F472765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 653 | 315 | 642 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300025928|Ga0207700_10520136|Ga0207700_105201362 |
| Length | 168 |
| Sequence | VSRPRPVKGRHQARKRAVDLLFEAEARGLSPAEVVDVRTALAEAKPDVAPLPAYTQTVARGVGDQLAHIDDLISSHLQGWTLDRLPAVDRAILRVAVWELLHDDVPEPVAVDEAVQLAKELSTDDSPGFVNGVLGHVMLVTPQIRAAAQAVRGAVGSDTTPEEHGPQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 6 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 7 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 8 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 9 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 10 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 11 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 200 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 201 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 202 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 204 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 205 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 206 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 307 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 310 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 311 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 312 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.32 |
| Metatranscriptomes | 0 |
| Isolates | 1.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.4 |
| Nodule | 0.15 |
| Rhizoplane | 9.04 |
| Rhizosphere | 70.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10028470 | 3300001990 | Bacteria | 1756 |
| 2 | JGI24737J22298_10096655 | 3300001990 | Bacteria | 876 |
| 3 | JGI24743J22301_10004175 | 3300001991 | Bacteria | 2336 |
| 4 | JGI24750J21931_1008178 | 3300002070 | Bacteria | 1327 |
| 5 | JGI24745J21846_1020926 | 3300002073 | Bacteria | 768 |
| 6 | JGI24748J21848_1001688 | 3300002074 | Bacteria | 2458 |
| 7 | JGI24738J21930_10075695 | 3300002075 | Bacteria | 701 |
| 8 | JGI24749J21850_1041713 | 3300002076 | Bacteria | 673 |
| 9 | JGI24744J21845_10001863 | 3300002077 | Bacteria | 4236 |
| 10 | JGI24034J26672_10003153 | 3300002239 | Bacteria | 2293 |
| 11 | JGI24034J26672_10028988 | 3300002239 | Bacteria | 895 |
| 12 | JGI24742J22300_10032239 | 3300002244 | Bacteria | 918 |
| 13 | Ga0070658_11071300 | 3300005327 | Bacteria | 701 |
| 14 | Ga0070658_11184698 | 3300005327 | Bacteria | 664 |
| 15 | Ga0070676_10108836 | 3300005328 | Bacteria | 1723 |
| 16 | Ga0070683_100617025 | 3300005329 | Bacteria | 1038 |
| 17 | Ga0070690_100070302 | 3300005330 | Bacteria | 2273 |
| 18 | Ga0070677_10024995 | 3300005333 | Bacteria | 2226 |
| 19 | Ga0070666_10059060 | 3300005335 | Bacteria | 2594 |
| 20 | Ga0070680_100359376 | 3300005336 | Bacteria | 1239 |
| 21 | Ga0070682_100020784 | 3300005337 | Bacteria | 3867 |
| 22 | Ga0070682_100027764 | 3300005337 | Bacteria | 3398 |
| 23 | Ga0068868_100002447 | 3300005338 | Bacteria | 12879 |
| 24 | Ga0068868_100603366 | 3300005338 | Bacteria | 973 |
| 25 | Ga0070660_100407619 | 3300005339 | Bacteria | 1125 |
| 26 | Ga0070660_100522261 | 3300005339 | Bacteria | 989 |
| 27 | Ga0070689_100050890 | 3300005340 | Bacteria | 3201 |
| 28 | Ga0070689_100056655 | 3300005340 | Bacteria | 3039 |
| 29 | Ga0070661_100691855 | 3300005344 | Bacteria | 830 |
| 30 | Ga0070668_100002161 | 3300005347 | Bacteria | 14391 |
| 31 | Ga0070668_100851224 | 3300005347 | Bacteria | 813 |
| 32 | Ga0070669_100003447 | 3300005353 | Bacteria | 11397 |
| 33 | Ga0070675_100059053 | 3300005354 | Bacteria | 3164 |
| 34 | Ga0070671_100074578 | 3300005355 | Bacteria | 2834 |
| 35 | Ga0070671_100093992 | 3300005355 | Bacteria | 2513 |
| 36 | Ga0070671_100155578 | 3300005355 | Bacteria | 1931 |
| 37 | Ga0070674_100011743 | 3300005356 | Bacteria | 5344 |
| 38 | Ga0070674_100043876 | 3300005356 | Bacteria | 3044 |
| 39 | Ga0070674_101573706 | 3300005356 | Bacteria | 592 |
| 40 | Ga0070673_100476711 | 3300005364 | Bacteria | 1126 |
| 41 | Ga0070673_100833987 | 3300005364 | Bacteria | 853 |
| 42 | Ga0070688_100029765 | 3300005365 | Bacteria | 3272 |
| 43 | Ga0070688_100291745 | 3300005365 | Bacteria | 1176 |
| 44 | Ga0070688_100913179 | 3300005365 | Bacteria | 693 |
| 45 | Ga0070659_100206977 | 3300005366 | Bacteria | 1616 |
| 46 | Ga0070667_100000034 | 3300005367 | Bacteria | 173652 |
| 47 | Ga0070667_100002881 | 3300005367 | Bacteria | 14788 |
| 48 | Ga0070667_100303783 | 3300005367 | Bacteria | 1437 |
| 49 | Ga0070667_101167993 | 3300005367 | Bacteria | 720 |
| 50 | Ga0070703_10147350 | 3300005406 | Bacteria | 881 |
| 51 | Ga0070709_10135573 | 3300005434 | Bacteria | 1686 |
| 52 | Ga0070709_11221136 | 3300005434 | Bacteria | 605 |
| 53 | Ga0070714_100169808 | 3300005435 | Bacteria | 1979 |
| 54 | Ga0070714_100220999 | 3300005435 | Bacteria | 1741 |
| 55 | Ga0070714_100290321 | 3300005435 | Bacteria | 1522 |
| 56 | Ga0070714_100330481 | 3300005435 | Bacteria | 1427 |
| 57 | Ga0070713_100260144 | 3300005436 | Bacteria | 1586 |
| 58 | Ga0070713_100379472 | 3300005436 | Bacteria | 1317 |
| 59 | Ga0070713_100860059 | 3300005436 | Bacteria | 871 |
| 60 | Ga0070710_10000423 | 3300005437 | Bacteria | 19929 |
| 61 | Ga0070710_10030661 | 3300005437 | Bacteria | 2895 |
| 62 | Ga0070710_10105794 | 3300005437 | Bacteria | 1683 |
| 63 | Ga0070701_10767381 | 3300005438 | Bacteria | 655 |
| 64 | Ga0070711_100007390 | 3300005439 | Bacteria | 6682 |
| 65 | Ga0070711_100020770 | 3300005439 | Bacteria | 4237 |
| 66 | Ga0070705_100003301 | 3300005440 | Bacteria | 7926 |
| 67 | Ga0070705_100511433 | 3300005440 | Bacteria | 913 |
| 68 | Ga0070700_100001071 | 3300005441 | Bacteria | 13571 |
| 69 | Ga0070700_100028795 | 3300005441 | Bacteria | 3307 |
| 70 | Ga0070700_100340696 | 3300005441 | Bacteria | 1108 |
| 71 | Ga0070694_100220739 | 3300005444 | Bacteria | 1421 |
| 72 | Ga0070694_100634186 | 3300005444 | Bacteria | 863 |
| 73 | Ga0070708_101542901 | 3300005445 | Bacteria | 619 |
| 74 | Ga0070663_100002171 | 3300005455 | Bacteria | 10972 |
| 75 | Ga0070663_100028798 | 3300005455 | Bacteria | 3786 |
| 76 | Ga0070678_100000075 | 3300005456 | Bacteria | 37282 |
| 77 | Ga0070678_100212217 | 3300005456 | Bacteria | 1604 |
| 78 | Ga0070678_100766699 | 3300005456 | Bacteria | 874 |
| 79 | Ga0068867_100002147 | 3300005459 | Bacteria | 13833 |
| 80 | Ga0070685_10162617 | 3300005466 | Bacteria | 1424 |
| 81 | Ga0070685_10288763 | 3300005466 | Bacteria | 1101 |
| 82 | Ga0070685_10494033 | 3300005466 | Bacteria | 865 |
| 83 | Ga0070679_101040829 | 3300005530 | Bacteria | 763 |
