F472782

General Info

Members Datasets Scaffolds Average Seq Length
653 298 1306 125

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0425401|Ga0395901_0425401_540_905
Length 121
Sequence MASILVVDDEFGLLEVLEAVLSEAGHEVLTATNGRQGLERLEGAAVDLVLLDFMMPVMDGPAMFKALRATPALRRLPVLIMSSLPQATIAAELRGYAGFIRKPFRIREIVAAVEEALKKAG

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
246 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
247 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
248 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
273 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.31
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0425401 3300038443 Bacteria 1361
2 Ga0065707_10179276 3300005295 Bacteria 1429
3 Ga0065707_10218991 3300005295 Bacteria 1233
4 Ga0065707_10310648 3300005295 Bacteria 985
5 Ga0070683_100056461 3300005329 Bacteria 3647
6 Ga0070677_10053957 3300005333 Bacteria 1636
7 Ga0068869_100025632 3300005334 Bacteria 4096
8 Ga0068869_100505461 3300005334 Bacteria 1010
9 Ga0070680_100000789 3300005336 Bacteria 22263
10 Ga0070680_100066644 3300005336 Bacteria 2952
11 Ga0070680_100195611 3300005336 Bacteria 1705
12 Ga0070680_100296485 3300005336 Bacteria 1371
13 Ga0070680_101204795 3300005336 Bacteria 655
14 Ga0070682_100536766 3300005337 Bacteria 913
15 Ga0068868_100036776 3300005338 Bacteria 3792
16 Ga0070689_100000776 3300005340 Bacteria 19580
17 Ga0070689_100059601 3300005340 Bacteria 2967
18 Ga0070689_100209534 3300005340 Bacteria 1595
19 Ga0070689_100310094 3300005340 Bacteria 1315
20 Ga0070689_100848746 3300005340 Bacteria 806
21 Ga0070691_10105688 3300005341 Bacteria 1403
22 Ga0070691_10107556 3300005341 Bacteria 1392
23 Ga0070691_10488159 3300005341 Bacteria 710
24 Ga0070691_10532524 3300005341 Bacteria 684
25 Ga0070687_100008563 3300005343 Bacteria 4341
26 Ga0070687_100399831 3300005343 Bacteria 900
27 Ga0070687_101098502 3300005343 Unclassified 582
28 Ga0070692_10003588 3300005345 Bacteria 6326
29 Ga0070692_10029573 3300005345 Bacteria 2731
30 Ga0070692_10177689 3300005345 Bacteria 1232
31 Ga0070692_10384243 3300005345 Bacteria 882
32 Ga0070669_100525099 3300005353 Bacteria 984
33 Ga0070675_100076867 3300005354 Bacteria 2778
34 Ga0070674_100296382 3300005356 Bacteria 1288
35 Ga0070674_100501491 3300005356 Bacteria 1011
36 Ga0070673_101305577 3300005364 Bacteria 681
37 Ga0070688_100076589 3300005365 Bacteria 2153
38 Ga0070688_100383143 3300005365 Bacteria 1037
39 Ga0070667_101516252 3300005367 Bacteria 630
40 Ga0070703_10052387 3300005406 Bacteria 1309
41 Ga0070701_10008994 3300005438 Bacteria 4355
42 Ga0070701_10801064 3300005438 Bacteria 643
43 Ga0070711_101413048 3300005439 Bacteria 606
44 Ga0070705_100004915 3300005440 Bacteria 6511
45 Ga0070705_100073979 3300005440 Bacteria 2070
46 Ga0070705_100230827 3300005440 Bacteria 1287
47 Ga0070705_100783957 3300005440 Bacteria 757
48 Ga0070705_101448847 3300005440 Bacteria 574
49 Ga0070700_100006849 3300005441 Bacteria 6116
50 Ga0070700_100270448 3300005441 Bacteria 1227
51 Ga0070694_100011252 3300005444 Bacteria 5540
52 Ga0070694_100025193 3300005444 Bacteria 3848
53 Ga0070694_100029978 3300005444 Bacteria 3555
54 Ga0070694_100053791 3300005444 Bacteria 2726
55 Ga0070694_100139261 3300005444 Bacteria 1761
56 Ga0070694_100281234 3300005444 Bacteria 1269
57 Ga0070694_100512926 3300005444 Bacteria 956
58 Ga0070694_100577629 3300005444 Bacteria 903
59 Ga0070694_101272569 3300005444 Bacteria 618
60 Ga0070678_100615839 3300005456 Bacteria 971
61 Ga0070662_100333394 3300005457 Bacteria 1240
62 Ga0070681_10000235 3300005458 Bacteria 43570
63 Ga0068867_100000699 3300005459 Bacteria 22369
64 Ga0068867_100003806 3300005459 Bacteria 10612
65 Ga0068867_100414197 3300005459 Bacteria 1140
66 Ga0070706_100040437 3300005467 Bacteria 4304
67 Ga0070706_101524402 3300005467 Bacteria 611
68 Ga0070707_100870866 3300005468 Unclassified 865
69 Ga0070698_100189800 3300005471 Bacteria 1993
70 Ga0070699_100027831 3300005518 Bacteria 4876
71 Ga0070699_101077806 3300005518 Bacteria 737
72 Ga0070699_101853838 3300005518 Bacteria 552
73 Ga0070679_100064355 3300005530 Bacteria 3655
74 Ga0070697_100001807 3300005536 Bacteria 16334
75 Ga0070697_100777325 3300005536 Bacteria 847
76 Ga0068853_100544725 3300005539 Bacteria 1099
77 Ga0070672_101352226 3300005543 Bacteria 636
78 Ga0070686_100003904 3300005544 Bacteria 8194
79 Ga0070686_100044215 3300005544 Bacteria 2798
80 Ga0070686_100744277 3300005544 Bacteria 786
81 Ga0070686_100763162 3300005544 Bacteria 777
82 Ga0070686_101536248 3300005544 Bacteria 562
83 Ga0070695_100000113 3300005545 Bacteria 35966
84 Ga0070695_100001179 3300005545 Bacteria 14369
85 Ga0070695_100025621 3300005545 Bacteria 3643
86 Ga0070695_100042548 3300005545 Bacteria 2884
87 Ga0070695_100044910 3300005545 Bacteria 2815
88 Ga0070695_100201484 3300005545 Bacteria 1423
89 Ga0070695_100499315 3300005545 Bacteria 941
90 Ga0070695_101189723 3300005545 Bacteria 627
91 Ga0070696_100000434 3300005546 Bacteria 26295
92 Ga0070696_100001657 3300005546 Bacteria 14602
93 Ga0070696_100001672 3300005546 Bacteria 14528
94 Ga0070696_100165669 3300005546 Bacteria 1631
95 Ga0070696_100181774 3300005546 Bacteria 1560
96 Ga0070696_100190366 3300005546 Bacteria 1527
97 Ga0070696_100207841 3300005546 Bacteria 1464
98 Ga0070696_100209440 3300005546 Bacteria 1459
99 Ga0070696_101582430 3300005546 Bacteria 563
100 Ga0070693_100000209 3300005547 Bacteria 27275
101 Ga0070693_100109164 3300005547 Bacteria 1699
102 Ga0070704_100049067 3300005549 Bacteria 2959
103 Ga0070704_100070164 3300005549 Bacteria 2542
104 Ga0070704_100656972 3300005549 Bacteria 926
105 Ga0070704_100895616 3300005549 Bacteria 798
106 Ga0070704_101194410 3300005549 Bacteria 693
107 Ga0068855_100089138 3300005563 Bacteria 3562
108 Ga0068854_100001665 3300005578 Bacteria 13528
109 Ga0068856_100022176 3300005614 Bacteria 6174
110 Ga0070702_100001157 3300005615 Bacteria 10629
111 Ga0070702_100017482 3300005615 Bacteria 3699
112 Ga0070702_100416010 3300005615 Bacteria 966
113 Ga0068852_100237091 3300005616 Bacteria 1742
114 Ga0068859_100023270 3300005617 Bacteria 6217
