 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
144 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
145 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
146 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
149 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
150 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
151 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
152 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
153 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
154 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
168 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
169 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
170 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
173 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
215 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
225 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
228 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
229 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
230 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
233 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
234 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 8018221730 Enterobacter sp. CM29 Isolate Unclassified
294 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
295 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
296 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
297 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
298 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
299 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
300 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
301 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
302 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.25
Metatranscriptomes 1.07
Isolates 20.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0.15
Endosphere 1.68
Nodule 3.06
Rhizoplane 9.65
Rhizosphere 64.32
Stem 0.15
Stem Tuber 0.46
Unclassified 19.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C711 2010549000 Bacteria 6242
2 SwRhRL2b_contig_2664570 2162886007 Bacteria 2585
3 SwRhRL2b_contig_2998025 2162886007 Bacteria 2585
4 SwRhRL2b_contig_303839 2162886007 Bacteria 3850
5 SwRhRL2b_contig_477049 2162886007 Bacteria 2880
6 JGI24739J22299_10003159 3300001989 Bacteria 6288
7 rootH2_10013040 3300003320 Bacteria 16106
8 Ga0058692_1003806 3300003856 Bacteria 4587
9 Ga0058692_1003977 3300003856 Bacteria 4462
10 Ga0058692_1004129 3300003856 Bacteria 4352
11 Ga0058692_1004240 3300003856 Bacteria 4274
12 Ga0058692_1018259 3300003856 Bacteria 1519
13 Ga0058692_1024985 3300003856 Bacteria 1192
14 Ga0065704_10000644 3300005289 Bacteria 24925
15 Ga0065704_10002108 3300005289 Bacteria 10828
16 Ga0065704_10092089 3300005289 Bacteria 2670
17 Ga0065704_10110571 3300005289 Bacteria 1977
18 Ga0065704_10123095 3300005289 Bacteria 1724
19 Ga0065704_10173393 3300005289 Bacteria 1278
20 Ga0065707_10001120 3300005295 Bacteria 26753
21 Ga0065707_10082652 3300005295 Bacteria 13032
22 Ga0065707_10254824 3300005295 Bacteria 1114
23 Ga0070689_100051521 3300005340 Bacteria 3182
24 Ga0070689_100245755 3300005340 Bacteria 1475
25 Ga0070709_10143249 3300005434 Bacteria 1644
26 Ga0070708_100188459 3300005445 Bacteria 1929
27 Ga0070706_100129629 3300005467 Bacteria 2353
28 Ga0070706_100494330 3300005467 Unclassified 1138
29 Ga0070707_100077768 3300005468 Bacteria 3201
30 Ga0070698_100014496 3300005471 Bacteria 8324
31 Ga0070697_100176777 3300005536 Unclassified 1808
32 Ga0070697_100218184 3300005536 Unclassified 1625
33 Ga0070697_100325462 3300005536 Unclassified 1324
34 Ga0070665_100000423 3300005548 Bacteria 61750
35 Ga0070665_100158266 3300005548 Bacteria 2267
36 Ga0068857_100000004 3300005577 Bacteria 171895
37 Ga0068851_10020182 3300005834 Bacteria 3223
38 Ga0068862_100082899 3300005844 Bacteria 2784
39 Ga0081538_10051707 3300005981 Bacteria 2463
40 Ga0075364_10002253 3300006051 Bacteria 10820
41 Ga0075364_10020926 3300006051 Bacteria 4119
42 Ga0075432_10100710 3300006058 Bacteria 1067
43 Ga0075366_10001298 3300006195 Bacteria 12444
44 Ga0075428_100269776 3300006844 Bacteria 1831
45 Ga0075431_100069741 3300006847 Bacteria 3626
46 Ga0075429_100006419 3300006880 Bacteria 10181
47 Ga0075429_100037993 3300006880 Bacteria 4190
48 Ga0079104_1000043 3300006946 Bacteria 185977
49 Ga0079104_1000308 3300006946 Bacteria 61968
50 Ga0079104_1000473 3300006946 Bacteria 44805
51 Ga0079104_1001529 3300006946 Bacteria 15280
52 Ga0079104_1004294 3300006946 Bacteria 6175
53 Ga0079104_1005229 3300006946 Bacteria 5241
54 Ga0079104_1006890 3300006946 Bacteria 4206
55 Ga0079104_1007421 3300006946 Bacteria 3979
56 Ga0079104_1013908 3300006946 Bacteria 2456
57 Ga0105251_10000448 3300009011 Bacteria 39795
58 Ga0105251_10001028 3300009011 Bacteria 24490
59 Ga0105251_10001203 3300009011 Bacteria 22371
60 Ga0105251_10001732 3300009011 Bacteria 18211
61 Ga0105251_10002099 3300009011 Bacteria 16056
62 Ga0105251_10002323 3300009011 Bacteria 15060
63 Ga0105251_10007125 3300009011 Bacteria 6959
64 Ga0105251_10046026 3300009011 Bacteria 2101
65 Ga0105251_10062704 3300009011 Bacteria 1745
66 Ga0105244_10000039 3300009036 Bacteria 158304
67 Ga0105244_10000064 3300009036 Bacteria 122071
68 Ga0105244_10000093 3300009036 Bacteria 94812
69 Ga0105244_10000440 3300009036 Bacteria 38214
70 Ga0105244_10000538 3300009036 Bacteria 33838
71 Ga0105244_10003071 3300009036 Bacteria 12217
72 Ga0105244_10015609 3300009036 Bacteria 4352
73 Ga0105244_10016389 3300009036 Bacteria 4221
74 Ga0105244_10018788 3300009036 Bacteria 3871
75 Ga0105244_10021942 3300009036 Bacteria 3520
76 Ga0105244_10024056 3300009036 Bacteria 3329
77 Ga0105244_10053581 3300009036 Bacteria 2049
78 Ga0105244_10088235 3300009036 Bacteria 1528
79 Ga0105250_10000055 3300009092 Bacteria 114088
80 Ga0105250_10001140 3300009092 Bacteria 14987
81 Ga0105250_10053150 3300009092 Bacteria 1625
82 Ga0105250_10124141 3300009092 Bacteria 1063
83 Ga0105240_10121769 3300009093 Bacteria 3141
84 Ga0114129_10035325 3300009147 Bacteria 7061
85 Ga0114129_10080402 3300009147 Bacteria 4530
86 Ga0114129_10098705 3300009147 Bacteria 4042
87 Ga0105243_10000559 3300009148 Bacteria 37609
88 Ga0105243_10036319 3300009148 Bacteria 3825
89 Ga0105243_10818705 3300009148 Bacteria 919
90 Ga0105241_10000002 3300009174 Bacteria 869480
91 Ga0105249_10031720 3300009553 Bacteria 4779
92 Ga0105249_10081775 3300009553 Bacteria 3003
93 Ga0105246_10119484 3300011119 Bacteria 1950
94 Ga0157373_10003718 3300013100 Bacteria 11545
95 Ga0157373_10026798 3300013100 Bacteria 4160
96 Ga0157373_10041455 3300013100 Bacteria 3293
97 Ga0157373_10066519 3300013100 Bacteria 2550
98 Ga0157373_10106325 3300013100 Bacteria 1973
99 Ga0157371_10000845 3300013102 Bacteria 35026
100 Ga0157371_10000905 3300013102 Bacteria 33385
101 Ga0157371_10024617 3300013102 Bacteria 4394
102 Ga0157371_10030959 3300013102 Bacteria 3856
103 Ga0157370_10000330 3300013104 Bacteria 59532
104 Ga0157369_10009079 3300013105 Bacteria 11381
105 Ga0157372_10002076 3300013307 Bacteria 21757
106 Ga0157372_10340993 3300013307 Bacteria 1745
107 Ga0157372_11018591 3300013307 Bacteria 959
108 Ga0182006_1000013 3300015261 Bacteria 363224
109 Ga0183366_1003 3300015679 Bacteria 453474
110 Ga0183370_1003 3300015680 Bacteria 454044
111 Ga0183369_1005 3300015685 Bacteria 453680
112 Ga0183368_1006 3300015687 Bacteria 551576
113 Ga0213876_10000026 3300021384 Bacteria 231892
114 Ga0207425_1033570 3300025245 Bacteria 1011
115 Ga0209129_1000008 3300025258 Bacteria 640959
116 Ga0207696_1000066 3300025711 Bacteria 231203
117 Ga0207696_1000154 3300025711 Bacteria 115850
118 Ga0207696_1000725 3300025711 Bacteria 22150
119 Ga0207696_1006727 3300025711 Bacteria 4591
120 Ga0207696_1009798 3300025711 Bacteria 3553
121 Ga0207696_1017009 3300025711 Bacteria 2418
122 Ga0207655_1000017 3300025728 Bacteria 544403
123 Ga0207655_1000026 3300025728 Bacteria 445528
124 Ga0207655_1000090 3300025728 Bacteria 203398
125 Ga0207655_1000101 3300025728 Bacteria 185883
126 Ga0207655_1000826 3300025728 Bacteria 33394
127 Ga0207655_1001735 3300025728 Bacteria 19134
128 Ga0207655_1006647 3300025728 Bacteria 7622
129 Ga0207655_1015340 3300025728 Bacteria 4266
130 Ga0207655_1018439 3300025728 Bacteria 3700
131 Ga0207655_1020569 3300025728 Bacteria 3384