| 84 | Ga0070697_101177817 | 3300005536 | Bacteria | 683 |
| 85 | Ga0068853_100002826 | 3300005539 | Bacteria | 13152 |
| 86 | Ga0068853_100276079 | 3300005539 | Bacteria | 1548 |
| 87 | Ga0070672_101429988 | 3300005543 | Bacteria | 619 |
| 88 | Ga0070686_100042792 | 3300005544 | Bacteria | 2839 |
| 89 | Ga0070686_100475984 | 3300005544 | Bacteria | 965 |
| 90 | Ga0070695_100021602 | 3300005545 | Bacteria | 3941 |
| 91 | Ga0070696_100006661 | 3300005546 | Bacteria | 7716 |
| 92 | Ga0070693_100003717 | 3300005547 | Bacteria | 7137 |
| 93 | Ga0070693_100250061 | 3300005547 | Bacteria | 1175 |
| 94 | Ga0070665_100030748 | 3300005548 | Bacteria | 5403 |
| 95 | Ga0070665_100076253 | 3300005548 | Bacteria | 3360 |
| 96 | Ga0070665_100103991 | 3300005548 | Bacteria | 2843 |
| 97 | Ga0070704_100000415 | 3300005549 | Bacteria | 19786 |
| 98 | Ga0068855_100111357 | 3300005563 | Bacteria | 3143 |
| 99 | Ga0068855_101844032 | 3300005563 | Bacteria | 614 |
| 100 | Ga0070664_100876245 | 3300005564 | Bacteria | 841 |
| 101 | Ga0068854_100000209 | 3300005578 | Bacteria | 39503 |
| 102 | Ga0068854_100075993 | 3300005578 | Bacteria | 2467 |
| 103 | Ga0068854_100371601 | 3300005578 | Bacteria | 1176 |
| 104 | Ga0070702_100055497 | 3300005615 | Bacteria | 2284 |
| 105 | Ga0068852_100034595 | 3300005616 | Bacteria | 4205 |
| 106 | Ga0068852_100467726 | 3300005616 | Bacteria | 1251 |
| 107 | Ga0068859_100000228 | 3300005617 | Bacteria | 55135 |
| 108 | Ga0068859_100006371 | 3300005617 | Bacteria | 11971 |
| 109 | Ga0068859_100611201 | 3300005617 | Bacteria | 1183 |
| 110 | Ga0068859_100658938 | 3300005617 | Bacteria | 1138 |
| 111 | Ga0068864_100184186 | 3300005618 | Bacteria | 1911 |
| 112 | Ga0068864_101372683 | 3300005618 | Bacteria | 708 |
| 113 | Ga0068864_101890061 | 3300005618 | Bacteria | 603 |
| 114 | Ga0068866_10000202 | 3300005718 | Bacteria | 27989 |
| 115 | Ga0068866_10049914 | 3300005718 | Bacteria | 2123 |
| 116 | Ga0068866_10507717 | 3300005718 | Bacteria | 799 |
| 117 | Ga0068861_100001529 | 3300005719 | Bacteria | 14652 |
| 118 | Ga0068863_100002759 | 3300005841 | Bacteria | 17397 |
| 119 | Ga0068863_100027391 | 3300005841 | Bacteria | 5435 |
| 120 | Ga0068863_100248869 | 3300005841 | Bacteria | 1716 |
| 121 | Ga0068858_100059181 | 3300005842 | Bacteria | 3541 |
| 122 | Ga0068858_100216359 | 3300005842 | Bacteria | 1814 |
| 123 | Ga0068858_100219216 | 3300005842 | Bacteria | 1801 |
| 124 | Ga0068860_100000011 | 3300005843 | Bacteria | 328172 |
| 125 | Ga0068860_100001399 | 3300005843 | Bacteria | 26149 |
| 126 | Ga0068860_100083428 | 3300005843 | Bacteria | 3039 |
| 127 | Ga0068860_100201871 | 3300005843 | Bacteria | 1927 |
| 128 | Ga0068862_100000139 | 3300005844 | Bacteria | 82475 |
| 129 | Ga0068862_100009253 | 3300005844 | Bacteria | 8157 |
| 130 | Ga0068862_100573992 | 3300005844 | Bacteria | 1080 |
| 131 | Ga0068862_100850848 | 3300005844 | Bacteria | 894 |
| 132 | Ga0081455_10041564 | 3300005937 | Bacteria | 4041 |
| 133 | Ga0081455_10048108 | 3300005937 | Bacteria | 3687 |
| 134 | Ga0081455_10095990 | 3300005937 | Bacteria | 2391 |
| 135 | Ga0081538_10084471 | 3300005981 | Bacteria | 1672 |
| 136 | Ga0081540_1063160 | 3300005983 | Bacteria | 1754 |
| 137 | Ga0075365_10000694 | 3300006038 | Bacteria | 13537 |
| 138 | Ga0075365_10021166 | 3300006038 | Bacteria | 4051 |
| 139 | Ga0075365_10074187 | 3300006038 | Bacteria | 2294 |
| 140 | Ga0075365_10218666 | 3300006038 | Bacteria | 1336 |
| 141 | Ga0075365_10805280 | 3300006038 | Bacteria | 663 |
| 142 | Ga0075368_10276575 | 3300006042 | Bacteria | 721 |
| 143 | Ga0075363_100001512 | 3300006048 | Bacteria | 8880 |
| 144 | Ga0075363_100002442 | 3300006048 | Bacteria | 7594 |
| 145 | Ga0075363_100009800 | 3300006048 | Bacteria | 4515 |
| 146 | Ga0075363_100012710 | 3300006048 | Bacteria | 4063 |
| 147 | Ga0075363_100120930 | 3300006048 | Bacteria | 1462 |
| 148 | Ga0075363_100123338 | 3300006048 | Bacteria | 1448 |
| 149 | Ga0075364_10016218 | 3300006051 | Bacteria | 4634 |
| 150 | Ga0075364_10019402 | 3300006051 | Bacteria | 4267 |
| 151 | Ga0075364_10035521 | 3300006051 | Bacteria | 3221 |
| 152 | Ga0075364_10036360 | 3300006051 | Bacteria | 3183 |
| 153 | Ga0075364_10040610 | 3300006051 | Bacteria | 3018 |
| 154 | Ga0075364_10123872 | 3300006051 | Bacteria | 1731 |
| 155 | Ga0075364_10317768 | 3300006051 | Bacteria | 1060 |
| 156 | Ga0070715_10007335 | 3300006163 | Bacteria | 3794 |
| 157 | Ga0070715_10032186 | 3300006163 | Bacteria | 2134 |
| 158 | Ga0070716_100005247 | 3300006173 | Bacteria | 6263 |
| 159 | Ga0070716_100818061 | 3300006173 | Bacteria | 723 |
| 160 | Ga0070712_100001001 | 3300006175 | Bacteria | 17008 |
| 161 | Ga0070712_100011324 | 3300006175 | Bacteria | 5651 |
| 162 | Ga0070712_100171429 | 3300006175 | Bacteria | 1684 |
| 163 | Ga0075362_10020161 | 3300006177 | Bacteria | 2783 |
| 164 | Ga0075362_10189766 | 3300006177 | Bacteria | 998 |
| 165 | Ga0075367_10006967 | 3300006178 | Bacteria | 5757 |
| 166 | Ga0075367_10090173 | 3300006178 | Bacteria | 1864 |
| 167 | Ga0075367_10107060 | 3300006178 | Bacteria | 1714 |
| 168 | Ga0075367_10268321 | 3300006178 | Bacteria | 1072 |
| 169 | Ga0075369_10007707 | 3300006186 | Bacteria | 4115 |
| 170 | Ga0075369_10010160 | 3300006186 | Bacteria | 3677 |
| 171 | Ga0075369_10170206 | 3300006186 | Bacteria | 1000 |
| 172 | Ga0075369_10205301 | 3300006186 | Bacteria | 910 |
| 173 | Ga0097621_100244767 | 3300006237 | Bacteria | 1569 |
| 174 | Ga0075370_10059823 | 3300006353 | Bacteria | 2169 |
| 175 | Ga0075370_10138488 | 3300006353 | Bacteria | 1422 |
| 176 | Ga0068871_100289590 | 3300006358 | Bacteria | 1435 |
| 177 | Ga0068871_100311962 | 3300006358 | Bacteria | 1383 |
| 178 | Ga0075434_102125130 | 3300006871 | Bacteria | 566 |
| 179 | Ga0068865_100000661 | 3300006881 | Bacteria | 19433 |
| 180 | Ga0068865_100437596 | 3300006881 | Bacteria | 1078 |
| 181 | Ga0097620_100000228 | 3300006931 | Bacteria | 55135 |
| 182 | Ga0097620_100006372 | 3300006931 | Bacteria | 11971 |
| 183 | Ga0097620_100611226 | 3300006931 | Bacteria | 1183 |
| 184 | Ga0097620_100658951 | 3300006931 | Bacteria | 1138 |
| 185 | Ga0075435_100708670 | 3300007076 | Bacteria | 875 |
| 186 | Ga0105250_10034476 | 3300009092 | Bacteria | 2031 |
| 187 | Ga0105250_10052083 | 3300009092 | Bacteria | 1642 |
| 188 | Ga0105250_10061639 | 3300009092 | Bacteria | 1508 |
| 189 | Ga0105240_10637863 | 3300009093 | Bacteria | 1169 |
| 190 | Ga0105245_10127283 | 3300009098 | Bacteria | 2386 |
| 191 | Ga0105247_10000067 | 3300009101 | Bacteria | 118585 |