115 Ga0068859_100437244 3300005617 Bacteria 1404
116 Ga0068859_101086832 3300005617 Bacteria 880
117 Ga0068866_10214512 3300005718 Bacteria 1157
118 Ga0068861_100003377 3300005719 Bacteria 10583
119 Ga0068870_10048915 3300005840 Bacteria 2228
120 Ga0068863_100429789 3300005841 Bacteria 1294
121 Ga0068858_100004085 3300005842 Bacteria 14380
122 Ga0068858_100693748 3300005842 Bacteria 990
123 Ga0068860_100627522 3300005843 Bacteria 1081
124 Ga0068862_100006699 3300005844 Bacteria 9558
125 Ga0068862_101831535 3300005844 Bacteria 616
126 Ga0081538_10213076 3300005981 Bacteria 776
127 Ga0081539_10000799 3300005985 Bacteria 61195
128 Ga0097621_100004646 3300006237 Bacteria 9585
129 Ga0097621_100009592 3300006237 Bacteria 7035
130 Ga0068871_100000788 3300006358 Bacteria 21290
131 Ga0068871_100001073 3300006358 Bacteria 18331
132 Ga0075428_100003728 3300006844 Bacteria 16711
133 Ga0075428_100021034 3300006844 Bacteria 7225
134 Ga0075428_100197727 3300006844 Bacteria 2174
135 Ga0075428_100944672 3300006844 Bacteria 914
136 Ga0075428_101560937 3300006844 Bacteria 691
137 Ga0075430_100002931 3300006846 Bacteria 14267
138 Ga0075430_100014127 3300006846 Bacteria 6808
139 Ga0075430_100018269 3300006846 Bacteria 5969
140 Ga0075430_100053434 3300006846 Bacteria 3401
141 Ga0075430_100280586 3300006846 Bacteria 1378
142 Ga0075431_100105084 3300006847 Bacteria 2914
143 Ga0075431_100133277 3300006847 Bacteria 2562
144 Ga0075431_100174045 3300006847 Bacteria 2211
145 Ga0075431_100269055 3300006847 Bacteria 1728
146 Ga0075431_100269786 3300006847 Bacteria 1725
147 Ga0075431_100873321 3300006847 Bacteria 870
148 Ga0075433_10004044 3300006852 Bacteria 11352
149 Ga0075433_10032482 3300006852 Bacteria 4471
150 Ga0075433_10206869 3300006852 Bacteria 1745
151 Ga0075433_10428430 3300006852 Bacteria 1167
152 Ga0075433_10514919 3300006852 Bacteria 1053
153 Ga0075434_100001086 3300006871 Bacteria 22255
154 Ga0075434_100006495 3300006871 Bacteria 10723
155 Ga0075434_100042543 3300006871 Bacteria 4503
156 Ga0075434_100068233 3300006871 Bacteria 3542
157 Ga0075434_100732730 3300006871 Bacteria 1006
158 Ga0075434_100737072 3300006871 Bacteria 1003
159 Ga0075434_100977376 3300006871 Bacteria 861
160 Ga0075429_100000051 3300006880 Bacteria 55896
161 Ga0075429_100112496 3300006880 Bacteria 2379
162 Ga0075429_100571466 3300006880 Bacteria 991
163 Ga0075429_101006097 3300006880 Bacteria 729
164 Ga0068865_100007010 3300006881 Bacteria 6915
165 Ga0068865_100485492 3300006881 Bacteria 1027
166 Ga0075436_100120844 3300006914 Bacteria 1833
167 Ga0097620_100023275 3300006931 Bacteria 6217
168 Ga0097620_100437214 3300006931 Bacteria 1404
169 Ga0097620_101086909 3300006931 Bacteria 880
170 Ga0075435_100000313 3300007076 Bacteria 29845
171 Ga0075435_100001505 3300007076 Bacteria 14975
172 Ga0075435_100028033 3300007076 Bacteria 4414
173 Ga0075435_100114689 3300007076 Bacteria 2243
174 Ga0075435_100242078 3300007076 Bacteria 1534
175 Ga0075435_100342609 3300007076 Bacteria 1281
176 Ga0099794_10016386 3300007265 Bacteria 3284
177 Ga0099794_10042375 3300007265 Bacteria 2170
178 Ga0105250_10348779 3300009092 Unclassified 648
179 Ga0111539_10015161 3300009094 Bacteria 9603
180 Ga0111539_10022240 3300009094 Bacteria 7794
181 Ga0111539_10042981 3300009094 Bacteria 5421
182 Ga0111539_10062203 3300009094 Bacteria 4420
183 Ga0111539_10172368 3300009094 Bacteria 2528
184 Ga0111539_10218552 3300009094 Bacteria 2220
185 Ga0111539_10357613 3300009094 Bacteria 1699
186 Ga0111539_10726503 3300009094 Bacteria 1156
187 Ga0105247_10593354 3300009101 Bacteria 820
188 Ga0114129_10000337 3300009147 Bacteria 54884
189 Ga0114129_10017705 3300009147 Bacteria 10145
190 Ga0114129_10052708 3300009147 Bacteria 5710
191 Ga0114129_10267812 3300009147 Bacteria 2287
192 Ga0114129_10713121 3300009147 Bacteria 1288
193 Ga0114129_11014310 3300009147 Bacteria 1044
194 Ga0114129_11271254 3300009147 Bacteria 913
195 Ga0105243_10000915 3300009148 Bacteria 27703
196 Ga0105243_10005794 3300009148 Bacteria 9592
197 Ga0105242_10000945 3300009176 Bacteria 22671
198 Ga0105242_10430135 3300009176 Bacteria 1239
199 Ga0105248_10537516 3300009177 Bacteria 1318
200 Ga0105248_10827622 3300009177 Bacteria 1045
201 Ga0105249_10000975 3300009553 Bacteria 25356
202 Ga0105249_10795759 3300009553 Bacteria 1009
203 Ga0105249_11357360 3300009553 Bacteria 783
204 Ga0157371_10236405 3300013102 Bacteria 1314
205 Ga0157369_10293535 3300013105 Bacteria 1692
206 Ga0157369_10764713 3300013105 Bacteria 993
207 Ga0157378_10000844 3300013297 Bacteria 28388
208 Ga0163162_10284630 3300013306 Bacteria 1785
209 Ga0163162_11202410 3300013306 Bacteria 860
210 Ga0157372_12479977 3300013307 Unclassified 595
211 Ga0157380_10129704 3300014326 Bacteria 2149
212 Ga0157380_10273520 3300014326 Bacteria 1541
213 Ga0157380_10737222 3300014326 Bacteria 995
214 Ga0157380_11355462 3300014326 Unclassified 760
215 Ga0157377_10141205 3300014745 Bacteria 1480
216 Ga0157379_10503907 3300014968 Bacteria 1122
217 Ga0157376_10049031 3300014969 Bacteria 3497
218 Ga0207653_10031943 3300025885 Bacteria 1702
219 Ga0207682_10073092 3300025893 Bacteria 1456
220 Ga0207642_10000343 3300025899 Bacteria 13939
221 Ga0207642_10057158 3300025899 Bacteria 1793
222 Ga0207688_10492074 3300025901 Bacteria 767
223 Ga0207647_10528440 3300025904 Bacteria 656
224 Ga0207645_10080082 3300025907 Bacteria 2094
225 Ga0207643_10054759 3300025908 Bacteria 2268
226 Ga0207643_10226256 3300025908 Bacteria 1146
227 Ga0207684_10056417 3300025910 Bacteria 3332
228 Ga0207707_10030356 3300025912 Bacteria 4729
229 Ga0207707_10207535 3300025912 Bacteria 1707
230 Ga0207663_10995588 3300025916 Bacteria 672
231 Ga0207660_10000870 3300025917 Bacteria 19956
232 Ga0207660_10062887 3300025917 Bacteria 2675
233 Ga0207660_10188859 3300025917 Bacteria 1603
234 Ga0207660_11142132 3300025917 Bacteria 634
235 Ga0207662_10041134 3300025918 Bacteria 2720
236 Ga0207662_10052038 3300025918 Bacteria 2437
237 Ga0207662_11070846 3300025918 Bacteria 573
238 Ga0207652_10016161 3300025921 Bacteria 6088
239 Ga0207652_10066160 3300025921 Bacteria 3131