132 Ga0207655_1046135 3300025728 Bacteria 1812
133 Ga0207713_1000008 3300025735 Bacteria 553952
134 Ga0207713_1000039 3300025735 Bacteria 247140
135 Ga0207713_1000048 3300025735 Bacteria 228272
136 Ga0207713_1000057 3300025735 Bacteria 217090
137 Ga0207713_1006358 3300025735 Bacteria 7209
138 Ga0207713_1010684 3300025735 Bacteria 5060
139 Ga0207713_1023518 3300025735 Bacteria 2898
140 Ga0207713_1047052 3300025735 Bacteria 1748
141 Ga0207713_1050801 3300025735 Bacteria 1652
142 Ga0207713_1074003 3300025735 Bacteria 1248
143 Ga0207713_1084802 3300025735 Bacteria 1130
144 Ga0207699_10263592 3300025906 Unclassified 1192
145 Ga0207684_10369962 3300025910 Bacteria 1233
146 Ga0207654_10000005 3300025911 Bacteria 869492
147 Ga0207695_10113022 3300025913 Bacteria 2692
148 Ga0207660_10177379 3300025917 Bacteria 1653
149 Ga0207646_10016758 3300025922 Bacteria 6873
150 Ga0207690_10122807 3300025932 Bacteria 1889
151 Ga0207709_10002340 3300025935 Bacteria 11961
152 Ga0207709_10148531 3300025935 Bacteria 1620
153 Ga0207709_10541177 3300025935 Bacteria 914
154 Ga0207665_10047997 3300025939 Bacteria 2864
155 Ga0207712_10396398 3300025961 Bacteria 1159
156 Ga0207708_10055397 3300026075 Bacteria 3023
157 Ga0207676_10074403 3300026095 Bacteria 2737
158 Ga0207674_10000009 3300026116 Bacteria 202730
159 Ga0207675_100097033 3300026118 Bacteria 2775
160 Ga0209281_1000058 3300027111 Bacteria 300244
161 Ga0209281_1000105 3300027111 Bacteria 220052
162 Ga0209281_1000137 3300027111 Bacteria 182134
163 Ga0209281_1000146 3300027111 Bacteria 169237
164 Ga0209281_1000440 3300027111 Bacteria 60696
165 Ga0209281_1001029 3300027111 Bacteria 21484
166 Ga0209281_1001204 3300027111 Bacteria 17601
167 Ga0209281_1002657 3300027111 Bacteria 6799
168 Ga0209281_1004533 3300027111 Bacteria 4133
169 Ga0209371_1000014 3300027312 Bacteria 661118
170 Ga0209371_1000030 3300027312 Bacteria 423605
171 Ga0209371_1000054 3300027312 Bacteria 259676
172 Ga0209371_1000510 3300027312 Bacteria 37070
173 Ga0209371_1002128 3300027312 Bacteria 11666
174 Ga0209371_1002267 3300027312 Bacteria 11024
175 Ga0209371_1002466 3300027312 Bacteria 10303
176 Ga0209371_1003025 3300027312 Bacteria 8686
177 Ga0209371_1004228 3300027312 Bacteria 6381
178 Ga0209371_1016426 3300027312 Bacteria 1953
179 Ga0268266_10000290 3300028379 Bacteria 82154
180 Ga0268266_10136896 3300028379 Bacteria 2194
181 Ga0268265_10008633 3300028380 Bacteria 6887
182 Ga0265323_10000756 3300028653 Bacteria 17302
183 Ga0265336_10008571 3300028666 Bacteria 3578
184 Ga0265338_10099445 3300028800 Bacteria 2376
185 Ga0268256_1000012 3300030500 Bacteria 794553
186 Ga0268256_1000021 3300030500 Bacteria 542735
187 Ga0268256_1000025 3300030500 Bacteria 484317
188 Ga0268256_1000440 3300030500 Bacteria 37070
189 Ga0268256_1001865 3300030500 Bacteria 11666
190 Ga0268256_1002008 3300030500 Bacteria 11024
191 Ga0268256_1002459 3300030500 Bacteria 9427
192 Ga0268256_1002715 3300030500 Bacteria 8680
193 Ga0268256_1003480 3300030500 Bacteria 7069
194 Ga0268256_1008453 3300030500 Bacteria 3522
195 Ga0268256_1014390 3300030500 Bacteria 2350
196 Ga0268256_1019990 3300030500 Bacteria 1818
197 Ga0268256_1030911 3300030500 Bacteria 1291
198 Ga0265316_10000177 3300031344 Bacteria 72268
199 Ga0265316_10024434 3300031344 Bacteria 5063
200 Ga0316575_10002962 3300031665 Bacteria 5781
201 Ga0316579_10041372 3300031691 Bacteria 2140
202 Ga0316579_10048920 3300031691 Bacteria 1976
203 Ga0316579_10069537 3300031691 Bacteria 1666
204 Ga0316579_10121053 3300031691 Bacteria 1257
205 Ga0316579_10220802 3300031691 Bacteria 917
206 Ga0316576_10004932 3300031727 Bacteria 8078
207 Ga0316576_10014461 3300031727 Bacteria 5274
208 Ga0316576_10054359 3300031727 Bacteria 2920
209 Ga0316576_10057657 3300031727 Bacteria 2839
210 Ga0316576_10082773 3300031727 Bacteria 2383
211 Ga0316576_10154652 3300031727 Bacteria 1729
212 Ga0316576_10170439 3300031727 Bacteria 1643
213 Ga0316576_10187906 3300031727 Bacteria 1558
214 Ga0316576_10264715 3300031727 Unclassified 1289
215 Ga0316576_10437178 3300031727 Unclassified 967
216 Ga0316578_10026251 3300031728 Bacteria 3283
217 Ga0316578_10037731 3300031728 Bacteria 2784
218 Ga0316578_10057193 3300031728 Bacteria 2291
219 Ga0316578_10086564 3300031728 Bacteria 1868
220 Ga0316578_10164880 3300031728 Bacteria 1335
221 Ga0316578_10244789 3300031728 Bacteria 1076
222 Ga0307405_10120791 3300031731 Bacteria 1793
223 Ga0316577_10007486 3300031733 Bacteria 5827
224 Ga0316577_10009597 3300031733 Bacteria 5209
225 Ga0316577_10035302 3300031733 Bacteria 2794
226 Ga0316577_10035558 3300031733 Bacteria 2784
227 Ga0316577_10044141 3300031733 Bacteria 2493
228 Ga0316577_10285308 3300031733 Bacteria 935
229 Ga0307413_10264942 3300031824 Bacteria 1283
230 Ga0307410_10011475 3300031852 Bacteria 5070
231 Ga0307407_10201935 3300031903 Bacteria 1333
232 Ga0307412_10901792 3300031911 Bacteria 775
233 Ga0307409_100006496 3300031995 Bacteria 6878
234 Ga0307416_100220178 3300032002 Bacteria 1819
235 Ga0307415_100600049 3300032126 Bacteria 980
236 Ga0316583_10094676 3300032133 Bacteria 1041
237 Ga0316585_10040395 3300032137 Bacteria 1485
238 Ga0316585_10116758 3300032137 Bacteria 878
239 Ga0316585_10121997 3300032137 Bacteria 858
240 Ga0316580_10012196 3300032139 Bacteria 2617
241 Ga0373940_0123127 3300035088 Bacteria 806
242 Ga0373957_0115414 3300035120 Bacteria 1084
243 Ga0316574_0000589 3300035398 Bacteria 15071
244 Ga0316574_0006729 3300035398 Bacteria 6242
245 Ga0316574_0023975 3300035398 Bacteria 3647
246 Ga0316574_0026500 3300035398 Bacteria 3487
247 Ga0316574_0257317 3300035398 Bacteria 1115
248 Ga0316574_0310412 3300035398 Bacteria 1002
249 Ga0373937_0410499 3300036401 Bacteria 1285
250 Ga0316582_0001000 3300036647 Bacteria 11794
251 Ga0316582_0015287 3300036647 Bacteria 4384
252 Ga0316582_0023449 3300036647 Bacteria 3679
253 Ga0316582_0052444 3300036647 Bacteria 2593
254 Ga0316582_0061277 3300036647 Bacteria 2413
255 Ga0316582_0132845 3300036647 Bacteria 1673
256 Ga0316582_0393728 3300036647 Bacteria 954
257 Ga0316584_0018941 3300036712 Bacteria 4972
258 Ga0316584_0020974 3300036712 Bacteria 4745
259 Ga0316584_0031976 3300036712 Unclassified 3892
260 Ga0316584_0042324 3300036712 Bacteria 3396
261 Ga0316584_0060325 3300036712 Bacteria 2841
262 Ga0316584_0107126 3300036712 Bacteria 2091
263 Ga0316584_0134792 3300036712 Bacteria 1844
264 Ga0316584_0150480 3300036712 Bacteria 1733
265 Ga0316584_0221568 3300036712 Bacteria 1390
266 Ga0316584_0258312 3300036712 Bacteria 1271
267 Ga0316584_0266959 3300036712 Bacteria 1246
268 Ga0316584_0367170 3300036712 Bacteria 1031
269 Ga0316581_0007933 3300037588 Bacteria 2872
270 Ga0316581_0018289 3300037588 Bacteria 2034
271 Ga0436364_1125312 3300037853 Bacteria 9272
272 Ga0400483_146137 3300039062 Bacteria 6285
273 Ga0400489_87447 3300039093 Bacteria 12134
274 Ga0436365_0084998 3300039437 Bacteria 507888
275 Ga0436365_1307659 3300039437 Bacteria 1670
276 Ga0436365_1712226 3300039437 Unclassified 1730
277 Ga0436365_1725380 3300039437 Unclassified 3910
278 Ga0439438_003845 3300041405 Bacteria 5924
279 Ga0451795_0258668 3300041456 Bacteria 755
280 Ga0451851_0368623 3300041507 Bacteria 1011
281 Ga0451855_0278396 3300041511 Bacteria 1472
282 Ga0451853_4120536 3300041512 Bacteria 6488
283 Ga0439432_022525 3300042006 Bacteria 2081
284 Ga0439432_027255 3300042006 Bacteria 1866
285 Ga0439452_000004 3300042010 Bacteria 764268
286 Ga0439452_000005 3300042010 Bacteria 646919
287 Ga0439452_000011 3300042010 Bacteria 428451
288 Ga0439452_000056 3300042010 Bacteria 106151
289 Ga0439452_000271 3300042010 Bacteria 34289
290 Ga0439452_001380 3300042010 Bacteria 10001
291 Ga0450902_004120 3300042137 Bacteria 2155
292 Ga0439464_0000139 3300042439 Bacteria 11765
293 Ga0451577_0000010 3300042876 Bacteria 616686
294 Ga0451577_0000034 3300042876 Bacteria 376183
295 Ga0451577_0001439 3300042876 Bacteria 31680
296 Ga0451577_0008642 3300042876 Bacteria 9892
297 Ga0451577_0010954 3300042876 Bacteria 8615
298 Ga0451577_0016728 3300042876 Bacteria 6782
299 Ga0451577_0019701 3300042876 Bacteria 6201
300 Ga0451577_0045646 3300042876 Bacteria 3922
301 Ga0451577_0069418 3300042876 Bacteria 3142
302 Ga0451577_0169231 3300042876 Bacteria 1969
303 Ga0451577_0182773 3300042876 Bacteria 1891
304 Ga0451577_0268020 3300042876 Bacteria 1546
305 Ga0451577_0521760 3300042876 Bacteria 1079