| 192 | Ga0105247_10000092 | 3300009101 | Bacteria | 97046 |
| 193 | Ga0105247_10080146 | 3300009101 | Bacteria | 2056 |
| 194 | Ga0105243_10001036 | 3300009148 | Bacteria | 25549 |
| 195 | Ga0105243_10105820 | 3300009148 | Bacteria | 2344 |
| 196 | Ga0105243_11081625 | 3300009148 | Bacteria | 809 |
| 197 | Ga0105243_11999303 | 3300009148 | Bacteria | 614 |
| 198 | Ga0105241_10733918 | 3300009174 | Bacteria | 904 |
| 199 | Ga0105241_10942241 | 3300009174 | Bacteria | 804 |
| 200 | Ga0105242_10000597 | 3300009176 | Bacteria | 28284 |
| 201 | Ga0105242_10431904 | 3300009176 | Bacteria | 1237 |
| 202 | Ga0105248_10000040 | 3300009177 | Bacteria | 172452 |
| 203 | Ga0105248_10005718 | 3300009177 | Bacteria | 13656 |
| 204 | Ga0105248_10035423 | 3300009177 | Bacteria | 5583 |
| 205 | Ga0105248_10425938 | 3300009177 | Bacteria | 1495 |
| 206 | Ga0105248_11048738 | 3300009177 | Bacteria | 921 |
| 207 | Ga0105237_10040797 | 3300009545 | Bacteria | 4681 |
| 208 | Ga0105237_10157556 | 3300009545 | Bacteria | 2268 |
| 209 | Ga0105237_10979498 | 3300009545 | Bacteria | 852 |
| 210 | Ga0105249_10000001 | 3300009553 | Bacteria | 504948 |
| 211 | Ga0105249_10001140 | 3300009553 | Bacteria | 23514 |
| 212 | Ga0105249_10025675 | 3300009553 | Bacteria | 5306 |
| 213 | Ga0105249_10298919 | 3300009553 | Bacteria | 1614 |
| 214 | Ga0105249_10919275 | 3300009553 | Bacteria | 942 |
| 215 | Ga0105239_10090134 | 3300010375 | Bacteria | 3383 |
| 216 | Ga0105246_10065212 | 3300011119 | Bacteria | 2546 |
| 217 | Ga0105246_10974516 | 3300011119 | Bacteria | 766 |
| 218 | Ga0105246_11041870 | 3300011119 | Bacteria | 743 |
| 219 | Ga0157371_10204796 | 3300013102 | Bacteria | 1415 |
| 220 | Ga0157371_10585675 | 3300013102 | Bacteria | 829 |
| 221 | Ga0157369_10360718 | 3300013105 | Bacteria | 1509 |
| 222 | Ga0157374_10086959 | 3300013296 | Bacteria | 2975 |
| 223 | Ga0157374_10476467 | 3300013296 | Bacteria | 1251 |
| 224 | Ga0157378_10002483 | 3300013297 | Bacteria | 16403 |
| 225 | Ga0157378_10059112 | 3300013297 | Bacteria | 3420 |
| 226 | Ga0157378_11215818 | 3300013297 | Bacteria | 793 |
| 227 | Ga0163162_10018721 | 3300013306 | Bacteria | 6787 |
| 228 | Ga0163162_10066182 | 3300013306 | Bacteria | 3662 |
| 229 | Ga0163162_10245894 | 3300013306 | Bacteria | 1920 |
| 230 | Ga0163162_10307995 | 3300013306 | Bacteria | 1716 |
| 231 | Ga0163162_11144724 | 3300013306 | Bacteria | 882 |
| 232 | Ga0163162_11316176 | 3300013306 | Bacteria | 821 |
| 233 | Ga0157372_10002385 | 3300013307 | Bacteria | 20339 |
| 234 | Ga0157372_11503556 | 3300013307 | Bacteria | 776 |
| 235 | Ga0157375_10000305 | 3300013308 | Bacteria | 44365 |
| 236 | Ga0157375_10535596 | 3300013308 | Bacteria | 1334 |
| 237 | Ga0163163_10157183 | 3300014325 | Bacteria | 2318 |
| 238 | Ga0163163_10224364 | 3300014325 | Bacteria | 1928 |
| 239 | Ga0163163_11140132 | 3300014325 | Bacteria | 842 |
| 240 | Ga0157380_10000732 | 3300014326 | Bacteria | 20467 |
| 241 | Ga0157380_12012175 | 3300014326 | Bacteria | 640 |
| 242 | Ga0157377_10094831 | 3300014745 | Bacteria | 1768 |
| 243 | Ga0157379_10022633 | 3300014968 | Bacteria | 5568 |
| 244 | Ga0157379_10066276 | 3300014968 | Bacteria | 3228 |
| 245 | Ga0157379_10084885 | 3300014968 | Bacteria | 2837 |
| 246 | Ga0163161_10004574 | 3300017792 | Bacteria | 9631 |
| 247 | Ga0163161_10009223 | 3300017792 | Bacteria | 6822 |
| 248 | Ga0163161_10265526 | 3300017792 | Bacteria | 1342 |
| 249 | Ga0213876_10000817 | 3300021384 | Bacteria | 21042 |
| 250 | Ga0213876_10038892 | 3300021384 | Bacteria | 2512 |
| 251 | Ga0213876_10088889 | 3300021384 | Bacteria | 1636 |
| 252 | Ga0213876_10139373 | 3300021384 | Bacteria | 1290 |
| 253 | Ga0213875_10018051 | 3300021388 | Bacteria | 3404 |
| 254 | Ga0213875_10024330 | 3300021388 | Bacteria | 2889 |
| 255 | Ga0224572_1035175 | 3300024225 | Bacteria | 951 |
| 256 | Ga0209025_1041064 | 3300025294 | Bacteria | 1988 |
| 257 | Ga0207653_10091115 | 3300025885 | Bacteria | 1068 |
| 258 | Ga0207692_10002656 | 3300025898 | Bacteria | 6879 |
| 259 | Ga0207642_10000164 | 3300025899 | Bacteria | 19066 |
| 260 | Ga0207642_10464897 | 3300025899 | Bacteria | 769 |
| 261 | Ga0207710_10000094 | 3300025900 | Bacteria | 118590 |
| 262 | Ga0207710_10020255 | 3300025900 | Bacteria | 2843 |
| 263 | Ga0207688_10000096 | 3300025901 | Bacteria | 34565 |
| 264 | Ga0207688_10000339 | 3300025901 | Bacteria | 21592 |
| 265 | Ga0207688_10160973 | 3300025901 | Bacteria | 1330 |
| 266 | Ga0207680_10048469 | 3300025903 | Bacteria | 2524 |
| 267 | Ga0207680_11079440 | 3300025903 | Bacteria | 574 |
| 268 | Ga0207647_10034535 | 3300025904 | Bacteria | 3227 |
| 269 | Ga0207685_10010811 | 3300025905 | Bacteria | 2715 |
| 270 | Ga0207685_10016497 | 3300025905 | Bacteria | 2366 |
| 271 | Ga0207699_10479287 | 3300025906 | Bacteria | 896 |
| 272 | Ga0207654_10527518 | 3300025911 | Bacteria | 837 |
| 273 | Ga0207671_10574578 | 3300025914 | Bacteria | 899 |
| 274 | Ga0207671_10584305 | 3300025914 | Bacteria | 890 |
| 275 | Ga0207693_10000634 | 3300025915 | Bacteria | 31449 |
| 276 | Ga0207693_10000717 | 3300025915 | Bacteria | 29831 |
| 277 | Ga0207663_10036412 | 3300025916 | Bacteria | 2960 |
| 278 | Ga0207660_10620460 | 3300025917 | Bacteria | 881 |
| 279 | Ga0207662_10087424 | 3300025918 | Bacteria | 1912 |
| 280 | Ga0207657_10243012 | 3300025919 | Bacteria | 1437 |
| 281 | Ga0207681_10028367 | 3300025923 | Bacteria | 3625 |
| 282 | Ga0207681_10066232 | 3300025923 | Bacteria | 2500 |
| 283 | Ga0207659_10038839 | 3300025926 | Bacteria | 3314 |
| 284 | Ga0207687_10001922 | 3300025927 | Bacteria | 14298 |
| 285 | Ga0207687_10017942 | 3300025927 | Bacteria | 4670 |
| 286 | Ga0207700_10450071 | 3300025928 | Bacteria | 1135 |
| 287 | Ga0207700_10520136 | 3300025928 | Bacteria | 1054 |
| 288 | Ga0207664_10184588 | 3300025929 | Bacteria | 1792 |
| 289 | Ga0207664_10605549 | 3300025929 | Bacteria | 984 |
| 290 | Ga0207664_11008833 | 3300025929 | Bacteria | 746 |
| 291 | Ga0207644_10010272 | 3300025931 | Bacteria | 6169 |
| 292 | Ga0207644_10014182 | 3300025931 | Bacteria | 5331 |
| 293 | Ga0207644_10125771 | 3300025931 | Bacteria | 1957 |
| 294 | Ga0207690_10312034 | 3300025932 | Bacteria | 1234 |
| 295 | Ga0207706_10023920 | 3300025933 | Bacteria | 5481 |
| 296 | Ga0207686_10031551 | 3300025934 | Bacteria | 3147 |
| 297 | Ga0207686_10309401 | 3300025934 | Bacteria | 1176 |
| 298 | Ga0207686_10719007 | 3300025934 | Bacteria | 795 |
| 299 | Ga0207709_10015396 | 3300025935 | Bacteria | 4240 |
| 300 | Ga0207709_10111098 | 3300025935 | Bacteria | 1833 |
| 301 | Ga0207670_10005154 | 3300025936 | Bacteria | 7145 |