240 Ga0207646_11173132 3300025922 Bacteria 674
241 Ga0207659_10059361 3300025926 Bacteria 2749
242 Ga0207659_10314300 3300025926 Bacteria 1290
243 Ga0207687_10006178 3300025927 Bacteria 7929
244 Ga0207664_10097059 3300025929 Bacteria 2427
245 Ga0207706_10413020 3300025933 Bacteria 1169
246 Ga0207706_10804921 3300025933 Bacteria 798
247 Ga0207686_10013549 3300025934 Bacteria 4514
248 Ga0207686_10091763 3300025934 Bacteria 2007
249 Ga0207709_10000934 3300025935 Bacteria 21962
250 Ga0207709_10005689 3300025935 Bacteria 7040
251 Ga0207670_10006803 3300025936 Bacteria 6360
252 Ga0207670_10029557 3300025936 Bacteria 3492
253 Ga0207670_10055544 3300025936 Bacteria 2677
254 Ga0207670_10096285 3300025936 Bacteria 2104
255 Ga0207670_10107235 3300025936 Bacteria 2005
256 Ga0207670_10145283 3300025936 Bacteria 1753
257 Ga0207670_10596959 3300025936 Bacteria 906
258 Ga0207669_10169310 3300025937 Bacteria 1553
259 Ga0207669_10752579 3300025937 Bacteria 805
260 Ga0207669_11016039 3300025937 Bacteria 697
261 Ga0207704_10001908 3300025938 Bacteria 9340
262 Ga0207704_10002850 3300025938 Bacteria 7810
263 Ga0207665_10010514 3300025939 Bacteria 6079
264 Ga0207665_10215299 3300025939 Bacteria 1405
265 Ga0207691_10035819 3300025940 Bacteria 4602
266 Ga0207689_10081483 3300025942 Bacteria 2660
267 Ga0207661_10040898 3300025944 Bacteria 3647
268 Ga0207661_10346453 3300025944 Bacteria 1340
269 Ga0207667_10680686 3300025949 Bacteria 1032
270 Ga0207651_10125667 3300025960 Bacteria 1954
271 Ga0207651_10162080 3300025960 Bacteria 1754
272 Ga0207651_10320189 3300025960 Bacteria 1296
273 Ga0207651_11620593 3300025960 Bacteria 583
274 Ga0207712_10002777 3300025961 Bacteria 11198
275 Ga0207712_10095440 3300025961 Bacteria 2199
276 Ga0207712_10310881 3300025961 Bacteria 1297
277 Ga0207640_10026592 3300025981 Bacteria 3516
278 Ga0207658_11079006 3300025986 Bacteria 733
279 Ga0207677_10020563 3300026023 Bacteria 4010
280 Ga0207703_10101980 3300026035 Bacteria 2434
281 Ga0207703_10707618 3300026035 Bacteria 958
282 Ga0207639_10079531 3300026041 Bacteria 2591
283 Ga0207708_10000625 3300026075 Bacteria 27213
284 Ga0207708_10013288 3300026075 Bacteria 6148
285 Ga0207708_10046885 3300026075 Bacteria 3291
286 Ga0207708_10233865 3300026075 Bacteria 1476
287 Ga0207641_10230786 3300026088 Bacteria 1720
288 Ga0207648_10004683 3300026089 Bacteria 13988
289 Ga0207676_10678052 3300026095 Bacteria 997
290 Ga0207676_11331809 3300026095 Bacteria 713
291 Ga0207674_10182114 3300026116 Bacteria 2052
292 Ga0207675_100029321 3300026118 Bacteria 5128
293 Ga0207675_100579283 3300026118 Bacteria 1124
294 Ga0207698_10222749 3300026142 Bacteria 1706
295 Ga0209969_1012050 3300027360 Bacteria 1244
296 Ga0209967_1004437 3300027364 Bacteria 1865
297 Ga0209967_1009381 3300027364 Bacteria 1356
298 Ga0209967_1022513 3300027364 Bacteria 925
299 Ga0209981_1021295 3300027378 Bacteria 927
300 Ga0209996_1024163 3300027395 Bacteria 865
301 Ga0210000_1001370 3300027462 Bacteria 3434
302 Ga0210000_1003425 3300027462 Bacteria 2287
303 Ga0209995_1050703 3300027471 Bacteria 704
304 Ga0209999_1007283 3300027543 Bacteria 1989
305 Ga0209999_1073072 3300027543 Bacteria 659
306 Ga0209983_1034785 3300027665 Bacteria 1079
307 Ga0209588_1027539 3300027671 Bacteria 1809
308 Ga0209971_1005264 3300027682 Bacteria 3075
309 Ga0209966_1010098 3300027695 Bacteria 1696
310 Ga0209974_10119752 3300027876 Bacteria 932
311 Ga0207428_10000610 3300027907 Bacteria 42207
312 Ga0207428_10042033 3300027907 Bacteria 3698
313 Ga0207428_10092182 3300027907 Bacteria 2351
314 Ga0207428_10121118 3300027907 Bacteria 2006
315 Ga0207428_10153420 3300027907 Bacteria 1752
316 Ga0207428_10328346 3300027907 Bacteria 1128
317 Ga0268265_10002642 3300028380 Bacteria 13304
318 Ga0268265_10004917 3300028380 Bacteria 9188
319 Ga0268265_11682679 3300028380 Bacteria 640
320 Ga0268264_10003858 3300028381 Bacteria 12865
321 Ga0307408_100317941 3300031548 Bacteria 1310
322 Ga0307408_100373102 3300031548 Bacteria 1217
323 Ga0307408_101932240 3300031548 Bacteria 566
324 Ga0307405_11874409 3300031731 Bacteria 534
325 Ga0307406_10277190 3300031901 Bacteria 1277
326 Ga0307407_10430762 3300031903 Bacteria 953
327 Ga0307409_100970163 3300031995 Bacteria 867
328 Ga0307409_101757001 3300031995 Bacteria 649
329 Ga0307416_100308057 3300032002 Bacteria 1578
330 Ga0307416_100335300 3300032002 Bacteria 1522
331 Ga0307416_100467892 3300032002 Bacteria 1317
332 Ga0307416_100700581 3300032002 Bacteria 1102
333 Ga0307416_100711519 3300032002 Bacteria 1094
334 Ga0307416_100957084 3300032002 Bacteria 958
335 Ga0307416_102970927 3300032002 Bacteria 567
336 Ga0307416_103267736 3300032002 Bacteria 542
337 Ga0307411_10720051 3300032005 Bacteria 871
338 Ga0307411_10754398 3300032005 Bacteria 853
339 Ga0373948_0026773 3300034817 Bacteria 1138
340 Ga0373950_0069928 3300034818 Bacteria 718
341 Ga0373958_0006972 3300034819 Bacteria 1783
342 Ga0373959_0006259 3300034820 Bacteria 1970
343 Ga0373938_0105539 3300034957 Bacteria 712
344 Ga0373929_0030474 3300035085 Bacteria 1150
345 Ga0373929_0091809 3300035085 Bacteria 754
346 Ga0373940_0019717 3300035088 Bacteria 1706
347 Ga0373944_0001295 3300035089 Bacteria 6289
348 Ga0373949_0004675 3300035090 Bacteria 3112
349 Ga0373952_0010885 3300035092 Bacteria 1766
350 Ga0373952_0045098 3300035092 Bacteria 1032
351 Ga0373923_0049051 3300035111 Bacteria 1765
352 Ga0373923_0083820 3300035111 Bacteria 1386
353 Ga0373932_0060127 3300035112 Bacteria 1152
354 Ga0373936_0009825 3300035113 Bacteria 3610
355 Ga0373939_0007151 3300035114 Bacteria 2706
356 Ga0373941_0082347 3300035115 Bacteria 1089
357 Ga0373945_0003508 3300035116 Bacteria 4940
358 Ga0373953_0038993 3300035117 Bacteria 1882
359 Ga0373954_0000196 3300035118 Bacteria 21952
360 Ga0373960_0004628 3300035121 Bacteria 3159
361 Ga0373943_0033984 3300035170 Bacteria 2431
362 Ga0373943_0469099 3300035170 Bacteria 733
363 Ga0373946_0267357 3300035171 Bacteria 838
364 Ga0373955_0053869 3300035172 Bacteria 2198
365 Ga0373942_0003508 3300035207 Bacteria 3684
366 Ga0373942_0009037 3300035207 Bacteria 2329
367 Ga0373961_0009110 3300035241 Bacteria 2424