306 Ga0466981_0000021 3300044669 Bacteria 83378
307 Ga0453683_0000023 3300044673 Bacteria 264522
308 Ga0453683_0000057 3300044673 Bacteria 190239
309 Ga0453683_0000740 3300044673 Bacteria 33318
310 Ga0453683_0007897 3300044673 Bacteria 7176
311 Ga0453683_0015084 3300044673 Bacteria 5015
312 Ga0453683_0016365 3300044673 Bacteria 4784
313 Ga0453683_0028426 3300044673 Bacteria 3541
314 Ga0453683_0103925 3300044673 Bacteria 1784
315 Ga0453683_0130171 3300044673 Bacteria 1585
316 Ga0453683_0203744 3300044673 Bacteria 1256
317 Ga0466963_0248447 3300044694 Bacteria 1248
318 Ga0453684_0000098 3300044712 Bacteria 376183
319 Ga0453684_0000130 3300044712 Bacteria 331761
320 Ga0453684_0000329 3300044712 Bacteria 198284
321 Ga0453684_0000430 3300044712 Bacteria 171415
322 Ga0453684_0000467 3300044712 Bacteria 161003
323 Ga0453684_0000535 3300044712 Bacteria 144635
324 Ga0453684_0000610 3300044712 Bacteria 131386
325 Ga0453684_0002604 3300044712 Bacteria 43124
326 Ga0453684_0004135 3300044712 Bacteria 31425
327 Ga0453684_0004838 3300044712 Bacteria 27641
328 Ga0453684_0006927 3300044712 Bacteria 21242
329 Ga0453684_0006996 3300044712 Bacteria 21098
330 Ga0453684_0009059 3300044712 Bacteria 17564
331 Ga0453684_0017644 3300044712 Bacteria 11034
332 Ga0453684_0020927 3300044712 Bacteria 9816
333 Ga0453684_0022514 3300044712 Bacteria 9341
334 Ga0453684_0027253 3300044712 Bacteria 8202
335 Ga0453684_0056768 3300044712 Bacteria 5075
336 Ga0453684_0056779 3300044712 Bacteria 5075
337 Ga0453684_0057089 3300044712 Bacteria 5057
338 Ga0453684_0062134 3300044712 Bacteria 4786
339 Ga0453684_0065010 3300044712 Bacteria 4655
340 Ga0453684_0067269 3300044712 Bacteria 4557
341 Ga0453684_0082222 3300044712 Bacteria 4013
342 Ga0453684_0088457 3300044712 Bacteria 3836
343 Ga0453684_0089429 3300044712 Bacteria 3808
344 Ga0453684_0105401 3300044712 Bacteria 3438
345 Ga0453684_0119103 3300044712 Bacteria 3191
346 Ga0453684_0148299 3300044712 Bacteria 2791
347 Ga0453684_0150428 3300044712 Bacteria 2767
348 Ga0453684_0173183 3300044712 Bacteria 2541
349 Ga0453684_0184831 3300044712 Bacteria 2444
350 Ga0453684_0191063 3300044712 Bacteria 2395
351 Ga0453684_0236213 3300044712 Bacteria 2107
352 Ga0453684_0283585 3300044712 Bacteria 1888
353 Ga0453684_0295973 3300044712 Unclassified 1841
354 Ga0453684_0369536 3300044712 Bacteria 1613
355 Ga0453684_0415687 3300044712 Bacteria 1503
356 Ga0453684_0445744 3300044712 Bacteria 1442
357 Ga0453684_0532340 3300044712 Bacteria 1296
358 Ga0453684_0928954 3300044712 Bacteria 930
359 Ga0453684_1019455 3300044712 Bacteria 879
360 Ga0451576_0000036 3300045051 Bacteria 376183
361 Ga0451576_0000045 3300045051 Bacteria 334210
362 Ga0451576_0000193 3300045051 Bacteria 154108
363 Ga0451576_0000353 3300045051 Bacteria 110215
364 Ga0451576_0006247 3300045051 Bacteria 14668
365 Ga0451576_0014734 3300045051 Bacteria 8693
366 Ga0451576_0021213 3300045051 Bacteria 7061
367 Ga0451576_0042446 3300045051 Bacteria 4801
368 Ga0451576_0050453 3300045051 Bacteria 4363
369 Ga0451576_0081174 3300045051 Bacteria 3372
370 Ga0451576_0085029 3300045051 Bacteria 3290
371 Ga0451576_0141127 3300045051 Unclassified 2512
372 Ga0451576_0218717 3300045051 Bacteria 1989
373 Ga0451576_0219870 3300045051 Bacteria 1983
374 Ga0451576_0739878 3300045051 Bacteria 1033
375 Ga0495591_000438 3300046458 Bacteria 33904
376 Ga0495591_006106 3300046458 Bacteria 5406
377 Ga0495638_0031438 3300046460 Bacteria 3412
378 Ga0495650_0000028 3300046471 Bacteria 473012
379 Ga0495650_0033078 3300046471 Bacteria 2305
380 Ga0495618_0060428 3300046514 Bacteria 2403
381 Ga0495620_0009456 3300046515 Bacteria 5184
382 Ga0495637_0038772 3300046520 Bacteria 2061
383 Ga0495643_0101180 3300046522 Bacteria 1477
384 Ga0495654_0010790 3300046530 Bacteria 4962
385 Ga0495597_0000550 3300046542 Bacteria 31137
386 Ga0495625_0093468 3300046660 Bacteria 2076
387 Ga0495649_0001014 3300046694 Bacteria 22056
388 Ga0495649_0001806 3300046694 Bacteria 15726
389 Ga0495649_0076731 3300046694 Bacteria 1789
390 Ga0495660_0020556 3300046810 Bacteria 3784
391 Ga0495672_0000051 3300047320 Bacteria 237883
392 Ga0495680_0365837 3300047322 Unclassified 1001
393 Ga0495679_000014 3300047446 Bacteria 292767
394 Ga0495679_006997 3300047446 Bacteria 4772
395 Ga0495679_030247 3300047446 Bacteria 1760
396 Ga0495673_0000047 3300047469 Bacteria 266522
397 Ga0496101_0039196 3300048904 Bacteria 3368
398 Ga0496101_0701614 3300048904 Bacteria 799
399 Ga0496102_0084013 3300048905 Bacteria 2938
400 Ga0496104_0016292 3300048907 Bacteria 6747
401 Ga0496104_0104990 3300048907 Bacteria 2707
402 Ga0496104_0494082 3300048907 Bacteria 1135
403 Ga0496105_0015305 3300048908 Bacteria 6109
404 Ga0496105_0355624 3300048908 Bacteria 1169
405 Ga0496112_0064546 3300048915 Bacteria 3613
406 Ga0496113_0079283 3300048916 Bacteria 2514
407 Ga0496116_0000103 3300048919 Bacteria 193529
408 Ga0496116_0000181 3300048919 Bacteria 126124
409 Ga0496116_0000980 3300048919 Bacteria 35087
410 Ga0496116_0001132 3300048919 Bacteria 31772
411 Ga0496116_0015488 3300048919 Bacteria 6023
412 Ga0496116_0025832 3300048919 Bacteria 4307
413 Ga0496117_0001953 3300048920 Bacteria 27459
414 Ga0496117_0003317 3300048920 Bacteria 18805
415 Ga0496117_0003529 3300048920 Bacteria 18089
416 Ga0496117_0003748 3300048920 Bacteria 17399
417 Ga0496117_0043720 3300048920 Bacteria 3253
418 Ga0496117_0056184 3300048920 Bacteria 2744
419 Ga0496117_0062227 3300048920 Bacteria 2558
420 Ga0496117_0089985 3300048920 Bacteria 1979
421 Ga0496117_0115106 3300048920 Bacteria 1665
422 Ga0496118_0001235 3300048921 Bacteria 39296
423 Ga0496118_0001510 3300048921 Bacteria 34648
424 Ga0496118_0004378 3300048921 Bacteria 16791
425 Ga0496118_0018944 3300048921 Bacteria 6171
426 Ga0496118_0117087 3300048921 Bacteria 1749
427 Ga0496119_0000026 3300048922 Bacteria 254759
428 Ga0496119_0000160 3300048922 Bacteria 93515
429 Ga0496119_0000277 3300048922 Bacteria 72419
430 Ga0496119_0001719 3300048922 Bacteria 25553
431 Ga0496119_0013921 3300048922 Bacteria 6346
432 Ga0496119_0045750 3300048922 Bacteria 2741
433 Ga0496119_0047167 3300048922 Bacteria 2682
434 Ga0496119_0066625 3300048922 Bacteria 2126
435 Ga0496119_0228489 3300048922 Bacteria 948
436 Ga0496120_0000038 3300048923 Bacteria 204168
437 Ga0496120_0000192 3300048923 Bacteria 104239
438 Ga0496120_0010415 3300048923 Bacteria 6491
439 Ga0496120_0015197 3300048923 Bacteria 5089
440 Ga0496120_0016564 3300048923 Bacteria 4813
441 Ga0496120_0027657 3300048923 Bacteria 3483
442 Ga0496120_0302828 3300048923 Bacteria 731
443 Ga0496121_0003741 3300048924 Bacteria 21307
444 Ga0496121_0006806 3300048924 Bacteria 14003
445 Ga0496121_0007864 3300048924 Bacteria 12751
446 Ga0496121_0007928 3300048924 Bacteria 12694
447 Ga0496121_0019455 3300048924 Bacteria 6787
448 Ga0496121_0036324 3300048924 Bacteria 4392
449 Ga0496121_0048673 3300048924 Bacteria 3604
450 Ga0496122_0000477 3300048925 Bacteria 83335
451 Ga0496122_0001294 3300048925 Bacteria 41474
452 Ga0496122_0001657 3300048925 Bacteria 34574
453 Ga0496122_0005935 3300048925 Bacteria 14295
454 Ga0496122_0011622 3300048925 Bacteria 8887
455 Ga0496122_0022385 3300048925 Bacteria 5618
456 Ga0496122_0023208 3300048925 Bacteria 5480
457 Ga0496122_0123807 3300048925 Bacteria 1660
458 Ga0496122_0144248 3300048925 Bacteria 1483
459 Ga0496122_0281062 3300048925 Bacteria 909
460 Ga0496123_0000019 3300048926 Bacteria 400216
461 Ga0496123_0000310 3300048926 Bacteria 93838
462 Ga0496123_0001352 3300048926 Bacteria 34568
463 Ga0496123_0002398 3300048926 Bacteria 23426
464 Ga0496123_0004178 3300048926 Bacteria 15437
465 Ga0496123_0016973 3300048926 Bacteria 5879
466 Ga0496123_0018931 3300048926 Bacteria 5447
467 Ga0496123_0030535 3300048926 Bacteria 3943
468 Ga0496123_0032475 3300048926 Bacteria 3778
469 Ga0496123_0134907 3300048926 Bacteria 1360
470 Ga0496124_0000142 3300048927 Bacteria 147311
471 Ga0496124_0000752 3300048927 Bacteria 53203
472 Ga0496124_0005548 3300048927 Bacteria 14132
473 Ga0496124_0014887 3300048927 Bacteria 7493
474 Ga0496124_0016817 3300048927 Bacteria 6933
475 Ga0496124_0036208 3300048927 Bacteria 4307
476 Ga0496124_0080350 3300048927 Bacteria 2683
477 Ga0496124_0091332 3300048927 Bacteria 2481
478 Ga0496124_0225442 3300048927 Bacteria 1405
479 Ga0496124_0424648 3300048927 Bacteria 914
480 Ga0496125_0000032 3300048928 Bacteria 354078