| 302 | Ga0207670_10494212 | 3300025936 | Bacteria | 992 |
| 303 | Ga0207669_10002349 | 3300025937 | Bacteria | 8037 |
| 304 | Ga0207704_10175834 | 3300025938 | Bacteria | 1541 |
| 305 | Ga0207665_10002349 | 3300025939 | Bacteria | 12773 |
| 306 | Ga0207665_10031991 | 3300025939 | Bacteria | 3483 |
| 307 | Ga0207665_10435910 | 3300025939 | Bacteria | 1003 |
| 308 | Ga0207665_10568789 | 3300025939 | Bacteria | 882 |
| 309 | Ga0207665_10633602 | 3300025939 | Bacteria | 837 |
| 310 | Ga0207691_10074146 | 3300025940 | Bacteria | 3069 |
| 311 | Ga0207711_10000126 | 3300025941 | Bacteria | 80235 |
| 312 | Ga0207711_10114555 | 3300025941 | Bacteria | 2401 |
| 313 | Ga0207689_10029503 | 3300025942 | Bacteria | 4580 |
| 314 | Ga0207689_10330811 | 3300025942 | Bacteria | 1265 |
| 315 | Ga0207679_10858304 | 3300025945 | Bacteria | 829 |
| 316 | Ga0207667_10278466 | 3300025949 | Bacteria | 1709 |
| 317 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 318 | Ga0207712_10008843 | 3300025961 | Bacteria | 6367 |
| 319 | Ga0207668_10004608 | 3300025972 | Bacteria | 8106 |
| 320 | Ga0207640_10013966 | 3300025981 | Bacteria | 4612 |
| 321 | Ga0207640_10265749 | 3300025981 | Bacteria | 1339 |
| 322 | Ga0207640_10659150 | 3300025981 | Bacteria | 893 |
| 323 | Ga0207658_10000108 | 3300025986 | Bacteria | 90165 |
| 324 | Ga0207658_10007702 | 3300025986 | Bacteria | 7334 |
| 325 | Ga0207658_10028606 | 3300025986 | Bacteria | 3926 |
| 326 | Ga0207658_11074299 | 3300025986 | Bacteria | 735 |
| 327 | Ga0207677_10001300 | 3300026023 | Bacteria | 13408 |
| 328 | Ga0207677_10057209 | 3300026023 | Bacteria | 2676 |
| 329 | Ga0207703_10028770 | 3300026035 | Bacteria | 4384 |
| 330 | Ga0207703_10162284 | 3300026035 | Bacteria | 1958 |
| 331 | Ga0207639_10019367 | 3300026041 | Bacteria | 4852 |
| 332 | Ga0207639_10250904 | 3300026041 | Bacteria | 1543 |
| 333 | Ga0207678_10004438 | 3300026067 | Bacteria | 12622 |
| 334 | Ga0207678_10025301 | 3300026067 | Bacteria | 5182 |
| 335 | Ga0207678_11251419 | 3300026067 | Bacteria | 657 |
| 336 | Ga0207708_10068628 | 3300026075 | Bacteria | 2713 |
| 337 | Ga0207708_10386416 | 3300026075 | Bacteria | 1155 |
| 338 | Ga0207708_10765685 | 3300026075 | Bacteria | 829 |
| 339 | Ga0207702_10640121 | 3300026078 | Bacteria | 1045 |
| 340 | Ga0207641_10004858 | 3300026088 | Bacteria | 11567 |
| 341 | Ga0207641_10018642 | 3300026088 | Bacteria | 5688 |
| 342 | Ga0207641_10409857 | 3300026088 | Bacteria | 1303 |
| 343 | Ga0207641_11951286 | 3300026088 | Bacteria | 588 |
| 344 | Ga0207648_10001107 | 3300026089 | Bacteria | 30199 |
| 345 | Ga0207676_10160976 | 3300026095 | Bacteria | 1944 |
| 346 | Ga0207676_10508822 | 3300026095 | Bacteria | 1145 |
| 347 | Ga0207676_11250944 | 3300026095 | Bacteria | 736 |
| 348 | Ga0207675_100000555 | 3300026118 | Bacteria | 36440 |
| 349 | Ga0207675_100016977 | 3300026118 | Bacteria | 6802 |
| 350 | Ga0207675_100425344 | 3300026118 | Bacteria | 1312 |
| 351 | Ga0207683_10000795 | 3300026121 | Bacteria | 28807 |
| 352 | Ga0207683_10087918 | 3300026121 | Bacteria | 2764 |
| 353 | Ga0207698_10061977 | 3300026142 | Bacteria | 2918 |
| 354 | Ga0207698_10330721 | 3300026142 | Bacteria | 1431 |
| 355 | Ga0207698_10414057 | 3300026142 | Bacteria | 1291 |
| 356 | Ga0207698_11152272 | 3300026142 | Bacteria | 789 |
| 357 | Ga0268266_10003769 | 3300028379 | Bacteria | 14856 |
| 358 | Ga0268266_10005376 | 3300028379 | Bacteria | 11963 |
| 359 | Ga0268266_10037420 | 3300028379 | Bacteria | 4134 |
| 360 | Ga0268266_11038692 | 3300028379 | Bacteria | 793 |
| 361 | Ga0268266_11288999 | 3300028379 | Bacteria | 706 |
| 362 | Ga0268265_10000032 | 3300028380 | Bacteria | 225953 |
| 363 | Ga0268265_10005171 | 3300028380 | Bacteria | 8940 |
| 364 | Ga0268264_10000026 | 3300028381 | Bacteria | 459088 |
| 365 | Ga0268264_10010060 | 3300028381 | Bacteria | 7830 |
| 366 | Ga0268264_10147774 | 3300028381 | Bacteria | 2103 |
| 367 | Ga0307405_10184464 | 3300031731 | Bacteria | 1501 |
| 368 | Ga0307405_11029269 | 3300031731 | Bacteria | 704 |
| 369 | Ga0307410_10881920 | 3300031852 | Bacteria | 765 |
| 370 | Ga0307407_10102762 | 3300031903 | Bacteria | 1778 |
| 371 | Ga0307409_100109219 | 3300031995 | Bacteria | 2316 |
| 372 | Ga0307409_101707167 | 3300031995 | Bacteria | 658 |
| 373 | Ga0307416_101179957 | 3300032002 | Bacteria | 871 |
| 374 | Ga0307416_102347418 | 3300032002 | Bacteria | 633 |
| 375 | Ga0307414_10141581 | 3300032004 | Bacteria | 1884 |
| 376 | Ga0307411_10392426 | 3300032005 | Bacteria | 1145 |
| 377 | Ga0307415_100025121 | 3300032126 | Bacteria | 3733 |
| 378 | Ga0373932_0070853 | 3300035112 | Bacteria | 1081 |
| 379 | Ga0373960_0031948 | 3300035121 | Bacteria | 1476 |
| 380 | Ga0373943_0055212 | 3300035170 | Bacteria | 1967 |
| 381 | Ga0373962_0055165 | 3300035242 | Bacteria | 1154 |
| 382 | Ga0316582_0363370 | 3300036647 | Bacteria | 996 |
| 383 | Ga0436364_0182063 | 3300037853 | Bacteria | 3933 |
| 384 | Ga0436364_0829857 | 3300037853 | Bacteria | 1475 |
| 385 | Ga0436364_1324934 | 3300037853 | Bacteria | 6135 |
| 386 | Ga0436365_0191332 | 3300039437 | Bacteria | 8367 |
| 387 | Ga0436365_0308474 | 3300039437 | Bacteria | 32517 |
| 388 | Ga0436365_0619963 | 3300039437 | Bacteria | 8309 |
| 389 | Ga0436365_1880606 | 3300039437 | Bacteria | 3206 |
| 390 | Ga0436361_0289718 | 3300039447 | Bacteria | 1061 |
| 391 | Ga0439461_0000660 | 3300041410 | Bacteria | 4983 |
| 392 | Ga0439461_0001053 | 3300041410 | Bacteria | 4152 |
| 393 | Ga0439466_0006285 | 3300041411 | Bacteria | 4522 |
| 394 | Ga0439466_0017969 | 3300041411 | Bacteria | 2541 |
| 395 | Ga0439466_0144465 | 3300041411 | Bacteria | 729 |
| 396 | Ga0439465_0013714 | 3300041413 | Bacteria | 2523 |
| 397 | Ga0439465_0017397 | 3300041413 | Bacteria | 2244 |
| 398 | Ga0451789_1111759 | 3300041443 | Bacteria | 979 |
| 399 | Ga0439431_0000231 | 3300041997 | Bacteria | 11288 |
| 400 | Ga0439442_003399 | 3300042002 | Bacteria | 3146 |
| 401 | Ga0439442_012415 | 3300042002 | Bacteria | 1742 |
| 402 | Ga0439445_0069044 | 3300042004 | Bacteria | 975 |
| 403 | Ga0439434_0025194 | 3300042435 | Bacteria | 1794 |
| 404 | Ga0439434_0059574 | 3300042435 | Bacteria | 1192 |
| 405 | Ga0439434_0084049 | 3300042435 | Bacteria | 1012 |
| 406 | Ga0466969_0098062 | 3300044656 | Bacteria | 1382 |
| 407 | Ga0466972_0050787 | 3300044658 | Bacteria | 2001 |
| 408 | Ga0466972_0070800 | 3300044658 | Bacteria | 1664 |
| 409 | Ga0466972_0191181 | 3300044658 | Bacteria | 959 |
| 410 | Ga0466972_0257834 | 3300044658 | Bacteria | 815 |