368 Ga0373962_0091282 3300035242 Bacteria 938
369 Ga0373924_0183552 3300035410 Bacteria 921
370 Ga0373931_0012625 3300035691 Bacteria 4096
371 Ga0373931_0281384 3300035691 Bacteria 1021
372 Ga0373931_0665694 3300035691 Bacteria 685
373 Ga0373935_0055440 3300035692 Bacteria 2525
374 Ga0373935_0213664 3300035692 Bacteria 1337
375 Ga0373935_0463874 3300035692 Bacteria 916
376 Ga0373927_0031579 3300035695 Bacteria 3451
377 Ga0373933_0383019 3300035724 Bacteria 916
378 Ga0373947_0181983 3300035725 Bacteria 1368
379 Ga0373937_0001198 3300036401 Bacteria 21774
380 Ga0373937_0049337 3300036401 Bacteria 3855
381 Ga0373937_0331198 3300036401 Bacteria 1441
382 Ga0373925_0018211 3300037068 Bacteria 5102
383 Ga0373925_0089036 3300037068 Bacteria 2357
384 Ga0395900_0357785 3300037418 Bacteria 1432
385 Ga0436365_1621834 3300039437 Bacteria 530
386 Ga0439453_0013814 3300041408 Bacteria 1376
387 Ga0439441_001424 3300042001 Bacteria 3121
388 Ga0439441_003041 3300042001 Bacteria 2428
389 Ga0439441_015517 3300042001 Bacteria 1348
390 Ga0439443_000464 3300042003 Bacteria 3586
391 Ga0439443_021125 3300042003 Bacteria 1026
392 Ga0439451_010948 3300042009 Bacteria 1829
393 Ga0439434_0080347 3300042435 Bacteria 1034
394 Ga0439435_0000973 3300042436 Bacteria 5000
395 Ga0439435_0064771 3300042436 Bacteria 1071
396 Ga0439444_0003591 3300042437 Bacteria 2200
397 Ga0439444_0148153 3300042437 Bacteria 565
398 Ga0439460_0000558 3300042461 Bacteria 8154
399 Ga0439460_0004610 3300042461 Bacteria 3364
400 Ga0451577_0192301 3300042876 Bacteria 1841
401 Ga0451577_0776912 3300042876 Bacteria 866
402 Ga0439440_0031418 3300042993 Bacteria 1256
403 Ga0466964_0028934 3300044706 Bacteria 2185
404 Ga0451576_0030499 3300045051 Bacteria 5762
405 Ga0451576_0047691 3300045051 Bacteria 4502
406 Ga0451576_0098801 3300045051 Bacteria 3036
407 Ga0451576_0366083 3300045051 Bacteria 1510
408 Ga0451576_0516495 3300045051 Bacteria 1255
409 Ga0451576_0544398 3300045051 Bacteria 1219
410 Ga0451576_0621506 3300045051 Bacteria 1135
411 Ga0466967_0003164 3300045976 Bacteria 10613
412 Ga0495592_0056196 3300046454 Bacteria 2909
413 Ga0495629_0651080 3300046459 Unclassified 702
414 Ga0495653_0370222 3300046463 Bacteria 917
415 Ga0495580_0004797 3300046472 Bacteria 11323
416 Ga0495582_0105078 3300046473 Bacteria 1583
417 Ga0495639_0010485 3300046475 Bacteria 3991
418 Ga0495639_0029834 3300046475 Bacteria 2422
419 Ga0495662_0012398 3300046476 Bacteria 4160
420 Ga0495662_0022446 3300046476 Bacteria 3047
421 Ga0495594_0413255 3300046499 Bacteria 767
422 Ga0495608_0033324 3300046511 Bacteria 3482
423 Ga0495628_0046221 3300046516 Bacteria 3458
424 Ga0495628_0239619 3300046516 Bacteria 1357
425 Ga0495630_0051223 3300046517 Bacteria 3090
426 Ga0495630_0123188 3300046517 Bacteria 1967
427 Ga0495666_0012301 3300046526 Bacteria 4267
428 Ga0495666_0080624 3300046526 Bacteria 1540
429 Ga0495642_0030319 3300046528 Bacteria 2163
430 Ga0495652_0092736 3300046529 Bacteria 2467
431 Ga0495665_0070807 3300046531 Bacteria 1837
432 Ga0495640_0026681 3300046533 Bacteria 4170
433 Ga0495586_0000599 3300046535 Bacteria 20870
434 Ga0495586_0017425 3300046535 Bacteria 3819
435 Ga0495586_0109662 3300046535 Bacteria 1535
436 Ga0495587_0075719 3300046536 Bacteria 1954
437 Ga0495609_0072605 3300046538 Bacteria 1511
438 Ga0495621_0119927 3300046539 Bacteria 1016
439 Ga0495621_0164293 3300046539 Bacteria 879
440 Ga0495597_0401249 3300046542 Bacteria 521
441 Ga0495633_0297972 3300046558 Bacteria 733
442 Ga0495667_0124257 3300046559 Bacteria 1665
443 Ga0495656_0001461 3300046615 Bacteria 7730
444 Ga0495634_0016389 3300046642 Bacteria 5302
445 Ga0495588_0031433 3300046674 Bacteria 2672
446 Ga0495647_0055957 3300046681 Bacteria 1545
447 Ga0495658_0020914 3300046683 Bacteria 3443
448 Ga0495658_0062453 3300046683 Bacteria 2141
449 Ga0495669_0231872 3300046684 Bacteria 886
450 Ga0495613_0098024 3300046689 Bacteria 2118
451 Ga0495624_0047677 3300046690 Bacteria 2722
452 Ga0495624_0057806 3300046690 Bacteria 2438
453 Ga0495670_0085636 3300046691 Bacteria 1609
454 Ga0495589_0145204 3300046794 Bacteria 1135
455 Ga0495600_0042190 3300046809 Bacteria 2974
456 Ga0495581_0065583 3300047315 Bacteria 2099
457 Ga0495581_0227058 3300047315 Bacteria 1092
458 Ga0495604_0020496 3300047317 Bacteria 5281
459 Ga0495604_0098994 3300047317 Bacteria 2147
460 Ga0495636_0109247 3300047318 Bacteria 1216
461 Ga0495674_0221508 3300047319 Bacteria 1564
462 Ga0495676_0036176 3300047321 Bacteria 4125
463 Ga0495680_0010759 3300047322 Bacteria 8150
464 Ga0495680_0307821 3300047322 Bacteria 1111
465 Ga0495675_0336448 3300047444 Bacteria 890
466 Ga0495677_0038009 3300047445 Bacteria 1759
467 Ga0495684_0209773 3300047471 Bacteria 1433
468 Ga0495593_0055522 3300047673 Bacteria 2084
469 Ga0495593_0109517 3300047673 Bacteria 1411
470 Ga0496106_0222439 3300048909 Bacteria 1506
471 Ga0496114_1350846 3300048917 Unclassified 600
472 Ga0501292_054538 3300049515 Bacteria 714
473 Ga0501297_046124 3300049520 Bacteria 628
474 Ga0501299_061785 3300049522 Bacteria 795
475 Ga0501300_065273 3300049523 Unclassified 582
476 Ga0501031_0438566 3300049568 Bacteria 844
477 Ga0501032_0952563 3300049569 Bacteria 540
478 Ga0501033_0108896 3300049570 Bacteria 2018
479 Ga0501033_1131270 3300049570 Bacteria 520
480 Ga0501034_1214132 3300049571 Bacteria 633
481 Ga0501036_0073994 3300049572 Bacteria 2881
482 Ga0501036_0101904 3300049572 Bacteria 2428
483 Ga0501036_0138950 3300049572 Bacteria 2050
484 Ga0501036_0493594 3300049572 Bacteria 1019
485 Ga0501036_0529193 3300049572 Bacteria 980
486 Ga0501036_0567752 3300049572 Bacteria 942
487 Ga0501038_0040339 3300049574 Bacteria 4078
488 Ga0501038_0468402 3300049574 Bacteria 967
489 Ga0501039_0028179 3300049575 Bacteria 4321
490 Ga0501039_0047652 3300049575 Bacteria 3313
491 Ga0501039_0305625 3300049575 Bacteria 1250
492 Ga0501039_0313877 3300049575 Bacteria 1232
493 Ga0501039_0385319 3300049575 Bacteria 1101
494 Ga0501040_0008966 3300049576 Bacteria 6506
495 Ga0501040_0015099 3300049576 Bacteria 5103
496 Ga0501040_0072363 3300049576 Bacteria 2381