481 Ga0496125_0012180 3300048928 Bacteria 8557
482 Ga0496125_0014644 3300048928 Bacteria 7624
483 Ga0496125_0130052 3300048928 Bacteria 1774
484 Ga0496125_0153726 3300048928 Bacteria 1575
485 Ga0496125_0228612 3300048928 Bacteria 1191
486 Ga0496125_0272783 3300048928 Bacteria 1053
487 Ga0496126_0001047 3300048929 Bacteria 46742
488 Ga0496126_0001791 3300048929 Bacteria 31600
489 Ga0496126_0001986 3300048929 Bacteria 28995
490 Ga0496126_0007124 3300048929 Bacteria 12318
491 Ga0496126_0081356 3300048929 Bacteria 2863
492 Ga0496126_0243981 3300048929 Bacteria 1499
493 Ga0496126_0264022 3300048929 Bacteria 1431
494 Ga0496126_0286725 3300048929 Bacteria 1362
495 Ga0501310_000033 3300049130 Bacteria 13708
496 Ga0501344_01190 3300049133 Bacteria 1228
497 Ga0501305_000050 3300049161 Bacteria 6655
498 Ga0501312_000074 3300049528 Bacteria 5775
499 Ga0501315_002559 3300049531 Bacteria 1727
500 Ga0501323_001080 3300049539 Bacteria 2299
501 Ga0501335_000280 3300049551 Bacteria 2974
502 Ga0501048_0250997 3300049582 Bacteria 1256
503 Ga0501077_0240025 3300049593 Bacteria 1152
504 Ga0501217_008298 3300049661 Bacteria 2241
505 Ga0501217_018679 3300049661 Bacteria 1612
506 Ga0501221_014808 3300049704 Bacteria 1456
507 nmdc:mga00v17_45434_c1 3300050491 Bacteria 2654
508 nmdc:mga00v17_985_c1 3300050491 Bacteria 15250
509 nmdc:mga0k408_5884_c1 3300050493 Bacteria 3910
510 nmdc:mga05p37_1668_c1 3300050507 Bacteria 20182
511 nmdc:mga05p37_922247_c1 3300050507 Unclassified 939
512 nmdc:mga09592_109452_c1 3300050508 Bacteria 2370
513 nmdc:mga09592_41763_c1 3300050508 Bacteria 3857
514 nmdc:mga09592_42910_c1 3300050508 Bacteria 3805
515 nmdc:mga0qj67_221206_c1 3300050509 Bacteria 1537
516 Ga0495619_0007903 3300053085 Bacteria 6730
517 Ga0500566_0100258 3300053094 Bacteria 1589
518 Ga0500566_0233383 3300053094 Bacteria 906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1725380 Ga0436365_1725380_508_1095 191
2 3300035088 Ga0373940_0123127 Ga0373940_0123127_12_611 195
3 3300044712 Ga0453684_0002604 Ga0453684_0002604_48_659 201
4 3300039093 Ga0400489_87447 Ga0400489_87447_4432_5121 211
5 3300049130 Ga0501310_000033 Ga0501310_000033_1633_2301 215
6 3300053094 Ga0500566_0100258 Ga0500566_0100258_685_1353 215
7 3300053094 Ga0500566_0233383 Ga0500566_0233383_198_866 215
8 3300041456 Ga0451795_0258668 Ga0451795_0258668_85_744 218
9 3300039062 Ga0400483_146137 Ga0400483_146137_1504_2190 220
10 3300044712 Ga0453684_0928954 Ga0453684_0928954_244_912 220
11 3300031903 Ga0307407_10201935 Ga0307407_102019352 222
12 3300031911 Ga0307412_10901792 Ga0307412_109017921 222
13 iso_pu_bacteria 2565956521 2566036403 224
14 iso_pu_bacteria 2808606399 2809056138 224
15 iso_pu_bacteria 2860837431 2860840538 224
16 iso_pu_bacteria 2962290636 2962293744 224
17 iso_pu_bacteria 2969136845 2969139742 224
18 iso_pu_bacteria 2969765954 2969769776 224
19 iso_pu_bacteria 2969770375 2969772852 224
20 iso_pu_bacteria 2980492589 2980495531 224
21 iso_pu_bacteria 2919493220 2919494591 225
22 iso_pu_bacteria 2919543075 2919543592 225
23 3300005295 Ga0065707_10254824 Ga0065707_102548241 226
24 3300028666 Ga0265336_10008571 Ga0265336_100085713 226
25 3300031691 Ga0316579_10069537 Ga0316579_100695372 226
26 3300031727 Ga0316576_10014461 Ga0316576_100144614 226
27 3300031727 Ga0316576_10054359 Ga0316576_100543592 226
28 3300031728 Ga0316578_10026251 Ga0316578_100262512 226
29 3300031728 Ga0316578_10037731 Ga0316578_100377312 226
30 3300032137 Ga0316585_10121997 Ga0316585_101219972 226
31 3300032139 Ga0316580_10012196 Ga0316580_100121963 226
32 3300035398 Ga0316574_0006729 Ga0316574_0006729_2759_3448 226
33 3300035398 Ga0316574_0026500 Ga0316574_0026500_959_1651 226
34 3300035398 Ga0316574_0257317 Ga0316574_0257317_51_737 226
35 3300036647 Ga0316582_0061277 Ga0316582_0061277_624_1310 226
36 3300036647 Ga0316582_0393728 Ga0316582_0393728_142_831 226
37 3300036712 Ga0316584_0020974 Ga0316584_0020974_2738_3430 226
38 3300036712 Ga0316584_0060325 Ga0316584_0060325_1310_1996 226
39 3300036712 Ga0316584_0221568 Ga0316584_0221568_218_904 226
40 3300044673 Ga0453683_0000740 Ga0453683_0000740_8235_8921 226
41 3300044712 Ga0453684_0004135 Ga0453684_0004135_5948_6646 226
42 3300044712 Ga0453684_0006996 Ga0453684_0006996_765_1448 226
43 3300045051 Ga0451576_0081174 Ga0451576_0081174_312_998 226
44 3300045051 Ga0451576_0739878 Ga0451576_0739878_268_966 226
45 iso_pu_bacteria 2738541295 2738815185 226
46 iso_pu_bacteria 2738543010 2739233354 226
47 iso_pu_bacteria 2932406140 2932408431 226
48 iso_pu_bacteria 2939577877 2939580092 226
49 iso_pu_bacteria 2956897341 2956899119 226
50 iso_pu_bacteria 3001267043 3001269382 226
51 iso_pu_bacteria 3006826541 3006829131 226
52 iso_pu_bacteria 3006984091 3006986720 226
53 iso_pu_bacteria 3006988479 3006991215 226
54 iso_pu_bacteria 8054795415 8054803524 226
55 3300006946 Ga0079104_1013908 Ga0079104_10139082 227
56 3300028653 Ga0265323_10000756 Ga0265323_1000075612 227
57 3300028800 Ga0265338_10099445 Ga0265338_100994452 227
58 3300031344 Ga0265316_10024434 Ga0265316_100244343 227
59 3300031727 Ga0316576_10004932 Ga0316576_100049325 227
60 3300031727 Ga0316576_10057657 Ga0316576_100576572 227
61 3300031727 Ga0316576_10082773 Ga0316576_100827732 227
62 3300031727 Ga0316576_10154652 Ga0316576_101546522 227
63 3300031728 Ga0316578_10057193 Ga0316578_100571932 227
64 3300031733 Ga0316577_10035558 Ga0316577_100355582 227
65 3300032137 Ga0316585_10040395 Ga0316585_100403952 227
66 3300035398 Ga0316574_0310412 Ga0316574_0310412_65_748 227
67 3300036647 Ga0316582_0132845 Ga0316582_0132845_801_1490 227
68 3300036712 Ga0316584_0042324 Ga0316584_0042324_1020_1709 227
69 3300042876 Ga0451577_0000034 Ga0451577_0000034_105458_106144 227
70 3300042876 Ga0451577_0001439 Ga0451577_0001439_24370_25059 227
71 3300042876 Ga0451577_0010954 Ga0451577_0010954_7500_8189 227
72 3300042876 Ga0451577_0045646 Ga0451577_0045646_2381_3067 227
73 3300042876 Ga0451577_0169231 Ga0451577_0169231_572_1258 227
74 3300042876 Ga0451577_0182773 Ga0451577_0182773_238_948 227
75 3300042876 Ga0451577_0521760 Ga0451577_0521760_51_737 227
76 3300044673 Ga0453683_0000023 Ga0453683_0000023_72631_73347 227
77 3300044673 Ga0453683_0000057 Ga0453683_0000057_78719_79405 227
78 3300044673 Ga0453683_0028426 Ga0453683_0028426_344_1030 227
79 3300044712 Ga0453684_0000098 Ga0453684_0000098_105458_106144 227
80 3300044712 Ga0453684_0000329 Ga0453684_0000329_6020_6706 227
81 3300044712 Ga0453684_0000467 Ga0453684_0000467_20239_20928 227
82 3300044712 Ga0453684_0000610 Ga0453684_0000610_34173_34862 227
83 3300044712 Ga0453684_0004838 Ga0453684_0004838_4093_4779 227
84 3300044712 Ga0453684_0006927 Ga0453684_0006927_18885_19571 227
85 3300044712 Ga0453684_0009059 Ga0453684_0009059_4093_4779 227
86 3300044712 Ga0453684_0020927 Ga0453684_0020927_1991_2683 227
87 3300044712 Ga0453684_0022514 Ga0453684_0022514_7626_8312 227
88 3300044712 Ga0453684_0056779 Ga0453684_0056779_248_934 227
89 3300044712 Ga0453684_0089429 Ga0453684_0089429_2093_2779 227
90 3300044712 Ga0453684_0150428 Ga0453684_0150428_158_844 227
91 3300044712 Ga0453684_0184831 Ga0453684_0184831_1687_2373 227
92 3300044712 Ga0453684_0236213 Ga0453684_0236213_145_831 227
93 3300044712 Ga0453684_0532340 Ga0453684_0532340_26_712 227
94 3300044712 Ga0453684_1019455 Ga0453684_1019455_119_805 227
95 3300045051 Ga0451576_0000036 Ga0451576_0000036_270040_270726 227
96 3300045051 Ga0451576_0000193 Ga0451576_0000193_119243_119932 227
97 3300045051 Ga0451576_0006247 Ga0451576_0006247_11470_12156 227
98 3300045051 Ga0451576_0021213 Ga0451576_0021213_3712_4398 227
99 3300045051 Ga0451576_0042446 Ga0451576_0042446_3292_3978 227
100 3300045051 Ga0451576_0085029 Ga0451576_0085029_1584_2270 227
101 3300045051 Ga0451576_0219870 Ga0451576_0219870_283_969 227
102 iso_pu_bacteria 2537561728 2538426715 227
103 iso_pu_bacteria 2547132181 2547696589 227
104 iso_pu_bacteria 2554235234 2555261804 227
105 iso_pu_bacteria 2561511199 2562465953 227
106 iso_pu_bacteria 2599185169 2599412165 227
107 iso_pu_bacteria 2600255254 2601525354 227
108 iso_pu_bacteria 2600255255 2601530673 227
109 iso_pu_bacteria 2600255256 2601534001 227
110 iso_pu_bacteria 2600255257 2601540169 227
111 iso_pu_bacteria 2600255280 2601617476 227
112 iso_pu_bacteria 2600255281 2601622509 227
113 iso_pu_bacteria 2600255287 2601644582 227