| 411 | Ga0466965_0012698 | 3300044683 | Bacteria | 3966 |
| 412 | Ga0466965_0018506 | 3300044683 | Bacteria | 3340 |
| 413 | Ga0466966_0005651 | 3300044684 | Bacteria | 8226 |
| 414 | Ga0466963_0016907 | 3300044694 | Bacteria | 4544 |
| 415 | Ga0466964_0798735 | 3300044706 | Bacteria | 533 |
| 416 | Ga0466971_0193229 | 3300044719 | Bacteria | 959 |
| 417 | Ga0466971_0202401 | 3300044719 | Bacteria | 937 |
| 418 | Ga0466968_0000991 | 3300044735 | Bacteria | 9976 |
| 419 | Ga0466968_0020056 | 3300044735 | Bacteria | 2695 |
| 420 | Ga0466970_0009874 | 3300044765 | Bacteria | 4832 |
| 421 | Ga0466970_0235938 | 3300044765 | Bacteria | 1023 |
| 422 | Ga0466957_0010713 | 3300044842 | Bacteria | 5272 |
| 423 | Ga0466957_0040071 | 3300044842 | Bacteria | 2828 |
| 424 | Ga0466957_1393757 | 3300044842 | Bacteria | 510 |
| 425 | Ga0466960_0003659 | 3300044901 | Bacteria | 5931 |
| 426 | Ga0466960_0012369 | 3300044901 | Bacteria | 3599 |
| 427 | Ga0466960_0047430 | 3300044901 | Bacteria | 2060 |
| 428 | Ga0466960_0102515 | 3300044901 | Bacteria | 1476 |
| 429 | Ga0466959_0034592 | 3300045049 | Bacteria | 3737 |
| 430 | Ga0466959_0052465 | 3300045049 | Bacteria | 2986 |
| 431 | Ga0466959_0157436 | 3300045049 | Bacteria | 1598 |
| 432 | Ga0466958_0035849 | 3300045836 | Bacteria | 2965 |
| 433 | Ga0466958_0232120 | 3300045836 | Bacteria | 1178 |
| 434 | Ga0466958_0320054 | 3300045836 | Bacteria | 997 |
| 435 | Ga0466967_0042267 | 3300045976 | Bacteria | 3937 |
| 436 | Ga0466967_0047921 | 3300045976 | Bacteria | 3728 |
| 437 | Ga0466967_0325764 | 3300045976 | Bacteria | 1483 |
| 438 | Ga0466967_0342341 | 3300045976 | Bacteria | 1446 |
| 439 | Ga0466967_0569252 | 3300045976 | Bacteria | 1116 |
| 440 | Ga0466967_1398493 | 3300045976 | Bacteria | 697 |
| 441 | Ga0495603_0035005 | 3300046455 | Bacteria | 3018 |
| 442 | Ga0495629_0058598 | 3300046459 | Bacteria | 2693 |
| 443 | Ga0495638_0006741 | 3300046460 | Bacteria | 8318 |
| 444 | Ga0495641_0132167 | 3300046461 | Bacteria | 1114 |
| 445 | Ga0495582_0334826 | 3300046473 | Bacteria | 871 |
| 446 | Ga0495639_0686851 | 3300046475 | Bacteria | 528 |
| 447 | Ga0495662_0099083 | 3300046476 | Bacteria | 1425 |
| 448 | Ga0495596_0242398 | 3300046500 | Bacteria | 700 |
| 449 | Ga0495608_0325436 | 3300046511 | Bacteria | 949 |
| 450 | Ga0495665_0072295 | 3300046531 | Bacteria | 1816 |
| 451 | Ga0495640_0037748 | 3300046533 | Bacteria | 3404 |
| 452 | Ga0495609_0286882 | 3300046538 | Bacteria | 672 |
| 453 | Ga0495668_0266264 | 3300046616 | Bacteria | 938 |
| 454 | Ga0495611_0247821 | 3300046648 | Bacteria | 826 |
| 455 | Ga0495635_0542149 | 3300046663 | Bacteria | 763 |
| 456 | Ga0495588_0465592 | 3300046674 | Bacteria | 663 |
| 457 | Ga0495646_0291021 | 3300046680 | Bacteria | 866 |
| 458 | Ga0495658_0209263 | 3300046683 | Bacteria | 1218 |
| 459 | Ga0495669_0329596 | 3300046684 | Bacteria | 737 |
| 460 | Ga0495624_0159652 | 3300046690 | Bacteria | 1378 |
| 461 | Ga0495649_0293399 | 3300046694 | Bacteria | 829 |
| 462 | Ga0495674_0145983 | 3300047319 | Bacteria | 1986 |
| 463 | Ga0495672_0013924 | 3300047320 | Bacteria | 5529 |
| 464 | Ga0495672_0116847 | 3300047320 | Bacteria | 1424 |
| 465 | Ga0495676_0180582 | 3300047321 | Bacteria | 1479 |
| 466 | Ga0495683_0000381 | 3300047323 | Bacteria | 36243 |
| 467 | Ga0495673_0001061 | 3300047469 | Bacteria | 24141 |
| 468 | Ga0495686_0177994 | 3300047472 | Bacteria | 1234 |
| 469 | Ga0495593_0150692 | 3300047673 | Bacteria | 1176 |
| 470 | Ga0495614_0065358 | 3300048089 | Bacteria | 1565 |
| 471 | Ga0496100_0005184 | 3300048903 | Bacteria | 6991 |
| 472 | Ga0496100_0008547 | 3300048903 | Bacteria | 5714 |
| 473 | Ga0496100_0022949 | 3300048903 | Bacteria | 3783 |
| 474 | Ga0496100_0181901 | 3300048903 | Bacteria | 1521 |
| 475 | Ga0496100_0387677 | 3300048903 | Bacteria | 1062 |
| 476 | Ga0496101_0000011 | 3300048904 | Bacteria | 272153 |
| 477 | Ga0496101_0003004 | 3300048904 | Bacteria | 10394 |
| 478 | Ga0496101_0757096 | 3300048904 | Bacteria | 766 |
| 479 | Ga0496101_0788764 | 3300048904 | Bacteria | 749 |
| 480 | Ga0496101_1191908 | 3300048904 | Bacteria | 597 |
| 481 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 482 | Ga0496102_0001872 | 3300048905 | Bacteria | 18125 |
| 483 | Ga0496102_0013028 | 3300048905 | Bacteria | 7198 |
| 484 | Ga0496102_0016862 | 3300048905 | Bacteria | 6390 |
| 485 | Ga0496102_0031471 | 3300048905 | Bacteria | 4760 |
| 486 | Ga0496102_0036031 | 3300048905 | Bacteria | 4456 |
| 487 | Ga0496102_0040837 | 3300048905 | Bacteria | 4199 |
| 488 | Ga0496102_0135691 | 3300048905 | Bacteria | 2306 |
| 489 | Ga0496102_0156138 | 3300048905 | Bacteria | 2145 |
| 490 | Ga0496102_0241085 | 3300048905 | Bacteria | 1705 |
| 491 | Ga0496102_0375929 | 3300048905 | Bacteria | 1337 |
| 492 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 493 | Ga0496103_0000238 | 3300048906 | Bacteria | 53761 |
| 494 | Ga0496103_0000277 | 3300048906 | Bacteria | 48396 |
| 495 | Ga0496104_0002275 | 3300048907 | Bacteria | 16561 |
| 496 | Ga0496104_0158612 | 3300048907 | Bacteria | 2171 |
| 497 | Ga0496104_0381033 | 3300048907 | Bacteria | 1323 |
| 498 | Ga0496105_0075329 | 3300048908 | Bacteria | 2787 |
| 499 | Ga0496105_0216572 | 3300048908 | Bacteria | 1560 |
| 500 | Ga0496105_0372233 | 3300048908 | Bacteria | 1138 |
| 501 | Ga0496106_0000372 | 3300048909 | Bacteria | 31847 |
| 502 | Ga0496106_0030493 | 3300048909 | Bacteria | 4020 |
| 503 | Ga0496106_0212290 | 3300048909 | Bacteria | 1542 |
| 504 | Ga0496106_0255258 | 3300048909 | Bacteria | 1402 |
| 505 | Ga0496107_0001450 | 3300048910 | Bacteria | 14665 |
| 506 | Ga0496107_0047803 | 3300048910 | Bacteria | 3081 |
| 507 | Ga0496107_0064415 | 3300048910 | Bacteria | 2657 |
| 508 | Ga0496107_0722137 | 3300048910 | Bacteria | 732 |
| 509 | Ga0496108_0075141 | 3300048911 | Bacteria | 2854 |
| 510 | Ga0496108_0089352 | 3300048911 | Bacteria | 2618 |
| 511 | Ga0496108_0096097 | 3300048911 | Bacteria | 2523 |
| 512 | Ga0496109_0027943 | 3300048912 | Bacteria | 5042 |
| 513 | Ga0496109_0740846 | 3300048912 | Bacteria | 920 |
| 514 | Ga0496109_0836677 | 3300048912 | Bacteria | 858 |
| 515 | Ga0496110_0480322 | 3300048913 | Bacteria | 1132 |
| 516 | Ga0496112_0058201 | 3300048915 | Bacteria | 3806 |
| 517 | Ga0496112_0070252 | 3300048915 | Bacteria | 3460 |
| 518 | Ga0496112_0075493 | 3300048915 | Bacteria | 3333 |
| 519 | Ga0496112_0075802 | 3300048915 | Bacteria | 3326 |
| 520 | Ga0496112_0335357 | 3300048915 | Bacteria | 1456 |
| 521 | Ga0496112_0976810 | 3300048915 | Bacteria | 767 |