497 Ga0501040_0218619 3300049576 Bacteria 1355
498 Ga0501040_0246702 3300049576 Bacteria 1273
499 Ga0501041_0001221 3300049577 Bacteria 14077
500 Ga0501041_0052583 3300049577 Bacteria 2483
501 Ga0501041_0291644 3300049577 Bacteria 1027
502 Ga0501041_0948101 3300049577 Bacteria 553
503 Ga0501042_0012960 3300049578 Bacteria 5663
504 Ga0501042_0026678 3300049578 Bacteria 4058
505 Ga0501042_0160478 3300049578 Bacteria 1622
506 Ga0501042_0550335 3300049578 Bacteria 839
507 Ga0501043_0555638 3300049579 Bacteria 852
508 Ga0501046_0029330 3300049580 Bacteria 4472
509 Ga0501046_0063190 3300049580 Bacteria 2892
510 Ga0501046_0108245 3300049580 Bacteria 2126
511 Ga0501046_0205965 3300049580 Bacteria 1462
512 Ga0501048_0005660 3300049582 Bacteria 9507
513 Ga0501048_0015361 3300049582 Bacteria 5654
514 Ga0501048_0093002 3300049582 Bacteria 2127
515 Ga0501068_0022049 3300049584 Bacteria 3722
516 Ga0501068_0157070 3300049584 Bacteria 1432
517 Ga0501068_0327721 3300049584 Bacteria 982
518 Ga0501068_1135382 3300049584 Bacteria 517
519 Ga0501069_0279473 3300049585 Bacteria 977
520 Ga0501069_0791859 3300049585 Bacteria 574
521 Ga0501070_0725232 3300049586 Bacteria 785
522 Ga0501070_1160114 3300049586 Unclassified 594
523 Ga0501071_0007693 3300049587 Bacteria 7099
524 Ga0501071_0009204 3300049587 Bacteria 6567
525 Ga0501071_0040307 3300049587 Bacteria 3342
526 Ga0501071_0208996 3300049587 Bacteria 1467
527 Ga0501071_0254425 3300049587 Bacteria 1326
528 Ga0501071_0484328 3300049587 Bacteria 948
529 Ga0501071_0699653 3300049587 Bacteria 780
530 Ga0501072_0007385 3300049588 Bacteria 8339
531 Ga0501072_0015376 3300049588 Bacteria 5868
532 Ga0501072_0109836 3300049588 Bacteria 2195
533 Ga0501072_0128142 3300049588 Bacteria 2022
534 Ga0501072_0724475 3300049588 Bacteria 781
535 Ga0501072_1250211 3300049588 Bacteria 576
536 Ga0501073_0048594 3300049589 Bacteria 2978
537 Ga0501073_0082459 3300049589 Bacteria 2237
538 Ga0501073_0507950 3300049589 Bacteria 833
539 Ga0501073_0539328 3300049589 Bacteria 806
540 Ga0501074_0013245 3300049590 Bacteria 5996
541 Ga0501074_0326055 3300049590 Bacteria 1090
542 Ga0501074_0396365 3300049590 Bacteria 979
543 Ga0501074_0601966 3300049590 Bacteria 777
544 Ga0501074_0789231 3300049590 Unclassified 669
545 Ga0501075_0079590 3300049591 Bacteria 2480
546 Ga0501075_0097920 3300049591 Bacteria 2226
547 Ga0501075_0149458 3300049591 Bacteria 1780
548 Ga0501075_0415789 3300049591 Bacteria 1025
549 Ga0501075_0872205 3300049591 Bacteria 684
550 Ga0501076_0011826 3300049592 Bacteria 6517
551 Ga0501076_0011855 3300049592 Bacteria 6507
552 Ga0501076_0047184 3300049592 Bacteria 3405
553 Ga0501076_0329718 3300049592 Bacteria 1252
554 Ga0501076_0478807 3300049592 Bacteria 1026
555 Ga0501077_0002508 3300049593 Bacteria 10992
556 Ga0501077_0105817 3300049593 Bacteria 1783
557 Ga0501077_0186267 3300049593 Bacteria 1319
558 Ga0501207_045829 3300049654 Bacteria 771
559 Ga0501217_155307 3300049661 Bacteria 687
560 Ga0501225_0274758 3300049705 Bacteria 562
561 Ga0501229_034604 3300049706 Unclassified 703
562 Ga0501079_0005271 3300049741 Bacteria 9613
563 Ga0501079_0142065 3300049741 Bacteria 1870
564 Ga0501079_0502332 3300049741 Bacteria 953
565 Ga0501080_0001927 3300049742 Bacteria 17908
566 Ga0501080_0010688 3300049742 Bacteria 8398
567 Ga0501080_0027607 3300049742 Bacteria 5278
568 Ga0501080_0082554 3300049742 Bacteria 2985
569 Ga0501081_0001856 3300049743 Bacteria 13124
570 Ga0501081_0006018 3300049743 Bacteria 7853
571 Ga0501081_0062939 3300049743 Bacteria 2574
572 Ga0501081_0245335 3300049743 Bacteria 1306
573 Ga0501035_0013223 3300049822 Bacteria 7617
574 Ga0501035_0213588 3300049822 Bacteria 1650
575 Ga0501035_1221347 3300049822 Bacteria 582
576 Ga0501035_1322628 3300049822 Bacteria 555
577 Ga0501035_1400864 3300049822 Unclassified 536
578 Ga0501044_0402148 3300049823 Bacteria 1282
579 Ga0501045_0002662 3300049824 Bacteria 12183
580 Ga0501045_0104950 3300049824 Bacteria 2094
581 Ga0501045_0164000 3300049824 Bacteria 1654
582 nmdc:mga03683_253879_c1 3300050489 Bacteria 817
583 nmdc:mga05p37_1087070_c1 3300050507 Bacteria 839
584 nmdc:mga05p37_1193176_c1 3300050507 Bacteria 787
585 nmdc:mga05p37_232106_c1 3300050507 Bacteria 2222
586 nmdc:mga05p37_240298_c1 3300050507 Bacteria 2178
587 nmdc:mga05p37_448101_c1 3300050507 Bacteria 1495
588 nmdc:mga05p37_758_c1 3300050507 Bacteria 35839
589 nmdc:mga05p37_779981_c1 3300050507 Bacteria 1049
590 nmdc:mga09592_1050_c1 3300050508 Bacteria 21887
591 nmdc:mga09592_215679_c1 3300050508 Bacteria 1663
592 nmdc:mga09592_230959_c1 3300050508 Bacteria 1603
593 nmdc:mga09592_553218_c1 3300050508 Bacteria 988
594 nmdc:mga09592_772851_c1 3300050508 Bacteria 814
595 nmdc:mga0qj67_2437_c1 3300050509 Bacteria 13248
596 nmdc:mga0qj67_451161_c1 3300050509 Bacteria 1036
597 nmdc:mga0qj67_68243_c1 3300050509 Bacteria 2834
598 nmdc:mga0qj67_8037_c1 3300050509 Bacteria 7804
599 nmdc:mga06r32_223122_c1 3300050510 Bacteria 1873
600 nmdc:mga06r32_271078_c1 3300050510 Bacteria 1685
601 nmdc:mga06r32_276015_c1 3300050510 Bacteria 1668
602 nmdc:mga06r32_5201_c1 3300050510 Bacteria 11693
603 nmdc:mga06r32_755940_c1 3300050510 Bacteria 935
604 nmdc:mga08y16_12138_c1 3300050511 Bacteria 9054
605 nmdc:mga08y16_141331_c1 3300050511 Bacteria 2503
606 nmdc:mga08y16_150206_c1 3300050511 Bacteria 2422
607 nmdc:mga08y16_16167_c1 3300050511 Bacteria 7844
608 nmdc:mga08y16_340146_c1 3300050511 Bacteria 1543
609 nmdc:mga08y16_35675_c1 3300050511 Bacteria 5223
610 nmdc:mga08y16_513051_c1 3300050511 Bacteria 1217
611 nmdc:mga08y16_97595_c1 3300050511 Bacteria 3060
612 nmdc:mga0n895_15638_c1 3300050512 Bacteria 6928
613 nmdc:mga0n895_1569_c1 3300050512 Bacteria 17184
614 nmdc:mga0n895_1976_c1 3300050512 Bacteria 15727
615 nmdc:mga0n895_21690_c1 3300050512 Bacteria 6011
616 nmdc:mga0n895_659747_c1 3300050512 Bacteria 1044
617 nmdc:mga0n895_811027_c1 3300050512 Bacteria 926
618 nmdc:mga0n895_976123_c1 3300050512 Bacteria 829
619 nmdc:mga0rr50_144788_c1 3300050513 Bacteria 1915
620 nmdc:mga0rr50_201534_c1 3300050513 Bacteria 1635
621 nmdc:mga0rr50_2095_c1 3300050513 Bacteria 11151