114 iso_pu_bacteria 2600255288 2601650784 227
115 iso_pu_bacteria 2600255289 2601655834 227
116 iso_pu_bacteria 2600255290 2601660886 227
117 iso_pu_bacteria 2600255291 2601664747 227
118 iso_pu_bacteria 2600255298 2601697385 227
119 iso_pu_bacteria 2600255299 2601702773 227
120 iso_pu_bacteria 2600255300 2601708599 227
121 iso_pu_bacteria 2600255301 2601713458 227
122 iso_pu_bacteria 2600255302 2601718683 227
123 iso_pu_bacteria 2600255303 2601722568 227
124 iso_pu_bacteria 2600255304 2601728836 227
125 iso_pu_bacteria 2600255305 2601733759 227
126 iso_pu_bacteria 2600255306 2601738734 227
127 iso_pu_bacteria 2600255307 2601742934 227
128 iso_pu_bacteria 2600255309 2601753727 227
129 iso_pu_bacteria 2600255310 2601758848 227
130 iso_pu_bacteria 2600255311 2601762802 227
131 iso_pu_bacteria 2600255392 2602020742 227
132 iso_pu_bacteria 2602042046 2603640654 227
133 iso_pu_bacteria 2602042047 2603644568 227
134 iso_pu_bacteria 2602042052 2603662936 227
135 iso_pu_bacteria 2602042053 2603667833 227
136 iso_pu_bacteria 2602042066 2603700422 227
137 iso_pu_bacteria 2602042067 2603705970 227
138 iso_pu_bacteria 2602042103 2603841152 227
139 iso_pu_bacteria 2602042104 2603846225 227
140 iso_pu_bacteria 2602042105 2603851299 227
141 iso_pu_bacteria 2602042106 2603856367 227
142 iso_pu_bacteria 2602042109 2603868592 227
143 iso_pu_bacteria 2602042110 2603873947 227
144 iso_pu_bacteria 2602042111 2603878642 227
145 iso_pu_bacteria 2603880178 2606051126 227
146 iso_pu_bacteria 2603880184 2606072236 227
147 iso_pu_bacteria 2603880202 2606148942 227
148 iso_pu_bacteria 2603880211 2606179018 227
149 iso_pu_bacteria 2609459761 2609911921 227
150 iso_pu_bacteria 2636415599 2637227115 227
151 iso_pu_bacteria 2654587920 2656279685 227
152 iso_pu_bacteria 2667528172 2671103668 227
153 iso_pu_bacteria 2675903046 2676409397 227
154 iso_pu_bacteria 2681812866 2681996880 227
155 iso_pu_bacteria 2681812869 2682008668 227
156 iso_pu_bacteria 2687453601 2689445264 227
157 iso_pu_bacteria 2711768156 2712471155 227
158 iso_pu_bacteria 2738543017 2739269212 227
159 iso_pu_bacteria 2751185917 2753854598 227
160 iso_pu_bacteria 2765235842 2765587465 227
161 iso_pu_bacteria 2775506706 2775540846 227
162 iso_pu_bacteria 2775507074 2777021513 227
163 iso_pu_bacteria 2791354903 2791924281 227
164 iso_pu_bacteria 2791355010 2792313364 227
165 iso_pu_bacteria 2791355275 2793404119 227
166 iso_pu_bacteria 2811995292 2813730584 227
167 iso_pu_bacteria 2814123068 2814698191 227
168 iso_pu_bacteria 2821118458 2821121460 227
169 iso_pu_bacteria 2823373977 2823377415 227
170 iso_pu_bacteria 2844425489 2844426151 227
171 iso_pu_bacteria 2857586860 2857589651 227
172 iso_pu_bacteria 2858466076 2858468841 227
173 iso_pu_bacteria 2871272651 2871272651 227
174 iso_pu_bacteria 2871282230 2871284766 227
175 iso_pu_bacteria 2884086401 2884090459 227
176 iso_pu_bacteria 2891670763 2891674690 227
177 iso_pu_bacteria 2904513164 2904516162 227
178 iso_pu_bacteria 2919108558 2919112631 227
179 iso_pu_bacteria 2923634449 2923637990 227
180 iso_pu_bacteria 2927833300 2927835572 227
181 iso_pu_bacteria 2935625433 2935627953 227
182 iso_pu_bacteria 2937539931 2937544454 227
183 iso_pu_bacteria 2939568625 2939571549 227
184 iso_pu_bacteria 2939573065 2939576082 227
185 iso_pu_bacteria 2939607340 2939609461 227
186 iso_pu_bacteria 2939617950 2939619626 227
187 iso_pu_bacteria 2939642701 2939646042 227
188 iso_pu_bacteria 2945874760 2945879745 227
189 iso_pu_bacteria 2969079654 2969084129 227
190 iso_pu_bacteria 2971820967 2971825622 227
191 iso_pu_bacteria 2974310843 2974313603 227
192 iso_pu_bacteria 2974435778 2974436981 227
193 iso_pu_bacteria 2984559226 2984561206 227
194 iso_pu_bacteria 2984595703 2984599279 227
195 iso_pu_bacteria 3000376612 3000380504 227
196 iso_pu_bacteria 8018221730 8018224032 227
197 iso_pu_bacteria 8018405270 8018410054 227
198 iso_pu_bacteria 8019504834 8019506852 227
199 iso_pu_bacteria 8054844752 8054848691 227
200 iso_pu_bacteria 8054849141 8054853874 227
201 iso_pu_bacteria 8055087960 8055092576 227
202 iso_pu_bacteria 8055092621 8055092865 227
203 iso_pu_bacteria 8055097453 8055100645 227
204 iso_pu_bacteria 8057304971 8057307317 227
205 3300005434 Ga0070709_10143249 Ga0070709_101432492 228
206 3300005445 Ga0070708_100188459 Ga0070708_1001884592 228
207 3300005467 Ga0070706_100129629 Ga0070706_1001296292 228
208 3300005467 Ga0070706_100494330 Ga0070706_1004943301 228
209 3300005468 Ga0070707_100077768 Ga0070707_1000777682 228
210 3300005471 Ga0070698_100014496 Ga0070698_1000144965 228
211 3300005536 Ga0070697_100176777 Ga0070697_1001767773 228
212 3300005536 Ga0070697_100218184 Ga0070697_1002181842 228
213 3300005536 Ga0070697_100325462 Ga0070697_1003254621 228
214 3300025906 Ga0207699_10263592 Ga0207699_102635922 228
215 3300025910 Ga0207684_10369962 Ga0207684_103699621 228
216 3300025922 Ga0207646_10016758 Ga0207646_100167581 228
217 3300025939 Ga0207665_10047997 Ga0207665_100479973 228
218 3300031344 Ga0265316_10000177 Ga0265316_1000017715 228
219 3300031727 Ga0316576_10264715 Ga0316576_102647151 228
220 3300031727 Ga0316576_10437178 Ga0316576_104371782 228
221 3300031733 Ga0316577_10044141 Ga0316577_100441412 228
222 3300035120 Ga0373957_0115414 Ga0373957_0115414_129_833 228
223 3300036401 Ga0373937_0410499 Ga0373937_0410499_225_929 228
224 3300036712 Ga0316584_0134792 Ga0316584_0134792_1011_1724 228
225 3300036712 Ga0316584_0367170 Ga0316584_0367170_271_960 228
226 3300037853 Ga0436364_1125312 Ga0436364_1125312_8467_9171 228
227 3300039437 Ga0436365_1307659 Ga0436365_1307659_482_1186 228
228 3300039437 Ga0436365_1712226 Ga0436365_1712226_486_1181 228
229 3300041511 Ga0451855_0278396 Ga0451855_0278396_409_1173 228
230 3300044673 Ga0453683_0015084 Ga0453683_0015084_3522_4217 228
231 3300044694 Ga0466963_0248447 Ga0466963_0248447_442_1131 228
232 3300044712 Ga0453684_0067269 Ga0453684_0067269_115_810 228
233 3300044712 Ga0453684_0283585 Ga0453684_0283585_1176_1871 228
234 3300046514 Ga0495618_0060428 Ga0495618_0060428_1490_2194 228
235 3300047322 Ga0495680_0365837 Ga0495680_0365837_84_788 228
236 3300048908 Ga0496105_0355624 Ga0496105_0355624_70_804 228
237 3300049582 Ga0501048_0250997 Ga0501048_0250997_345_1058 228
238 3300053085 Ga0495619_0007903 Ga0495619_0007903_826_1530 228
239 iso_pu_bacteria 2599185299 2599927832 228
240 iso_pu_bacteria 2648501693 2650898555 228
241 iso_pu_bacteria 2684622997 2686354734 228
242 iso_pu_bacteria 2808606414 2809125810 228
243 iso_pu_bacteria 2847085930 2847089414 228
244 iso_pu_bacteria 2847797336 2847801694 228
245 iso_pu_bacteria 2881609920 2881612093 228
246 iso_pu_bacteria 2908669403 2908671642 228
247 iso_pu_bacteria 2984494565 2984498449 228
248 iso_pu_bacteria 2990261002 2990263550 228
249 2162886007 SwRhRL2b_contig_2664570 SwRhRL2b_0808.00003640 229
250 2162886007 SwRhRL2b_contig_2998025 SwRhRL2b_0749.00006780 229
251 3300005289 Ga0065704_10173393 Ga0065704_101733931 229
252 3300005295 Ga0065707_10001120 Ga0065707_100011206 229
253 3300005295 Ga0065707_10082652 Ga0065707_1008265211 229
254 3300005340 Ga0070689_100051521 Ga0070689_1000515213 229
255 3300005340 Ga0070689_100245755 Ga0070689_1002457552 229
256 3300005844 Ga0068862_100082899 Ga0068862_1000828992 229
257 3300006844 Ga0075428_100269776 Ga0075428_1002697762 229
258 3300006847 Ga0075431_100069741 Ga0075431_1000697412 229
259 3300006880 Ga0075429_100006419 Ga0075429_1000064194 229
260 3300006880 Ga0075429_100037993 Ga0075429_1000379933 229
261 3300009147 Ga0114129_10035325 Ga0114129_100353252 229
262 3300009147 Ga0114129_10080402 Ga0114129_100804022 229
263 3300009147 Ga0114129_10098705 Ga0114129_100987054 229
264 3300009553 Ga0105249_10031720 Ga0105249_100317202 229
265 3300009553 Ga0105249_10081775 Ga0105249_100817752 229
266 3300025917 Ga0207660_10177379 Ga0207660_101773792 229
267 3300025935 Ga0207709_10148531 Ga0207709_101485312 229
268 3300025961 Ga0207712_10396398 Ga0207712_103963982 229
269 3300026075 Ga0207708_10055397 Ga0207708_100553972 229
270 3300026095 Ga0207676_10074403 Ga0207676_100744032 229
271 3300026118 Ga0207675_100097033 Ga0207675_1000970332 229
272 3300028380 Ga0268265_10008633 Ga0268265_100086337 229
273 3300031665 Ga0316575_10002962 Ga0316575_100029623 229
274 3300031691 Ga0316579_10041372 Ga0316579_100413722 229