| 522 | Ga0496113_0011555 | 3300048916 | Bacteria | 5898 |
| 523 | Ga0496113_0054138 | 3300048916 | Bacteria | 3002 |
| 524 | Ga0496113_0306635 | 3300048916 | Bacteria | 1272 |
| 525 | Ga0496114_0003618 | 3300048917 | Bacteria | 11882 |
| 526 | Ga0496114_0056543 | 3300048917 | Bacteria | 3275 |
| 527 | Ga0496115_0016385 | 3300048918 | Bacteria | 5644 |
| 528 | Ga0496115_0161955 | 3300048918 | Bacteria | 1849 |
| 529 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 530 | Ga0496116_0049212 | 3300048919 | Bacteria | 2821 |
| 531 | Ga0496116_0332611 | 3300048919 | Bacteria | 705 |
| 532 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 533 | Ga0496117_0000904 | 3300048920 | Bacteria | 45615 |
| 534 | Ga0496117_0102024 | 3300048920 | Bacteria | 1812 |
| 535 | Ga0496117_0600105 | 3300048920 | Bacteria | 515 |
| 536 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 537 | Ga0496118_0000694 | 3300048921 | Bacteria | 54687 |
| 538 | Ga0496118_0001360 | 3300048921 | Bacteria | 36838 |
| 539 | Ga0496119_0004263 | 3300048922 | Bacteria | 14329 |
| 540 | Ga0496119_0146059 | 3300048922 | Bacteria | 1272 |
| 541 | Ga0496119_0152336 | 3300048922 | Bacteria | 1237 |
| 542 | Ga0496119_0363809 | 3300048922 | Bacteria | 697 |
| 543 | Ga0496120_0047626 | 3300048923 | Bacteria | 2471 |
| 544 | Ga0496120_0201476 | 3300048923 | Bacteria | 963 |
| 545 | Ga0496121_0001091 | 3300048924 | Bacteria | 47947 |
| 546 | Ga0496121_0002871 | 3300048924 | Bacteria | 25391 |
| 547 | Ga0496122_0004913 | 3300048925 | Bacteria | 16215 |
| 548 | Ga0496123_0009435 | 3300048926 | Bacteria | 8789 |
| 549 | Ga0496124_0025494 | 3300048927 | Bacteria | 5354 |
| 550 | Ga0496124_0443876 | 3300048927 | Bacteria | 887 |
| 551 | Ga0496125_0069855 | 3300048928 | Bacteria | 2752 |
| 552 | Ga0496126_0000236 | 3300048929 | Bacteria | 119350 |
| 553 | Ga0496126_0009442 | 3300048929 | Bacteria | 10357 |
| 554 | Ga0496126_0156705 | 3300048929 | Bacteria | 1948 |
| 555 | Ga0496126_0158798 | 3300048929 | Bacteria | 1933 |
| 556 | Ga0501032_0001152 | 3300049569 | Bacteria | 21169 |
| 557 | Ga0501032_0037570 | 3300049569 | Bacteria | 3301 |
| 558 | Ga0501032_0154505 | 3300049569 | Bacteria | 1508 |
| 559 | Ga0501033_0038775 | 3300049570 | Bacteria | 3559 |
| 560 | Ga0501034_0002753 | 3300049571 | Bacteria | 20648 |
| 561 | Ga0501034_0032813 | 3300049571 | Bacteria | 5272 |
| 562 | Ga0501034_0276823 | 3300049571 | Bacteria | 1618 |
| 563 | Ga0501036_0013223 | 3300049572 | Bacteria | 6854 |
| 564 | Ga0501036_0062835 | 3300049572 | Bacteria | 3145 |
| 565 | Ga0501037_0002998 | 3300049573 | Bacteria | 12259 |
| 566 | Ga0501037_0077962 | 3300049573 | Bacteria | 2404 |
| 567 | Ga0501038_0003343 | 3300049574 | Bacteria | 14956 |
| 568 | Ga0501039_0000887 | 3300049575 | Bacteria | 21753 |
| 569 | Ga0501043_0002160 | 3300049579 | Bacteria | 16773 |
| 570 | Ga0501043_0066196 | 3300049579 | Bacteria | 2837 |
| 571 | Ga0501046_0001024 | 3300049580 | Bacteria | 27292 |
| 572 | Ga0501047_0088989 | 3300049581 | Bacteria | 2964 |
| 573 | Ga0501047_0606626 | 3300049581 | Bacteria | 916 |
| 574 | Ga0501048_0151490 | 3300049582 | Bacteria | 1640 |
| 575 | Ga0501069_0709299 | 3300049585 | Bacteria | 607 |
| 576 | Ga0501070_0004347 | 3300049586 | Bacteria | 12181 |
| 577 | Ga0501070_0009277 | 3300049586 | Bacteria | 8322 |
| 578 | Ga0501070_1125583 | 3300049586 | Bacteria | 605 |
| 579 | Ga0501073_0117475 | 3300049589 | Bacteria | 1843 |
| 580 | Ga0501074_0610934 | 3300049590 | Bacteria | 771 |
| 581 | Ga0501080_0041695 | 3300049742 | Bacteria | 4276 |
| 582 | Ga0501080_0446459 | 3300049742 | Bacteria | 1160 |
| 583 | Ga0501035_0003983 | 3300049822 | Bacteria | 14082 |
| 584 | Ga0501044_0008894 | 3300049823 | Bacteria | 10976 |
| 585 | Ga0501044_0403113 | 3300049823 | Bacteria | 1280 |
| 586 | Ga0501044_0864028 | 3300049823 | Bacteria | 781 |
| 587 | nmdc:mga03683_14300_c1 | 3300050489 | Bacteria | 2934 |
| 588 | nmdc:mga03683_54316_c1 | 3300050489 | Bacteria | 1679 |
| 589 | nmdc:mga03683_78811_c1 | 3300050489 | Bacteria | 1419 |
| 590 | nmdc:mga03n38_113533_c1 | 3300050490 | Bacteria | 1322 |
| 591 | nmdc:mga03n38_15808_c1 | 3300050490 | Bacteria | 2922 |
| 592 | nmdc:mga03n38_3016_c1 | 3300050490 | Bacteria | 3780 |
| 593 | nmdc:mga03n38_366703_c1 | 3300050490 | Bacteria | 787 |
| 594 | nmdc:mga03n38_4001_c1 | 3300050490 | Bacteria | 4816 |
| 595 | nmdc:mga03n38_8312_c1 | 3300050490 | Bacteria | 3718 |
| 596 | nmdc:mga00v17_10423_c1 | 3300050491 | Bacteria | 5074 |
| 597 | nmdc:mga00v17_155612_c1 | 3300050491 | Bacteria | 1470 |
| 598 | nmdc:mga00v17_170118_c1 | 3300050491 | Bacteria | 1405 |
| 599 | nmdc:mga00v17_347012_c1 | 3300050491 | Bacteria | 965 |
| 600 | nmdc:mga00v17_3695_c1 | 3300050491 | Bacteria | 7906 |
| 601 | nmdc:mga00v17_438228_c1 | 3300050491 | Bacteria | 848 |
| 602 | nmdc:mga00v17_54243_c1 | 3300050491 | Bacteria | 2445 |
| 603 | nmdc:mga00v17_59759_c1 | 3300050491 | Bacteria | 2340 |
| 604 | nmdc:mga00v17_85154_c1 | 3300050491 | Bacteria | 1979 |
| 605 | nmdc:mga00v17_91425_c1 | 3300050491 | Bacteria | 1912 |
| 606 | nmdc:mga00v17_98692_c1 | 3300050491 | Bacteria | 1842 |
| 607 | nmdc:mga0yw44_100068_c1 | 3300050492 | Bacteria | 1845 |
| 608 | nmdc:mga0yw44_35816_c1 | 3300050492 | Bacteria | 2920 |
| 609 | nmdc:mga0yw44_632285_c1 | 3300050492 | Bacteria | 727 |
| 610 | nmdc:mga0yw44_72395_c1 | 3300050492 | Bacteria | 2142 |
| 611 | nmdc:mga0yw44_7865_c2 | 3300050492 | Bacteria | 4050 |
| 612 | nmdc:mga0yw44_988_c1 | 3300050492 | Bacteria | 4723 |
| 613 | nmdc:mga0k408_105819_c2 | 3300050493 | Bacteria | 660 |
| 614 | nmdc:mga06z11_13879_c1 | 3300050494 | Bacteria | 3551 |
| 615 | nmdc:mga06z11_255541_c1 | 3300050494 | Bacteria | 1033 |
| 616 | nmdc:mga07m45_13609_c1 | 3300050496 | Bacteria | 4321 |
| 617 | nmdc:mga07m45_204846_c1 | 3300050496 | Bacteria | 1148 |
| 618 | nmdc:mga07m45_305812_c1 | 3300050496 | Bacteria | 924 |
| 619 | nmdc:mga07m45_318818_c1 | 3300050496 | Bacteria | 903 |
| 620 | nmdc:mga07m45_9452_c1 | 3300050496 | Bacteria | 5059 |
| 621 | nmdc:mga07m45_9656_c1 | 3300050496 | Bacteria | 5014 |
| 622 | nmdc:mga0qj67_49997_c1 | 3300050509 | Bacteria | 3304 |
| 623 | nmdc:mga08y16_1391576_c1 | 3300050511 | Bacteria | 665 |
| 624 | nmdc:mga0rr50_653270_c1 | 3300050513 | Bacteria | 897 |
| 625 | nmdc:mga08x19_903965_c1 | 3300050514 | Bacteria | 627 |
| 626 | nmdc:mga0sz30_1043_c2 | 3300050516 | Bacteria | 3228 |
| 627 | nmdc:mga0sz30_142591_c1 | 3300050516 | Bacteria | 1058 |
| 628 | nmdc:mga0sz30_178607_c1 | 3300050516 | Bacteria | 941 |
| 629 | nmdc:mga0sz30_30910_c1 | 3300050516 | Bacteria | 936 |