622 nmdc:mga0rr50_22883_c1 3300050513 Bacteria 4298
623 nmdc:mga0rr50_2740_c1 3300050513 Bacteria 10002
624 nmdc:mga0rr50_62478_c1 3300050513 Bacteria 2810
625 nmdc:mga08x19_106481_c1 3300050514 Bacteria 1866
626 nmdc:mga08x19_1254_c1 3300050514 Bacteria 15744
627 nmdc:mga08x19_18012_c1 3300050514 Bacteria 4327
628 nmdc:mga08x19_204035_c1 3300050514 Bacteria 1356
629 nmdc:mga08x19_33080_c1 3300050514 Bacteria 3262
630 nmdc:mga0a205_1506880_c1 3300050515 Bacteria 521
631 nmdc:mga0a205_261255_c1 3300050515 Bacteria 1609
632 nmdc:mga0a205_328555_c1 3300050515 Bacteria 1399
633 nmdc:mga0a205_394053_c1 3300050515 Bacteria 1249
634 nmdc:mga0a205_405263_c1 3300050515 Bacteria 1227
635 nmdc:mga0a205_57416_c1 3300050515 Bacteria 3758
636 nmdc:mga0a205_599_c1 3300050515 Bacteria 28654
637 Ga0495601_0089434 3300053077 Bacteria 1980
638 Ga0495601_0091420 3300053077 Bacteria 1959
639 Ga0500566_0211484 3300053094 Bacteria 971
640 Ga0501084_0009272 3300054114 Bacteria 8141
641 Ga0501084_0009536 3300054114 Bacteria 8035
642 Ga0501084_0139560 3300054114 Bacteria 2041
643 Ga0501084_0184062 3300054114 Bacteria 1763
644 Ga0501084_0697546 3300054114 Bacteria 856
645 Ga0501084_0701219 3300054114 Bacteria 854
646 Ga0590071_005303 3300059421 Bacteria 3106
647 Ga0590075_093202 3300059424 Unclassified 782
648 Ga0501082_0016248 3300060353 Bacteria 6407
649 Ga0501082_0340816 3300060353 Bacteria 1306
650 Ga0501082_0404326 3300060353 Bacteria 1192
651 Ga0530510_0001351 3300061734 Bacteria 16409
652 Ga0530510_0002568 3300061734 Bacteria 12479
653 Ga0530510_0069673 3300061734 Bacteria 2552
654 Ga0395901_0425401
655 Ga0065707_10179276
656 Ga0065707_10218991
657 Ga0065707_10310648
658 Ga0070683_100056461
659 Ga0070677_10053957
660 Ga0068869_100025632
661 Ga0068869_100505461
662 Ga0070680_100000789
663 Ga0070680_100066644
664 Ga0070680_100195611
665 Ga0070680_100296485
666 Ga0070680_101204795
667 Ga0070682_100536766
668 Ga0068868_100036776
669 Ga0070689_100000776
670 Ga0070689_100059601
671 Ga0070689_100209534
672 Ga0070689_100310094
673 Ga0070689_100848746
674 Ga0070691_10105688
675 Ga0070691_10107556
676 Ga0070691_10488159
677 Ga0070691_10532524
678 Ga0070687_100008563
679 Ga0070687_100399831
680 Ga0070687_101098502
681 Ga0070692_10003588
682 Ga0070692_10029573
683 Ga0070692_10177689
684 Ga0070692_10384243
685 Ga0070669_100525099
686 Ga0070675_100076867
687 Ga0070674_100296382
688 Ga0070674_100501491
689 Ga0070673_101305577
690 Ga0070688_100076589
691 Ga0070688_100383143
692 Ga0070667_101516252
693 Ga0070703_10052387
694 Ga0070701_10008994
695 Ga0070701_10801064
696 Ga0070711_101413048
697 Ga0070705_100004915
698 Ga0070705_100073979
699 Ga0070705_100230827
700 Ga0070705_100783957
701 Ga0070705_101448847
702 Ga0070700_100006849
703 Ga0070700_100270448
704 Ga0070694_100011252
705 Ga0070694_100025193
706 Ga0070694_100029978
707 Ga0070694_100053791
708 Ga0070694_100139261
709 Ga0070694_100281234
710 Ga0070694_100512926
711 Ga0070694_100577629
712 Ga0070694_101272569
713 Ga0070678_100615839
714 Ga0070662_100333394
715 Ga0070681_10000235
716 Ga0068867_100000699
717 Ga0068867_100003806
718 Ga0068867_100414197
719 Ga0070706_100040437
720 Ga0070706_101524402
721 Ga0070707_100870866
722 Ga0070698_100189800
723 Ga0070699_100027831
724 Ga0070699_101077806
725 Ga0070699_101853838
726 Ga0070679_100064355
727 Ga0070697_100001807
728 Ga0070697_100777325
729 Ga0068853_100544725
730 Ga0070672_101352226
731 Ga0070686_100003904
732 Ga0070686_100044215
733 Ga0070686_100744277
734 Ga0070686_100763162
735 Ga0070686_101536248
736 Ga0070695_100000113
737 Ga0070695_100001179
738 Ga0070695_100025621
739 Ga0070695_100042548
740 Ga0070695_100044910
741 Ga0070695_100201484
742 Ga0070695_100499315
743 Ga0070695_101189723
744 Ga0070696_100000434
745 Ga0070696_100001657
746 Ga0070696_100001672
747 Ga0070696_100165669
748 Ga0070696_100181774
749 Ga0070696_100190366
750 Ga0070696_100207841
751 Ga0070696_100209440
752 Ga0070696_101582430
753 Ga0070693_100000209
754 Ga0070693_100109164
755 Ga0070704_100049067
756 Ga0070704_100070164
757 Ga0070704_100656972
758 Ga0070704_100895616
759 Ga0070704_101194410
760 Ga0068855_100089138
761 Ga0068854_100001665
762 Ga0068856_100022176
763 Ga0070702_100001157
764 Ga0070702_100017482
765 Ga0070702_100416010
766 Ga0068852_100237091
767 Ga0068859_100023270
768 Ga0068859_100437244
769 Ga0068859_101086832
770 Ga0068866_10214512
771 Ga0068861_100003377
772 Ga0068870_10048915
773 Ga0068863_100429789
774 Ga0068858_100004085
775 Ga0068858_100693748
776 Ga0068860_100627522
777 Ga0068862_100006699
778 Ga0068862_101831535
779 Ga0081538_10213076
780 Ga0081539_10000799
781 Ga0097621_100004646
782 Ga0097621_100009592
783 Ga0068871_100000788
784 Ga0068871_100001073
785 Ga0075428_100003728
786 Ga0075428_100021034
787 Ga0075428_100197727
788 Ga0075428_100944672
789 Ga0075428_101560937
790 Ga0075430_100002931
791 Ga0075430_100014127
792 Ga0075430_100018269
793 Ga0075430_100053434
794 Ga0075430_100280586
795 Ga0075431_100105084
796 Ga0075431_100133277
797 Ga0075431_100174045
798 Ga0075431_100269055
799 Ga0075431_100269786
800 Ga0075431_100873321
801 Ga0075433_10004044
802 Ga0075433_10032482
803 Ga0075433_10206869
804 Ga0075433_10428430
805 Ga0075433_10514919
806 Ga0075434_100001086
807 Ga0075434_100006495
808 Ga0075434_100042543
809 Ga0075434_100068233
810 Ga0075434_100732730
811 Ga0075434_100737072
812 Ga0075434_100977376
813 Ga0075429_100000051
814 Ga0075429_100112496
815 Ga0075429_100571466
816 Ga0075429_101006097
817 Ga0068865_100007010
818 Ga0068865_100485492
819 Ga0075436_100120844
820 Ga0097620_100023275
821 Ga0097620_100437214
822 Ga0097620_101086909
823 Ga0075435_100000313
824 Ga0075435_100001505
825 Ga0075435_100028033
826 Ga0075435_100114689
827 Ga0075435_100242078
828 Ga0075435_100342609
829 Ga0099794_10016386
830 Ga0099794_10042375
831 Ga0105250_10348779
832 Ga0111539_10015161
833 Ga0111539_10022240
834 Ga0111539_10042981
835 Ga0111539_10062203
836 Ga0111539_10172368
837 Ga0111539_10218552
838 Ga0111539_10357613
839 Ga0111539_10726503
840 Ga0105247_10593354
841 Ga0114129_10000337
842 Ga0114129_10017705