275 3300031691 Ga0316579_10048920 Ga0316579_100489202 229
276 3300031691 Ga0316579_10121053 Ga0316579_101210532 229
277 3300031691 Ga0316579_10220802 Ga0316579_102208021 229
278 3300031727 Ga0316576_10170439 Ga0316576_101704392 229
279 3300031727 Ga0316576_10187906 Ga0316576_101879062 229
280 3300031728 Ga0316578_10086564 Ga0316578_100865641 229
281 3300031728 Ga0316578_10164880 Ga0316578_101648802 229
282 3300031728 Ga0316578_10244789 Ga0316578_102447892 229
283 3300031733 Ga0316577_10007486 Ga0316577_100074863 229
284 3300031733 Ga0316577_10009597 Ga0316577_100095974 229
285 3300031733 Ga0316577_10035302 Ga0316577_100353022 229
286 3300031733 Ga0316577_10285308 Ga0316577_102853082 229
287 3300031824 Ga0307413_10264942 Ga0307413_102649422 229
288 3300031852 Ga0307410_10011475 Ga0307410_100114752 229
289 3300032126 Ga0307415_100600049 Ga0307415_1006000491 229
290 3300032133 Ga0316583_10094676 Ga0316583_100946761 229
291 3300032137 Ga0316585_10116758 Ga0316585_101167581 229
292 3300035398 Ga0316574_0000589 Ga0316574_0000589_6876_7577 229
293 3300035398 Ga0316574_0023975 Ga0316574_0023975_284_976 229
294 3300036647 Ga0316582_0001000 Ga0316582_0001000_9023_9724 229
295 3300036647 Ga0316582_0015287 Ga0316582_0015287_792_1484 229
296 3300036647 Ga0316582_0023449 Ga0316582_0023449_216_917 229
297 3300036647 Ga0316582_0052444 Ga0316582_0052444_236_937 229
298 3300036712 Ga0316584_0018941 Ga0316584_0018941_2979_3680 229
299 3300036712 Ga0316584_0031976 Ga0316584_0031976_3134_3835 229
300 3300036712 Ga0316584_0107126 Ga0316584_0107126_562_1254 229
301 3300036712 Ga0316584_0150480 Ga0316584_0150480_578_1267 229
302 3300036712 Ga0316584_0258312 Ga0316584_0258312_534_1244 229
303 3300036712 Ga0316584_0266959 Ga0316584_0266959_390_1082 229
304 3300037588 Ga0316581_0007933 Ga0316581_0007933_2008_2709 229
305 3300037588 Ga0316581_0018289 Ga0316581_0018289_97_798 229
306 3300042876 Ga0451577_0000010 Ga0451577_0000010_227921_228613 229
307 3300042876 Ga0451577_0008642 Ga0451577_0008642_5455_6150 229
308 3300042876 Ga0451577_0016728 Ga0451577_0016728_2480_3181 229
309 3300042876 Ga0451577_0019701 Ga0451577_0019701_5095_5787 229
310 3300042876 Ga0451577_0069418 Ga0451577_0069418_1144_1845 229
311 3300042876 Ga0451577_0268020 Ga0451577_0268020_35_733 229
312 3300044673 Ga0453683_0007897 Ga0453683_0007897_1552_2253 229
313 3300044673 Ga0453683_0103925 Ga0453683_0103925_33_734 229
314 3300044673 Ga0453683_0130171 Ga0453683_0130171_32_733 229
315 3300044673 Ga0453683_0203744 Ga0453683_0203744_454_1146 229
316 3300044712 Ga0453684_0000130 Ga0453684_0000130_120407_121099 229
317 3300044712 Ga0453684_0000430 Ga0453684_0000430_38207_38953 229
318 3300044712 Ga0453684_0000535 Ga0453684_0000535_60782_61483 229
319 3300044712 Ga0453684_0017644 Ga0453684_0017644_9110_9799 229
320 3300044712 Ga0453684_0027253 Ga0453684_0027253_1603_2298 229
321 3300044712 Ga0453684_0056768 Ga0453684_0056768_2734_3435 229
322 3300044712 Ga0453684_0057089 Ga0453684_0057089_4088_4792 229
323 3300044712 Ga0453684_0062134 Ga0453684_0062134_1350_2051 229
324 3300044712 Ga0453684_0065010 Ga0453684_0065010_1201_1902 229
325 3300044712 Ga0453684_0082222 Ga0453684_0082222_1477_2178 229
326 3300044712 Ga0453684_0088457 Ga0453684_0088457_2884_3576 229
327 3300044712 Ga0453684_0105401 Ga0453684_0105401_263_964 229
328 3300044712 Ga0453684_0119103 Ga0453684_0119103_832_1530 229
329 3300044712 Ga0453684_0148299 Ga0453684_0148299_411_1103 229
330 3300044712 Ga0453684_0173183 Ga0453684_0173183_1193_1894 229
331 3300044712 Ga0453684_0191063 Ga0453684_0191063_632_1327 229
332 3300044712 Ga0453684_0295973 Ga0453684_0295973_762_1454 229
333 3300044712 Ga0453684_0369536 Ga0453684_0369536_477_1172 229
334 3300044712 Ga0453684_0415687 Ga0453684_0415687_531_1229 229
335 3300044712 Ga0453684_0445744 Ga0453684_0445744_53_787 229
336 3300045051 Ga0451576_0000045 Ga0451576_0000045_291699_292388 229
337 3300045051 Ga0451576_0000353 Ga0451576_0000353_42016_42708 229
338 3300045051 Ga0451576_0014734 Ga0451576_0014734_2174_2875 229
339 3300045051 Ga0451576_0050453 Ga0451576_0050453_1436_2137 229
340 3300045051 Ga0451576_0141127 Ga0451576_0141127_1322_2014 229
341 3300045051 Ga0451576_0218717 Ga0451576_0218717_178_879 229
342 3300049593 Ga0501077_0240025 Ga0501077_0240025_88_789 229
343 3300050507 nmdc:mga05p37_1668_c1 nmdc:mga05p37_1668_c1_297_998 229
344 3300050507 nmdc:mga05p37_922247_c1 nmdc:mga05p37_922247_c1_47_736 229
345 3300050508 nmdc:mga09592_109452_c1 nmdc:mga09592_109452_c1_1315_2016 229
346 3300050508 nmdc:mga09592_41763_c1 nmdc:mga09592_41763_c1_659_1348 229
347 3300050508 nmdc:mga09592_42910_c1 nmdc:mga09592_42910_c1_2871_3572 229
348 3300050509 nmdc:mga0qj67_221206_c1 nmdc:mga0qj67_221206_c1_26_727 229
349 3300009036 Ga0105244_10024056 Ga0105244_100240562 230
350 3300027312 Ga0209371_1004228 Ga0209371_10042283 230
351 3300030500 Ga0268256_1002459 Ga0268256_10024593 230
352 3300031731 Ga0307405_10120791 Ga0307405_101207912 230
353 3300031995 Ga0307409_100006496 Ga0307409_1000064964 230
354 3300032002 Ga0307416_100220178 Ga0307416_1002201782 230
355 3300044673 Ga0453683_0016365 Ga0453683_0016365_393_1091 230
356 3300046810 Ga0495660_0020556 Ga0495660_0020556_2362_3057 230
357 3300048904 Ga0496101_0701614 Ga0496101_0701614_14_745 230
358 3300048905 Ga0496102_0084013 Ga0496102_0084013_1821_2552 230
359 3300048915 Ga0496112_0064546 Ga0496112_0064546_231_926 230
360 3300048916 Ga0496113_0079283 Ga0496113_0079283_1158_1853 230
361 3300048919 Ga0496116_0000980 Ga0496116_0000980_27980_28681 230
362 3300048925 Ga0496122_0001294 Ga0496122_0001294_197_889 230
363 3300048926 Ga0496123_0134907 Ga0496123_0134907_551_1243 230
364 3300048929 Ga0496126_0001047 Ga0496126_0001047_5571_6263 230
365 3300048929 Ga0496126_0264022 Ga0496126_0264022_282_980 230
366 3300049133 Ga0501344_01190 Ga0501344_01190_401_1120 230
367 3300049161 Ga0501305_000050 Ga0501305_000050_2298_3017 230
368 3300049528 Ga0501312_000074 Ga0501312_000074_3143_3862 230
369 3300049531 Ga0501315_002559 Ga0501315_002559_73_792 230
370 3300049539 Ga0501323_001080 Ga0501323_001080_1085_1804 230
371 3300049551 Ga0501335_000280 Ga0501335_000280_2074_2793 230
372 3300049661 Ga0501217_008298 Ga0501217_008298_1000_1695 230
373 3300049661 Ga0501217_018679 Ga0501217_018679_13_732 230
374 3300049704 Ga0501221_014808 Ga0501221_014808_108_803 230
375 iso_pu_bacteria 2852103415 2852103427 230
376 2010549000 RicEn_C711 RicEn_13080 231
377 2162886007 SwRhRL2b_contig_303839 SwRhRL2b_0486.00007470 231
378 2162886007 SwRhRL2b_contig_477049 SwRhRL2b_0403.00003180 231
379 3300001989 JGI24739J22299_10003159 JGI24739J22299_100031594 231
380 3300003320 rootH2_10013040 rootH2_100130402 231
381 3300003856 Ga0058692_1003806 Ga0058692_10038063 231
382 3300003856 Ga0058692_1003977 Ga0058692_10039773 231
383 3300003856 Ga0058692_1004129 Ga0058692_10041293 231
384 3300003856 Ga0058692_1004240 Ga0058692_10042402 231
385 3300003856 Ga0058692_1018259 Ga0058692_10182592 231
386 3300003856 Ga0058692_1024985 Ga0058692_10249851 231
387 3300005289 Ga0065704_10000644 Ga0065704_1000064415 231
388 3300005289 Ga0065704_10002108 Ga0065704_100021088 231
389 3300005289 Ga0065704_10092089 Ga0065704_100920892 231
390 3300005289 Ga0065704_10110571 Ga0065704_101105711 231
391 3300005289 Ga0065704_10123095 Ga0065704_101230952 231
392 3300005548 Ga0070665_100000423 Ga0070665_10000042330 231
393 3300005548 Ga0070665_100158266 Ga0070665_1001582662 231
394 3300005577 Ga0068857_100000004 Ga0068857_10000000417 231
395 3300005834 Ga0068851_10020182 Ga0068851_100201822 231
396 3300005981 Ga0081538_10051707 Ga0081538_100517072 231
397 3300006051 Ga0075364_10002253 Ga0075364_100022533 231
398 3300006051 Ga0075364_10020926 Ga0075364_100209263 231
399 3300006058 Ga0075432_10100710 Ga0075432_101007101 231
400 3300006195 Ga0075366_10001298 Ga0075366_100012983 231
401 3300006946 Ga0079104_1000043 Ga0079104_1000043176 231
402 3300006946 Ga0079104_1000308 Ga0079104_100030823 231
403 3300006946 Ga0079104_1000473 Ga0079104_100047312 231
404 3300006946 Ga0079104_1001529 Ga0079104_100152911 231
405 3300006946 Ga0079104_1004294 Ga0079104_10042943 231
406 3300006946 Ga0079104_1005229 Ga0079104_10052293 231
407 3300006946 Ga0079104_1006890 Ga0079104_10068902 231
408 3300006946 Ga0079104_1007421 Ga0079104_10074212 231