| 630 | nmdc:mga0sz30_32515_c1 | 3300050516 | Bacteria | 2164 |
| 631 | nmdc:mga0sz30_5516_c1 | 3300050516 | Bacteria | 4645 |
| 632 | nmdc:mga0sz30_61224_c1 | 3300050516 | Bacteria | 1608 |
| 633 | Ga0500635_0001178 | 3300053080 | Bacteria | 6260 |
| 634 | Ga0495655_0025457 | 3300053083 | Bacteria | 1384 |
| 635 | Ga0495619_0036492 | 3300053085 | Bacteria | 3202 |
| 636 | Ga0500643_207979 | 3300053087 | Bacteria | 525 |
| 637 | Ga0500646_0032759 | 3300053090 | Bacteria | 1435 |
| 638 | Ga0500595_089341 | 3300053119 | Bacteria | 893 |
| 639 | Ga0500628_074421 | 3300053129 | Bacteria | 857 |
| 640 | Ga0500642_0036279 | 3300053130 | Bacteria | 2100 |
| 641 | Ga0500652_000914 | 3300053131 | Bacteria | 9744 |
| 642 | Ga0466962_0066899 | 3300061719 | Bacteria | 1715 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0037570 | Ga0501032_0037570_2083_2538 | 140 |
| 2 | 3300049570 | Ga0501033_0038775 | Ga0501033_0038775_1706_2161 | 140 |
| 3 | 3300049571 | Ga0501034_0002753 | Ga0501034_0002753_13708_14163 | 140 |
| 4 | 3300049572 | Ga0501036_0062835 | Ga0501036_0062835_688_1143 | 140 |
| 5 | 3300049573 | Ga0501037_0077962 | Ga0501037_0077962_448_903 | 140 |
| 6 | 3300049579 | Ga0501043_0066196 | Ga0501043_0066196_866_1321 | 140 |
| 7 | 3300049580 | Ga0501046_0001024 | Ga0501046_0001024_10856_11311 | 140 |
| 8 | 3300049581 | Ga0501047_0088989 | Ga0501047_0088989_901_1356 | 140 |
| 9 | 3300049582 | Ga0501048_0151490 | Ga0501048_0151490_1131_1586 | 140 |
| 10 | 3300049586 | Ga0501070_0009277 | Ga0501070_0009277_3382_3837 | 140 |
| 11 | 3300049742 | Ga0501080_0041695 | Ga0501080_0041695_1028_1483 | 140 |
| 12 | 3300049822 | Ga0501035_0003983 | Ga0501035_0003983_3254_3709 | 140 |
| 13 | 3300037853 | Ga0436364_0829857 | Ga0436364_0829857_842_1306 | 143 |
| 14 | 3300039437 | Ga0436365_0191332 | Ga0436365_0191332_5062_5526 | 143 |
| 15 | 3300049569 | Ga0501032_0154505 | Ga0501032_0154505_31_501 | 143 |
| 16 | 3300026121 | Ga0207683_10087918 | Ga0207683_100879183 | 148 |
| 17 | 3300046663 | Ga0495635_0542149 | Ga0495635_0542149_182_661 | 148 |
| 18 | 3300044706 | Ga0466964_0798735 | Ga0466964_0798735_13_471 | 149 |
| 19 | 3300048904 | Ga0496101_0788764 | Ga0496101_0788764_137_640 | 149 |
| 20 | 3300005563 | Ga0068855_100111357 | Ga0068855_1001113572 | 150 |
| 21 | 3300009093 | Ga0105240_10637863 | Ga0105240_106378632 | 150 |
| 22 | 3300009545 | Ga0105237_10040797 | Ga0105237_100407975 | 150 |
| 23 | 3300025914 | Ga0207671_10574578 | Ga0207671_105745781 | 150 |
| 24 | 3300044842 | Ga0466957_1393757 | Ga0466957_1393757_27_485 | 150 |
| 25 | 3300048903 | Ga0496100_0005184 | Ga0496100_0005184_5715_6194 | 150 |
| 26 | 3300048904 | Ga0496101_0000011 | Ga0496101_0000011_160926_161405 | 150 |
| 27 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_142136_142615 | 150 |
| 28 | 3300048905 | Ga0496102_0375929 | Ga0496102_0375929_493_951 | 150 |
| 29 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_172848_173327 | 150 |
| 30 | 3300048909 | Ga0496106_0030493 | Ga0496106_0030493_3225_3704 | 150 |
| 31 | 3300048910 | Ga0496107_0064415 | Ga0496107_0064415_1796_2275 | 150 |
| 32 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_138357_138836 | 150 |
| 33 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_172856_173335 | 150 |
| 34 | 3300048920 | Ga0496117_0102024 | Ga0496117_0102024_1249_1707 | 150 |
| 35 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_172856_173335 | 150 |
| 36 | 3300048921 | Ga0496118_0000694 | Ga0496118_0000694_38288_38746 | 150 |
| 37 | 3300048922 | Ga0496119_0152336 | Ga0496119_0152336_132_611 | 150 |
| 38 | 3300048922 | Ga0496119_0363809 | Ga0496119_0363809_87_566 | 150 |
| 39 | 3300048923 | Ga0496120_0201476 | Ga0496120_0201476_208_687 | 150 |
| 40 | 3300048924 | Ga0496121_0001091 | Ga0496121_0001091_512_991 | 150 |
| 41 | 3300048929 | Ga0496126_0000236 | Ga0496126_0000236_94100_94579 | 150 |
| 42 | 3300048929 | Ga0496126_0158798 | Ga0496126_0158798_347_871 | 150 |
| 43 | iso_pu_bacteria | 2738541264 | 2738668684 | 150 |
| 44 | iso_pu_bacteria | 2738541356 | 2739147876 | 150 |
| 45 | 3300021384 | Ga0213876_10139373 | Ga0213876_101393732 | 151 |
| 46 | 3300039437 | Ga0436365_1880606 | Ga0436365_1880606_825_1283 | 151 |
| 47 | 3300053130 | Ga0500642_0036279 | Ga0500642_0036279_219_686 | 151 |
| 48 | 3300005436 | Ga0070713_100379472 | Ga0070713_1003794722 | 152 |
| 49 | 3300005937 | Ga0081455_10041564 | Ga0081455_100415645 | 152 |
| 50 | 3300044719 | Ga0466971_0202401 | Ga0466971_0202401_16_492 | 152 |
| 51 | 3300061719 | Ga0466962_0066899 | Ga0466962_0066899_987_1463 | 152 |
| 52 | 3300005436 | Ga0070713_100260144 | Ga0070713_1002601442 | 154 |
| 53 | 3300005436 | Ga0070713_100860059 | Ga0070713_1008600591 | 154 |
| 54 | 3300005437 | Ga0070710_10105794 | Ga0070710_101057944 | 154 |
| 55 | 3300006038 | Ga0075365_10074187 | Ga0075365_100741872 | 154 |
| 56 | 3300006042 | Ga0075368_10276575 | Ga0075368_102765752 | 154 |
| 57 | 3300006048 | Ga0075363_100001512 | Ga0075363_1000015127 | 154 |
| 58 | 3300006051 | Ga0075364_10036360 | Ga0075364_100363604 | 154 |
| 59 | 3300006178 | Ga0075367_10268321 | Ga0075367_102683212 | 154 |
| 60 | 3300006186 | Ga0075369_10007707 | Ga0075369_100077072 | 154 |
| 61 | 3300021384 | Ga0213876_10000817 | Ga0213876_100008178 | 154 |
| 62 | 3300021388 | Ga0213875_10018051 | Ga0213875_100180513 | 154 |
| 63 | 3300036647 | Ga0316582_0363370 | Ga0316582_0363370_114_587 | 154 |
| 64 | 3300037853 | Ga0436364_1324934 | Ga0436364_1324934_1974_2474 | 154 |
| 65 | 3300039437 | Ga0436365_0308474 | Ga0436365_0308474_12768_13268 | 154 |
| 66 | 3300044656 | Ga0466969_0098062 | Ga0466969_0098062_592_1065 | 154 |
| 67 | 3300044684 | Ga0466966_0005651 | Ga0466966_0005651_3791_4264 | 154 |
| 68 | 3300044694 | Ga0466963_0016907 | Ga0466963_0016907_2050_2523 | 154 |
| 69 | 3300044719 | Ga0466971_0193229 | Ga0466971_0193229_272_745 | 154 |
| 70 | 3300044765 | Ga0466970_0235938 | Ga0466970_0235938_406_879 | 154 |
| 71 | 3300044842 | Ga0466957_0040071 | Ga0466957_0040071_1229_1702 | 154 |
| 72 | 3300044901 | Ga0466960_0047430 | Ga0466960_0047430_186_683 | 154 |
| 73 | 3300045049 | Ga0466959_0052465 | Ga0466959_0052465_154_627 | 154 |
| 74 | 3300045836 | Ga0466958_0035849 | Ga0466958_0035849_1043_1516 | 154 |
| 75 | 3300045976 | Ga0466967_0047921 | Ga0466967_0047921_3045_3542 | 154 |
| 76 | 3300050490 | nmdc:mga03n38_3016_c1 | nmdc:mga03n38_3016_c1_160_642 | 154 |
| 77 | 3300050491 | nmdc:mga00v17_170118_c1 | nmdc:mga00v17_170118_c1_74_556 | 154 |
| 78 | 3300050492 | nmdc:mga0yw44_72395_c1 | nmdc:mga0yw44_72395_c1_1023_1505 | 154 |