843 Ga0114129_10052708
844 Ga0114129_10267812
845 Ga0114129_10713121
846 Ga0114129_11014310
847 Ga0114129_11271254
848 Ga0105243_10000915
849 Ga0105243_10005794
850 Ga0105242_10000945
851 Ga0105242_10430135
852 Ga0105248_10537516
853 Ga0105248_10827622
854 Ga0105249_10000975
855 Ga0105249_10795759
856 Ga0105249_11357360
857 Ga0157371_10236405
858 Ga0157369_10293535
859 Ga0157369_10764713
860 Ga0157378_10000844
861 Ga0163162_10284630
862 Ga0163162_11202410
863 Ga0157372_12479977
864 Ga0157380_10129704
865 Ga0157380_10273520
866 Ga0157380_10737222
867 Ga0157380_11355462
868 Ga0157377_10141205
869 Ga0157379_10503907
870 Ga0157376_10049031
871 Ga0207653_10031943
872 Ga0207682_10073092
873 Ga0207642_10000343
874 Ga0207642_10057158
875 Ga0207688_10492074
876 Ga0207647_10528440
877 Ga0207645_10080082
878 Ga0207643_10054759
879 Ga0207643_10226256
880 Ga0207684_10056417
881 Ga0207707_10030356
882 Ga0207707_10207535
883 Ga0207663_10995588
884 Ga0207660_10000870
885 Ga0207660_10062887
886 Ga0207660_10188859
887 Ga0207660_11142132
888 Ga0207662_10041134
889 Ga0207662_10052038
890 Ga0207662_11070846
891 Ga0207652_10016161
892 Ga0207652_10066160
893 Ga0207646_11173132
894 Ga0207659_10059361
895 Ga0207659_10314300
896 Ga0207687_10006178
897 Ga0207664_10097059
898 Ga0207706_10413020
899 Ga0207706_10804921
900 Ga0207686_10013549
901 Ga0207686_10091763
902 Ga0207709_10000934
903 Ga0207709_10005689
904 Ga0207670_10006803
905 Ga0207670_10029557
906 Ga0207670_10055544
907 Ga0207670_10096285
908 Ga0207670_10107235
909 Ga0207670_10145283
910 Ga0207670_10596959
911 Ga0207669_10169310
912 Ga0207669_10752579
913 Ga0207669_11016039
914 Ga0207704_10001908
915 Ga0207704_10002850
916 Ga0207665_10010514
917 Ga0207665_10215299
918 Ga0207691_10035819
919 Ga0207689_10081483
920 Ga0207661_10040898
921 Ga0207661_10346453
922 Ga0207667_10680686
923 Ga0207651_10125667
924 Ga0207651_10162080
925 Ga0207651_10320189
926 Ga0207651_11620593
927 Ga0207712_10002777
928 Ga0207712_10095440
929 Ga0207712_10310881
930 Ga0207640_10026592
931 Ga0207658_11079006
932 Ga0207677_10020563
933 Ga0207703_10101980
934 Ga0207703_10707618
935 Ga0207639_10079531
936 Ga0207708_10000625
937 Ga0207708_10013288
938 Ga0207708_10046885
939 Ga0207708_10233865
940 Ga0207641_10230786
941 Ga0207648_10004683
942 Ga0207676_10678052
943 Ga0207676_11331809
944 Ga0207674_10182114
945 Ga0207675_100029321
946 Ga0207675_100579283
947 Ga0207698_10222749
948 Ga0209969_1012050
949 Ga0209967_1004437
950 Ga0209967_1009381
951 Ga0209967_1022513
952 Ga0209981_1021295
953 Ga0209996_1024163
954 Ga0210000_1001370
955 Ga0210000_1003425
956 Ga0209995_1050703
957 Ga0209999_1007283
958 Ga0209999_1073072
959 Ga0209983_1034785
960 Ga0209588_1027539
961 Ga0209971_1005264
962 Ga0209966_1010098
963 Ga0209974_10119752
964 Ga0207428_10000610
965 Ga0207428_10042033
966 Ga0207428_10092182
967 Ga0207428_10121118
968 Ga0207428_10153420
969 Ga0207428_10328346
970 Ga0268265_10002642
971 Ga0268265_10004917
972 Ga0268265_11682679
973 Ga0268264_10003858
974 Ga0307408_100317941
975 Ga0307408_100373102
976 Ga0307408_101932240
977 Ga0307405_11874409
978 Ga0307406_10277190
979 Ga0307407_10430762
980 Ga0307409_100970163
981 Ga0307409_101757001
982 Ga0307416_100308057
983 Ga0307416_100335300
984 Ga0307416_100467892
985 Ga0307416_100700581
986 Ga0307416_100711519
987 Ga0307416_100957084
988 Ga0307416_102970927
989 Ga0307416_103267736
990 Ga0307411_10720051
991 Ga0307411_10754398
992 Ga0373948_0026773
993 Ga0373950_0069928
994 Ga0373958_0006972
995 Ga0373959_0006259
996 Ga0373938_0105539
997 Ga0373929_0030474
998 Ga0373929_0091809
999 Ga0373940_0019717
1000 Ga0373944_0001295
1001 Ga0373949_0004675
1002 Ga0373952_0010885
1003 Ga0373952_0045098
1004 Ga0373923_0049051
1005 Ga0373923_0083820
1006 Ga0373932_0060127
1007 Ga0373936_0009825
1008 Ga0373939_0007151
1009 Ga0373941_0082347
1010 Ga0373945_0003508
1011 Ga0373953_0038993
1012 Ga0373954_0000196
1013 Ga0373960_0004628
1014 Ga0373943_0033984
1015 Ga0373943_0469099
1016 Ga0373946_0267357
1017 Ga0373955_0053869
1018 Ga0373942_0003508
1019 Ga0373942_0009037
1020 Ga0373961_0009110
1021 Ga0373962_0091282
1022 Ga0373924_0183552
1023 Ga0373931_0012625
1024 Ga0373931_0281384
1025 Ga0373931_0665694
1026 Ga0373935_0055440
1027 Ga0373935_0213664
1028 Ga0373935_0463874
1029 Ga0373927_0031579
1030 Ga0373933_0383019
1031 Ga0373947_0181983
1032 Ga0373937_0001198
1033 Ga0373937_0049337
1034 Ga0373937_0331198
1035 Ga0373925_0018211
1036 Ga0373925_0089036
1037 Ga0395900_0357785
1038 Ga0436365_1621834
1039 Ga0439453_0013814
1040 Ga0439441_001424
1041 Ga0439441_003041
1042 Ga0439441_015517
1043 Ga0439443_000464
1044 Ga0439443_021125
1045 Ga0439451_010948
1046 Ga0439434_0080347
1047 Ga0439435_0000973
1048 Ga0439435_0064771
1049 Ga0439444_0003591
1050 Ga0439444_0148153
1051 Ga0439460_0000558
1052 Ga0439460_0004610
1053 Ga0451577_0192301
1054 Ga0451577_0776912
1055 Ga0439440_0031418
1056 Ga0466964_0028934
1057 Ga0451576_0030499
1058 Ga0451576_0047691
1059 Ga0451576_0098801
1060 Ga0451576_0366083
1061 Ga0451576_0516495
1062 Ga0451576_0544398
1063 Ga0451576_0621506
1064 Ga0466967_0003164
1065 Ga0495592_0056196
1066 Ga0495629_0651080
1067 Ga0495653_0370222
1068 Ga0495580_0004797
1069 Ga0495582_0105078
1070 Ga0495639_0010485
1071 Ga0495639_0029834
1072 Ga0495662_0012398
1073 Ga0495662_0022446
1074 Ga0495594_0413255
1075 Ga0495608_0033324
1076 Ga0495628_0046221
1077 Ga0495628_0239619
1078 Ga0495630_0051223
1079 Ga0495630_0123188
1080 Ga0495666_0012301
1081 Ga0495666_0080624
1082 Ga0495642_0030319
1083 Ga0495652_0092736
1084 Ga0495665_0070807
1085 Ga0495640_0026681
1086 Ga0495586_0000599
1087 Ga0495586_0017425
1088 Ga0495586_0109662
1089 Ga0495587_0075719
1090 Ga0495609_0072605
1091 Ga0495621_0119927
1092 Ga0495621_0164293
1093 Ga0495597_0401249
1094 Ga0495633_0297972
1095 Ga0495667_0124257
1096 Ga0495656_0001461
1097 Ga0495634_0016389
1098 Ga0495588_0031433
1099 Ga0495647_0055957
1100 Ga0495658_0020914
1101 Ga0495658_0062453
1102 Ga0495669_0231872
1103 Ga0495613_0098024
1104 Ga0495624_0047677
1105 Ga0495624_0057806
1106 Ga0495670_0085636
1107 Ga0495589_0145204