409 3300009011 Ga0105251_10000448 Ga0105251_1000044810 231
410 3300009011 Ga0105251_10001028 Ga0105251_1000102814 231
411 3300009011 Ga0105251_10001203 Ga0105251_100012039 231
412 3300009011 Ga0105251_10001732 Ga0105251_1000173211 231
413 3300009011 Ga0105251_10002099 Ga0105251_1000209911 231
414 3300009011 Ga0105251_10002323 Ga0105251_1000232311 231
415 3300009011 Ga0105251_10007125 Ga0105251_100071256 231
416 3300009011 Ga0105251_10046026 Ga0105251_100460262 231
417 3300009011 Ga0105251_10062704 Ga0105251_100627042 231
418 3300009036 Ga0105244_10000039 Ga0105244_10000039111 231
419 3300009036 Ga0105244_10000064 Ga0105244_1000006447 231
420 3300009036 Ga0105244_10000093 Ga0105244_1000009340 231
421 3300009036 Ga0105244_10000440 Ga0105244_1000044019 231
422 3300009036 Ga0105244_10000538 Ga0105244_1000053824 231
423 3300009036 Ga0105244_10003071 Ga0105244_100030712 231
424 3300009036 Ga0105244_10015609 Ga0105244_100156093 231
425 3300009036 Ga0105244_10016389 Ga0105244_100163892 231
426 3300009036 Ga0105244_10018788 Ga0105244_100187883 231
427 3300009036 Ga0105244_10021942 Ga0105244_100219422 231
428 3300009036 Ga0105244_10053581 Ga0105244_100535812 231
429 3300009036 Ga0105244_10088235 Ga0105244_100882351 231
430 3300009092 Ga0105250_10000055 Ga0105250_1000005558 231
431 3300009092 Ga0105250_10001140 Ga0105250_1000114010 231
432 3300009092 Ga0105250_10053150 Ga0105250_100531502 231
433 3300009092 Ga0105250_10124141 Ga0105250_101241412 231
434 3300009093 Ga0105240_10121769 Ga0105240_101217691 231
435 3300009148 Ga0105243_10000559 Ga0105243_1000055929 231
436 3300009148 Ga0105243_10036319 Ga0105243_100363192 231
437 3300009148 Ga0105243_10818705 Ga0105243_108187051 231
438 3300009174 Ga0105241_10000002 Ga0105241_1000000255 231
439 3300011119 Ga0105246_10119484 Ga0105246_101194842 231
440 3300013100 Ga0157373_10003718 Ga0157373_1000371811 231
441 3300013100 Ga0157373_10026798 Ga0157373_100267983 231
442 3300013100 Ga0157373_10041455 Ga0157373_100414554 231
443 3300013100 Ga0157373_10066519 Ga0157373_100665192 231
444 3300013100 Ga0157373_10106325 Ga0157373_101063252 231
445 3300013102 Ga0157371_10000845 Ga0157371_1000084528 231
446 3300013102 Ga0157371_10000905 Ga0157371_1000090524 231
447 3300013102 Ga0157371_10024617 Ga0157371_100246172 231
448 3300013102 Ga0157371_10030959 Ga0157371_100309592 231
449 3300013104 Ga0157370_10000330 Ga0157370_1000033037 231
450 3300013105 Ga0157369_10009079 Ga0157369_100090793 231
451 3300013307 Ga0157372_10002076 Ga0157372_1000207613 231
452 3300013307 Ga0157372_10340993 Ga0157372_103409932 231
453 3300013307 Ga0157372_11018591 Ga0157372_110185912 231
454 3300015261 Ga0182006_1000013 Ga0182006_1000013128 231
455 3300015679 Ga0183366_1003 Ga0183366_1003147 231
456 3300015680 Ga0183370_1003 Ga0183370_1003273 231
457 3300015685 Ga0183369_1005 Ga0183369_1005273 231
458 3300015687 Ga0183368_1006 Ga0183368_1006146 231
459 3300021384 Ga0213876_10000026 Ga0213876_1000002666 231
460 3300025245 Ga0207425_1033570 Ga0207425_10335702 231
461 3300025258 Ga0209129_1000008 Ga0209129_1000008447 231
462 3300025711 Ga0207696_1000066 Ga0207696_100006650 231
463 3300025711 Ga0207696_1000154 Ga0207696_100015447 231
464 3300025711 Ga0207696_1000725 Ga0207696_10007257 231
465 3300025711 Ga0207696_1006727 Ga0207696_10067273 231
466 3300025711 Ga0207696_1009798 Ga0207696_10097983 231
467 3300025711 Ga0207696_1017009 Ga0207696_10170092 231
468 3300025728 Ga0207655_1000017 Ga0207655_1000017363 231
469 3300025728 Ga0207655_1000026 Ga0207655_1000026351 231
470 3300025728 Ga0207655_1000090 Ga0207655_1000090142 231
471 3300025728 Ga0207655_1000101 Ga0207655_1000101109 231
472 3300025728 Ga0207655_1000826 Ga0207655_100082613 231
473 3300025728 Ga0207655_1001735 Ga0207655_10017352 231
474 3300025728 Ga0207655_1006647 Ga0207655_10066474 231
475 3300025728 Ga0207655_1015340 Ga0207655_10153404 231
476 3300025728 Ga0207655_1018439 Ga0207655_10184392 231
477 3300025728 Ga0207655_1020569 Ga0207655_10205692 231
478 3300025728 Ga0207655_1046135 Ga0207655_10461352 231
479 3300025735 Ga0207713_1000008 Ga0207713_1000008475 231
480 3300025735 Ga0207713_1000039 Ga0207713_1000039122 231
481 3300025735 Ga0207713_1000048 Ga0207713_1000048153 231
482 3300025735 Ga0207713_1000057 Ga0207713_1000057157 231
483 3300025735 Ga0207713_1006358 Ga0207713_10063582 231
484 3300025735 Ga0207713_1010684 Ga0207713_10106843 231
485 3300025735 Ga0207713_1023518 Ga0207713_10235182 231
486 3300025735 Ga0207713_1047052 Ga0207713_10470523 231
487 3300025735 Ga0207713_1050801 Ga0207713_10508011 231
488 3300025735 Ga0207713_1074003 Ga0207713_10740032 231
489 3300025735 Ga0207713_1084802 Ga0207713_10848022 231
490 3300025911 Ga0207654_10000005 Ga0207654_1000000555 231
491 3300025913 Ga0207695_10113022 Ga0207695_101130222 231
492 3300025932 Ga0207690_10122807 Ga0207690_101228072 231
493 3300025935 Ga0207709_10002340 Ga0207709_100023404 231
494 3300025935 Ga0207709_10541177 Ga0207709_105411771 231
495 3300026116 Ga0207674_10000009 Ga0207674_1000000942 231
496 3300027111 Ga0209281_1000058 Ga0209281_1000058136 231
497 3300027111 Ga0209281_1000105 Ga0209281_100010524 231
498 3300027111 Ga0209281_1000137 Ga0209281_100013733 231
499 3300027111 Ga0209281_1000146 Ga0209281_100014627 231
500 3300027111 Ga0209281_1000440 Ga0209281_100044035 231
501 3300027111 Ga0209281_1001029 Ga0209281_10010298 231
502 3300027111 Ga0209281_1001204 Ga0209281_100120413 231
503 3300027111 Ga0209281_1002657 Ga0209281_10026572 231
504 3300027111 Ga0209281_1004533 Ga0209281_10045332 231
505 3300027312 Ga0209371_1000014 Ga0209371_1000014135 231
506 3300027312 Ga0209371_1000030 Ga0209371_100003079 231
507 3300027312 Ga0209371_1000054 Ga0209371_100005453 231
508 3300027312 Ga0209371_1000510 Ga0209371_10005106 231
509 3300027312 Ga0209371_1002128 Ga0209371_10021289 231
510 3300027312 Ga0209371_1002267 Ga0209371_10022675 231
511 3300027312 Ga0209371_1002466 Ga0209371_10024663 231
512 3300027312 Ga0209371_1003025 Ga0209371_10030252 231
513 3300027312 Ga0209371_1016426 Ga0209371_10164262 231
514 3300028379 Ga0268266_10000290 Ga0268266_1000029048 231
515 3300028379 Ga0268266_10136896 Ga0268266_101368962 231
516 3300030500 Ga0268256_1000012 Ga0268256_1000012640 231
517 3300030500 Ga0268256_1000021 Ga0268256_1000021129 231
518 3300030500 Ga0268256_1000025 Ga0268256_1000025132 231
519 3300030500 Ga0268256_1000440 Ga0268256_10004406 231
520 3300030500 Ga0268256_1001865 Ga0268256_10018659 231
521 3300030500 Ga0268256_1002008 Ga0268256_10020083 231
522 3300030500 Ga0268256_1002715 Ga0268256_10027152 231
523 3300030500 Ga0268256_1003480 Ga0268256_10034803 231
524 3300030500 Ga0268256_1008453 Ga0268256_10084533 231
525 3300030500 Ga0268256_1014390 Ga0268256_10143902 231
526 3300030500 Ga0268256_1019990 Ga0268256_10199902 231
527 3300030500 Ga0268256_1030911 Ga0268256_10309112 231
528 3300039437 Ga0436365_0084998 Ga0436365_0084998_155569_156264 231
529 3300041405 Ga0439438_003845 Ga0439438_003845_1139_1834 231
530 3300041507 Ga0451851_0368623 Ga0451851_0368623_257_955 231
531 3300041512 Ga0451853_4120536 Ga0451853_4120536_1905_2600 231
532 3300042006 Ga0439432_022525 Ga0439432_022525_133_831 231
533 3300042006 Ga0439432_027255 Ga0439432_027255_209_904 231
534 3300042010 Ga0439452_000004 Ga0439452_000004_153338_154036 231
535 3300042010 Ga0439452_000005 Ga0439452_000005_149796_150491 231
536 3300042010 Ga0439452_000011 Ga0439452_000011_373164_373859 231
537 3300042010 Ga0439452_000056 Ga0439452_000056_40234_40929 231
538 3300042010 Ga0439452_000271 Ga0439452_000271_25155_25850 231
539 3300042010 Ga0439452_001380 Ga0439452_001380_4339_5034 231
540 3300042137 Ga0450902_004120 Ga0450902_004120_1385_2080 231
541 3300042439 Ga0439464_0000139 Ga0439464_0000139_7835_8530 231
542 3300044669 Ga0466981_0000021 Ga0466981_0000021_59457_60152 231
543 3300046458 Ga0495591_000438 Ga0495591_000438_8246_8941 231
544 3300046458 Ga0495591_006106 Ga0495591_006106_1438_2133 231
545 3300046460 Ga0495638_0031438 Ga0495638_0031438_826_1521 231
546 3300046471 Ga0495650_0000028 Ga0495650_0000028_128547_129242 231
547 3300046471 Ga0495650_0033078 Ga0495650_0033078_264_959 231
548 3300046515 Ga0495620_0009456 Ga0495620_0009456_4088_4783 231
549 3300046520 Ga0495637_0038772 Ga0495637_0038772_709_1404 231
550 3300046522 Ga0495643_0101180 Ga0495643_0101180_646_1341 231