1108 Ga0495600_0042190
1109 Ga0495581_0065583
1110 Ga0495581_0227058
1111 Ga0495604_0020496
1112 Ga0495604_0098994
1113 Ga0495636_0109247
1114 Ga0495674_0221508
1115 Ga0495676_0036176
1116 Ga0495680_0010759
1117 Ga0495680_0307821
1118 Ga0495675_0336448
1119 Ga0495677_0038009
1120 Ga0495684_0209773
1121 Ga0495593_0055522
1122 Ga0495593_0109517
1123 Ga0496106_0222439
1124 Ga0496114_1350846
1125 Ga0501292_054538
1126 Ga0501297_046124
1127 Ga0501299_061785
1128 Ga0501300_065273
1129 Ga0501031_0438566
1130 Ga0501032_0952563
1131 Ga0501033_0108896
1132 Ga0501033_1131270
1133 Ga0501034_1214132
1134 Ga0501036_0073994
1135 Ga0501036_0101904
1136 Ga0501036_0138950
1137 Ga0501036_0493594
1138 Ga0501036_0529193
1139 Ga0501036_0567752
1140 Ga0501038_0040339
1141 Ga0501038_0468402
1142 Ga0501039_0028179
1143 Ga0501039_0047652
1144 Ga0501039_0305625
1145 Ga0501039_0313877
1146 Ga0501039_0385319
1147 Ga0501040_0008966
1148 Ga0501040_0015099
1149 Ga0501040_0072363
1150 Ga0501040_0218619
1151 Ga0501040_0246702
1152 Ga0501041_0001221
1153 Ga0501041_0052583
1154 Ga0501041_0291644
1155 Ga0501041_0948101
1156 Ga0501042_0012960
1157 Ga0501042_0026678
1158 Ga0501042_0160478
1159 Ga0501042_0550335
1160 Ga0501043_0555638
1161 Ga0501046_0029330
1162 Ga0501046_0063190
1163 Ga0501046_0108245
1164 Ga0501046_0205965
1165 Ga0501048_0005660
1166 Ga0501048_0015361
1167 Ga0501048_0093002
1168 Ga0501068_0022049
1169 Ga0501068_0157070
1170 Ga0501068_0327721
1171 Ga0501068_1135382
1172 Ga0501069_0279473
1173 Ga0501069_0791859
1174 Ga0501070_0725232
1175 Ga0501070_1160114
1176 Ga0501071_0007693
1177 Ga0501071_0009204
1178 Ga0501071_0040307
1179 Ga0501071_0208996
1180 Ga0501071_0254425
1181 Ga0501071_0484328
1182 Ga0501071_0699653
1183 Ga0501072_0007385
1184 Ga0501072_0015376
1185 Ga0501072_0109836
1186 Ga0501072_0128142
1187 Ga0501072_0724475
1188 Ga0501072_1250211
1189 Ga0501073_0048594
1190 Ga0501073_0082459
1191 Ga0501073_0507950
1192 Ga0501073_0539328
1193 Ga0501074_0013245
1194 Ga0501074_0326055
1195 Ga0501074_0396365
1196 Ga0501074_0601966
1197 Ga0501074_0789231
1198 Ga0501075_0079590
1199 Ga0501075_0097920
1200 Ga0501075_0149458
1201 Ga0501075_0415789
1202 Ga0501075_0872205
1203 Ga0501076_0011826
1204 Ga0501076_0011855
1205 Ga0501076_0047184
1206 Ga0501076_0329718
1207 Ga0501076_0478807
1208 Ga0501077_0002508
1209 Ga0501077_0105817
1210 Ga0501077_0186267
1211 Ga0501207_045829
1212 Ga0501217_155307
1213 Ga0501225_0274758
1214 Ga0501229_034604
1215 Ga0501079_0005271
1216 Ga0501079_0142065
1217 Ga0501079_0502332
1218 Ga0501080_0001927
1219 Ga0501080_0010688
1220 Ga0501080_0027607
1221 Ga0501080_0082554
1222 Ga0501081_0001856
1223 Ga0501081_0006018
1224 Ga0501081_0062939
1225 Ga0501081_0245335
1226 Ga0501035_0013223
1227 Ga0501035_0213588
1228 Ga0501035_1221347
1229 Ga0501035_1322628
1230 Ga0501035_1400864
1231 Ga0501044_0402148
1232 Ga0501045_0002662
1233 Ga0501045_0104950
1234 Ga0501045_0164000
1235 nmdc:mga03683_253879_c1
1236 nmdc:mga05p37_1087070_c1
1237 nmdc:mga05p37_1193176_c1
1238 nmdc:mga05p37_232106_c1
1239 nmdc:mga05p37_240298_c1
1240 nmdc:mga05p37_448101_c1
1241 nmdc:mga05p37_758_c1
1242 nmdc:mga05p37_779981_c1
1243 nmdc:mga09592_1050_c1
1244 nmdc:mga09592_215679_c1
1245 nmdc:mga09592_230959_c1
1246 nmdc:mga09592_553218_c1
1247 nmdc:mga09592_772851_c1
1248 nmdc:mga0qj67_2437_c1
1249 nmdc:mga0qj67_451161_c1
1250 nmdc:mga0qj67_68243_c1
1251 nmdc:mga0qj67_8037_c1
1252 nmdc:mga06r32_223122_c1
1253 nmdc:mga06r32_271078_c1
1254 nmdc:mga06r32_276015_c1
1255 nmdc:mga06r32_5201_c1
1256 nmdc:mga06r32_755940_c1
1257 nmdc:mga08y16_12138_c1
1258 nmdc:mga08y16_141331_c1
1259 nmdc:mga08y16_150206_c1
1260 nmdc:mga08y16_16167_c1
1261 nmdc:mga08y16_340146_c1
1262 nmdc:mga08y16_35675_c1
1263 nmdc:mga08y16_513051_c1
1264 nmdc:mga08y16_97595_c1
1265 nmdc:mga0n895_15638_c1
1266 nmdc:mga0n895_1569_c1
1267 nmdc:mga0n895_1976_c1
1268 nmdc:mga0n895_21690_c1
1269 nmdc:mga0n895_659747_c1
1270 nmdc:mga0n895_811027_c1
1271 nmdc:mga0n895_976123_c1
1272 nmdc:mga0rr50_144788_c1
1273 nmdc:mga0rr50_201534_c1
1274 nmdc:mga0rr50_2095_c1
1275 nmdc:mga0rr50_22883_c1
1276 nmdc:mga0rr50_2740_c1
1277 nmdc:mga0rr50_62478_c1
1278 nmdc:mga08x19_106481_c1
1279 nmdc:mga08x19_1254_c1
1280 nmdc:mga08x19_18012_c1
1281 nmdc:mga08x19_204035_c1
1282 nmdc:mga08x19_33080_c1
1283 nmdc:mga0a205_1506880_c1
1284 nmdc:mga0a205_261255_c1
1285 nmdc:mga0a205_328555_c1
1286 nmdc:mga0a205_394053_c1
1287 nmdc:mga0a205_405263_c1
1288 nmdc:mga0a205_57416_c1
1289 nmdc:mga0a205_599_c1
1290 Ga0495601_0089434
1291 Ga0495601_0091420
1292 Ga0500566_0211484
1293 Ga0501084_0009272
1294 Ga0501084_0009536
1295 Ga0501084_0139560
1296 Ga0501084_0184062
1297 Ga0501084_0697546
1298 Ga0501084_0701219
1299 Ga0590071_005303
1300 Ga0590075_093202
1301 Ga0501082_0016248
1302 Ga0501082_0340816
1303 Ga0501082_0404326
1304 Ga0530510_0001351
1305 Ga0530510_0002568
1306 Ga0530510_0069673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.917 6 124
2iyn-assembly4.cif.gz_A the co-factor-induced pre-active conformation in phob 0.9117 8 124
7w9h-assembly1.cif.gz_A crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa 0.9094 7 121
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9092 7 124
2iyn-assembly3.cif.gz_C the co-factor-induced pre-active conformation in phob 0.9089 8 126
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9303 6 89 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9232 7 89 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.92 7 89 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9149 6 89 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9113 7 89 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F3YJ94-F1-model_v4 Response regulatory domain-containing protein 0.9863 1 129 GO:0000160
AF-A0A2T4ZTL8-F1-model_v4 deleted 0.9854 3 126
AF-A0A2M7G3A0-F1-model_v4 Response regulatory domain-containing protein 0.9801 3 126 GO:0000160
AF-A0A2E5KPT5-F1-model_v4 Response regulatory domain-containing protein 0.98 6 125 GO:0000160
AF-A0A2S8SW81-F1-model_v4 Response regulator receiver domain-containing protein 0.9794 6 126 GO:0000160

Map