551 3300046530 Ga0495654_0010790 Ga0495654_0010790_2982_3677 231
552 3300046542 Ga0495597_0000550 Ga0495597_0000550_19243_19938 231
553 3300046660 Ga0495625_0093468 Ga0495625_0093468_239_934 231
554 3300046694 Ga0495649_0001014 Ga0495649_0001014_18876_19571 231
555 3300046694 Ga0495649_0001806 Ga0495649_0001806_12546_13241 231
556 3300046694 Ga0495649_0076731 Ga0495649_0076731_36_731 231
557 3300047320 Ga0495672_0000051 Ga0495672_0000051_89826_90521 231
558 3300047446 Ga0495679_000014 Ga0495679_000014_187733_188428 231
559 3300047446 Ga0495679_006997 Ga0495679_006997_4049_4744 231
560 3300047446 Ga0495679_030247 Ga0495679_030247_247_942 231
561 3300047469 Ga0495673_0000047 Ga0495673_0000047_116150_116845 231
562 3300048904 Ga0496101_0039196 Ga0496101_0039196_2419_3114 231
563 3300048907 Ga0496104_0016292 Ga0496104_0016292_653_1348 231
564 3300048907 Ga0496104_0104990 Ga0496104_0104990_614_1309 231
565 3300048907 Ga0496104_0494082 Ga0496104_0494082_225_920 231
566 3300048908 Ga0496105_0015305 Ga0496105_0015305_4080_4775 231
567 3300048919 Ga0496116_0000103 Ga0496116_0000103_39093_39791 231
568 3300048919 Ga0496116_0000181 Ga0496116_0000181_57916_58614 231
569 3300048919 Ga0496116_0001132 Ga0496116_0001132_18235_18930 231
570 3300048919 Ga0496116_0015488 Ga0496116_0015488_3309_4004 231
571 3300048919 Ga0496116_0025832 Ga0496116_0025832_2597_3292 231
572 3300048920 Ga0496117_0001953 Ga0496117_0001953_17236_17934 231
573 3300048920 Ga0496117_0003317 Ga0496117_0003317_12018_12794 231
574 3300048920 Ga0496117_0003529 Ga0496117_0003529_11779_12474 231
575 3300048920 Ga0496117_0003748 Ga0496117_0003748_14457_15152 231
576 3300048920 Ga0496117_0043720 Ga0496117_0043720_815_1510 231
577 3300048920 Ga0496117_0056184 Ga0496117_0056184_727_1422 231
578 3300048920 Ga0496117_0062227 Ga0496117_0062227_1744_2439 231
579 3300048920 Ga0496117_0089985 Ga0496117_0089985_44_739 231
580 3300048920 Ga0496117_0115106 Ga0496117_0115106_294_992 231
581 3300048921 Ga0496118_0001235 Ga0496118_0001235_17478_18176 231
582 3300048921 Ga0496118_0001510 Ga0496118_0001510_12767_13465 231
583 3300048921 Ga0496118_0004378 Ga0496118_0004378_13518_14294 231
584 3300048921 Ga0496118_0018944 Ga0496118_0018944_3133_3828 231
585 3300048921 Ga0496118_0117087 Ga0496118_0117087_822_1517 231
586 3300048922 Ga0496119_0000026 Ga0496119_0000026_59688_60383 231
587 3300048922 Ga0496119_0000160 Ga0496119_0000160_30757_31455 231
588 3300048922 Ga0496119_0000277 Ga0496119_0000277_23467_24165 231
589 3300048922 Ga0496119_0001719 Ga0496119_0001719_3689_4384 231
590 3300048922 Ga0496119_0013921 Ga0496119_0013921_2619_3314 231
591 3300048922 Ga0496119_0045750 Ga0496119_0045750_436_1131 231
592 3300048922 Ga0496119_0047167 Ga0496119_0047167_29_724 231
593 3300048922 Ga0496119_0066625 Ga0496119_0066625_741_1436 231
594 3300048922 Ga0496119_0228489 Ga0496119_0228489_227_922 231
595 3300048923 Ga0496120_0000038 Ga0496120_0000038_147946_148644 231
596 3300048923 Ga0496120_0000192 Ga0496120_0000192_72785_73483 231
597 3300048923 Ga0496120_0010415 Ga0496120_0010415_4662_5357 231
598 3300048923 Ga0496120_0015197 Ga0496120_0015197_2932_3627 231
599 3300048923 Ga0496120_0016564 Ga0496120_0016564_1628_2323 231
600 3300048923 Ga0496120_0027657 Ga0496120_0027657_104_799 231
601 3300048923 Ga0496120_0302828 Ga0496120_0302828_26_721 231
602 3300048924 Ga0496121_0003741 Ga0496121_0003741_8662_9357 231
603 3300048924 Ga0496121_0006806 Ga0496121_0006806_623_1399 231
604 3300048924 Ga0496121_0007864 Ga0496121_0007864_11926_12621 231
605 3300048924 Ga0496121_0007928 Ga0496121_0007928_10664_11359 231
606 3300048924 Ga0496121_0019455 Ga0496121_0019455_3300_3995 231
607 3300048924 Ga0496121_0036324 Ga0496121_0036324_2551_3246 231
608 3300048924 Ga0496121_0048673 Ga0496121_0048673_1574_2269 231
609 3300048925 Ga0496122_0000477 Ga0496122_0000477_57730_58425 231
610 3300048925 Ga0496122_0001657 Ga0496122_0001657_3169_3864 231
611 3300048925 Ga0496122_0005935 Ga0496122_0005935_662_1357 231
612 3300048925 Ga0496122_0011622 Ga0496122_0011622_643_1338 231
613 3300048925 Ga0496122_0022385 Ga0496122_0022385_3195_3890 231
614 3300048925 Ga0496122_0023208 Ga0496122_0023208_190_885 231
615 3300048925 Ga0496122_0123807 Ga0496122_0123807_613_1308 231
616 3300048925 Ga0496122_0144248 Ga0496122_0144248_382_1119 231
617 3300048925 Ga0496122_0281062 Ga0496122_0281062_149_844 231
618 3300048926 Ga0496123_0000019 Ga0496123_0000019_57730_58425 231
619 3300048926 Ga0496123_0000310 Ga0496123_0000310_43167_43862 231
620 3300048926 Ga0496123_0001352 Ga0496123_0001352_3163_3858 231
621 3300048926 Ga0496123_0002398 Ga0496123_0002398_21840_22535 231
622 3300048926 Ga0496123_0004178 Ga0496123_0004178_10237_10932 231
623 3300048926 Ga0496123_0016973 Ga0496123_0016973_3921_4616 231
624 3300048926 Ga0496123_0018931 Ga0496123_0018931_2305_3000 231
625 3300048926 Ga0496123_0030535 Ga0496123_0030535_2629_3363 231
626 3300048926 Ga0496123_0032475 Ga0496123_0032475_2236_2931 231
627 3300048927 Ga0496124_0000142 Ga0496124_0000142_60660_61355 231
628 3300048927 Ga0496124_0000752 Ga0496124_0000752_21196_21891 231
629 3300048927 Ga0496124_0005548 Ga0496124_0005548_1553_2248 231
630 3300048927 Ga0496124_0014887 Ga0496124_0014887_2841_3539 231
631 3300048927 Ga0496124_0016817 Ga0496124_0016817_4075_4770 231
632 3300048927 Ga0496124_0036208 Ga0496124_0036208_3192_3887 231
633 3300048927 Ga0496124_0080350 Ga0496124_0080350_1725_2420 231
634 3300048927 Ga0496124_0091332 Ga0496124_0091332_644_1339 231
635 3300048927 Ga0496124_0225442 Ga0496124_0225442_190_885 231
636 3300048927 Ga0496124_0424648 Ga0496124_0424648_176_871 231
637 3300048928 Ga0496125_0000032 Ga0496125_0000032_326915_327652 231
638 3300048928 Ga0496125_0012180 Ga0496125_0012180_7477_8172 231
639 3300048928 Ga0496125_0014644 Ga0496125_0014644_30_725 231
640 3300048928 Ga0496125_0130052 Ga0496125_0130052_1012_1707 231
641 3300048928 Ga0496125_0153726 Ga0496125_0153726_752_1447 231
642 3300048928 Ga0496125_0228612 Ga0496125_0228612_466_1161 231
643 3300048928 Ga0496125_0272783 Ga0496125_0272783_119_814 231
644 3300048929 Ga0496126_0001791 Ga0496126_0001791_23071_23805 231
645 3300048929 Ga0496126_0001986 Ga0496126_0001986_2311_3006 231
646 3300048929 Ga0496126_0007124 Ga0496126_0007124_5920_6615 231
647 3300048929 Ga0496126_0081356 Ga0496126_0081356_425_1120 231
648 3300048929 Ga0496126_0243981 Ga0496126_0243981_377_1114 231
649 3300048929 Ga0496126_0286725 Ga0496126_0286725_173_868 231
650 3300050491 nmdc:mga00v17_45434_c1 nmdc:mga00v17_45434_c1_680_1375 231
651 3300050491 nmdc:mga00v17_985_c1 nmdc:mga00v17_985_c1_3206_3901 231
652 3300050493 nmdc:mga0k408_5884_c1 nmdc:mga0k408_5884_c1_1932_2627 231
653 iso_pu_bacteria 2786546517 2787437951 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

26

215

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jdi-assembly1.cif.gz_A crystal structure of l-ribulose-5-phosphate 4-epimerase 0.9987 1 223
1k0w-assembly1.cif.gz_A crystal structure of l-ribulose-5-phosphate 4-epimerase 0.9985 1 223
1jdi-assembly1.cif.gz_A crystal structure of l-ribulose-5-phosphate 4-epimerase 0.9943 1 223
1k0w-assembly1.cif.gz_A crystal structure of l-ribulose-5-phosphate 4-epimerase 0.9941 1 223
2fua-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase crystal form t with cobalt 0.9117 1 225
ID Description Score Start End Superfamily
af_P39306_1_227_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9851 3 231 3.40.225.10
af_P39306_1_227_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9765 3 231 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9161 6 218 3.40.225.10
2fuaA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9117 1 225 3.40.225.10
2fuaA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8994 1 225 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A7H4PAB8-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 1.004 42 179 GO:0005829
GO:0008742
GO:0016832
GO:0019323
AF-A0A0P8HC15-F1-model_v4 deleted 1.004 80 201
AF-A0A5D8RDX5-F1-model_v4 deleted 1.004 63 175
AF-W1YBL3-F1-model_v4 L-ribulose-5-phosphate 4-epimerase SgbE 1.004 97 199 GO:0005829
GO:0016832
GO:0016853
GO:0019323
GO:0046872
AF-A0A7X2MN52-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 1.001 1 196 GO:0005829
GO:0016832
GO:0016853
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map