| 79 | 3300050494 | nmdc:mga06z11_255541_c1 | nmdc:mga06z11_255541_c1_50_532 | 154 |
| 80 | 3300050496 | nmdc:mga07m45_9452_c1 | nmdc:mga07m45_9452_c1_1112_1594 | 154 |
| 81 | 3300050516 | nmdc:mga0sz30_5516_c1 | nmdc:mga0sz30_5516_c1_2248_2730 | 154 |
| 82 | iso_pu_bacteria | 2738541274 | 2738705095 | 154 |
| 83 | iso_pu_bacteria | 2738543028 | 2739332792 | 154 |
| 84 | iso_pu_bacteria | 2842134933 | 2842138055 | 154 |
| 85 | iso_pu_bacteria | 2902799365 | 2902801186 | 154 |
| 86 | iso_pu_bacteria | 2929212328 | 2929215348 | 154 |
| 87 | iso_pu_bacteria | 2939582691 | 2939585936 | 154 |
| 88 | 3300005435 | Ga0070714_100330481 | Ga0070714_1003304812 | 155 |
| 89 | 3300025928 | Ga0207700_10450071 | Ga0207700_104500712 | 155 |
| 90 | 3300025929 | Ga0207664_10184588 | Ga0207664_101845882 | 155 |
| 91 | 3300039447 | Ga0436361_0289718 | Ga0436361_0289718_225_719 | 155 |
| 92 | 3300050489 | nmdc:mga03683_78811_c1 | nmdc:mga03683_78811_c1_574_1059 | 155 |
| 93 | 3300053087 | Ga0500643_207979 | Ga0500643_207979_18_506 | 155 |
| 94 | iso_pu_bacteria | 2643221715 | 2644633583 | 155 |
| 95 | iso_pu_bacteria | 2902792274 | 2902796062 | 155 |
| 96 | iso_pu_bacteria | 2902810491 | 2902815113 | 155 |
| 97 | 3300005578 | Ga0068854_100371601 | Ga0068854_1003716012 | 156 |
| 98 | 3300005616 | Ga0068852_100467726 | Ga0068852_1004677261 | 156 |
| 99 | 3300006038 | Ga0075365_10805280 | Ga0075365_108052802 | 156 |
| 100 | 3300006175 | Ga0070712_100171429 | Ga0070712_1001714292 | 156 |
| 101 | 3300025928 | Ga0207700_10520136 | Ga0207700_105201362 | 156 |
| 102 | 3300025932 | Ga0207690_10312034 | Ga0207690_103120343 | 156 |
| 103 | 3300025939 | Ga0207665_10435910 | Ga0207665_104359102 | 156 |
| 104 | 3300025981 | Ga0207640_10659150 | Ga0207640_106591502 | 156 |
| 105 | 3300047472 | Ga0495686_0177994 | Ga0495686_0177994_290_763 | 156 |
| 106 | 3300049823 | Ga0501044_0008894 | Ga0501044_0008894_6052_6540 | 156 |
| 107 | 3300005435 | Ga0070714_100220999 | Ga0070714_1002209993 | 157 |
| 108 | 3300005530 | Ga0070679_101040829 | Ga0070679_1010408292 | 157 |
| 109 | 3300006038 | Ga0075365_10218666 | Ga0075365_102186662 | 157 |
| 110 | 3300006051 | Ga0075364_10035521 | Ga0075364_100355213 | 157 |
| 111 | 3300006871 | Ga0075434_102125130 | Ga0075434_1021251301 | 157 |
| 112 | 3300021388 | Ga0213875_10024330 | Ga0213875_100243303 | 157 |
| 113 | 3300026067 | Ga0207678_11251419 | Ga0207678_112514191 | 157 |
| 114 | 3300037853 | Ga0436364_0182063 | Ga0436364_0182063_2530_3027 | 157 |
| 115 | 3300045976 | Ga0466967_0325764 | Ga0466967_0325764_318_800 | 157 |
| 116 | 3300046694 | Ga0495649_0293399 | Ga0495649_0293399_26_529 | 157 |
| 117 | 3300048905 | Ga0496102_0241085 | Ga0496102_0241085_398_889 | 157 |
| 118 | 3300049590 | Ga0501074_0610934 | Ga0501074_0610934_18_527 | 157 |
| 119 | 3300050491 | nmdc:mga00v17_347012_c1 | nmdc:mga00v17_347012_c1_381_860 | 157 |
| 120 | 3300050491 | nmdc:mga00v17_85154_c1 | nmdc:mga00v17_85154_c1_1407_1886 | 157 |
| 121 | 3300050492 | nmdc:mga0yw44_100068_c1 | nmdc:mga0yw44_100068_c1_766_1245 | 157 |
| 122 | 3300053080 | Ga0500635_0001178 | Ga0500635_0001178_5641_6135 | 157 |
| 123 | 3300053131 | Ga0500652_000914 | Ga0500652_000914_3224_3718 | 157 |
| 124 | 3300005327 | Ga0070658_11071300 | Ga0070658_110713002 | 158 |
| 125 | 3300005329 | Ga0070683_100617025 | Ga0070683_1006170252 | 158 |
| 126 | 3300005337 | Ga0070682_100027764 | Ga0070682_1000277642 | 158 |
| 127 | 3300005339 | Ga0070660_100522261 | Ga0070660_1005222612 | 158 |
| 128 | 3300005344 | Ga0070661_100691855 | Ga0070661_1006918552 | 158 |
| 129 | 3300005367 | Ga0070667_100303783 | Ga0070667_1003037831 | 158 |
| 130 | 3300005455 | Ga0070663_100028798 | Ga0070663_1000287986 | 158 |
| 131 | 3300005456 | Ga0070678_100766699 | Ga0070678_1007666992 | 158 |
| 132 | 3300005466 | Ga0070685_10162617 | Ga0070685_101626172 | 158 |
| 133 | 3300005564 | Ga0070664_100876245 | Ga0070664_1008762451 | 158 |
| 134 | 3300006048 | Ga0075363_100123338 | Ga0075363_1001233382 | 158 |
| 135 | 3300009148 | Ga0105243_11999303 | Ga0105243_119993032 | 158 |
| 136 | 3300014325 | Ga0163163_11140132 | Ga0163163_111401322 | 158 |
| 137 | 3300021384 | Ga0213876_10038892 | Ga0213876_100388922 | 158 |
| 138 | 3300021384 | Ga0213876_10088889 | Ga0213876_100888893 | 158 |
| 139 | 3300024225 | Ga0224572_1035175 | Ga0224572_10351752 | 158 |
| 140 | 3300025934 | Ga0207686_10719007 | Ga0207686_107190072 | 158 |
| 141 | 3300025939 | Ga0207665_10633602 | Ga0207665_106336022 | 158 |
| 142 | 3300025945 | Ga0207679_10858304 | Ga0207679_108583042 | 158 |
| 143 | 3300026067 | Ga0207678_10025301 | Ga0207678_100253017 | 158 |
| 144 | 3300026142 | Ga0207698_10330721 | Ga0207698_103307213 | 158 |
| 145 | 3300028379 | Ga0268266_11038692 | Ga0268266_110386921 | 158 |
| 146 | 3300035170 | Ga0373943_0055212 | Ga0373943_0055212_1463_1954 | 158 |
| 147 | 3300039437 | Ga0436365_0619963 | Ga0436365_0619963_3417_3923 | 158 |
| 148 | 3300041443 | Ga0451789_1111759 | Ga0451789_1111759_401_880 | 158 |
| 149 | 3300044658 | Ga0466972_0191181 | Ga0466972_0191181_398_874 | 158 |
| 150 | 3300044658 | Ga0466972_0257834 | Ga0466972_0257834_228_710 | 158 |
| 151 | 3300044683 | Ga0466965_0012698 | Ga0466965_0012698_1182_1658 | 158 |
| 152 | 3300044683 | Ga0466965_0018506 | Ga0466965_0018506_1456_1938 | 158 |
| 153 | 3300044735 | Ga0466968_0000991 | Ga0466968_0000991_1386_1862 | 158 |
| 154 | 3300044765 | Ga0466970_0009874 | Ga0466970_0009874_614_1090 | 158 |
| 155 | 3300044842 | Ga0466957_0010713 | Ga0466957_0010713_2340_2816 | 158 |
| 156 | 3300044901 | Ga0466960_0003659 | Ga0466960_0003659_3079_3555 | 158 |
| 157 | 3300044901 | Ga0466960_0012369 | Ga0466960_0012369_1869_2351 | 158 |
| 158 | 3300045049 | Ga0466959_0034592 | Ga0466959_0034592_280_792 | 158 |
| 159 | 3300045836 | Ga0466958_0232120 | Ga0466958_0232120_114_590 | 158 |
| 160 | 3300045976 | Ga0466967_0342341 | Ga0466967_0342341_251_727 | 158 |
| 161 | 3300045976 | Ga0466967_1398493 | Ga0466967_1398493_76_555 | 158 |
| 162 | 3300046455 | Ga0495603_0035005 | Ga0495603_0035005_229_720 | 158 |
| 163 | 3300046459 | Ga0495629_0058598 | Ga0495629_0058598_1266_1757 | 158 |
| 164 | 3300046460 | Ga0495638_0006741 | Ga0495638_0006741_108_587 | 158 |
| 165 | 3300046461 | Ga0495641_0132167 | Ga0495641_0132167_45_536 | 158 |
| 166 | 3300046473 | Ga0495582_0334826 | Ga0495582_0334826_91_582 | 158 |
| 167 | 3300046475 | Ga0495639_0686851 | Ga0495639_0686851_21_512 | 158 |
| 168 | 3300046476 | Ga0495662_0099083 | Ga0495662_0099083_491_982 | 158 |
| 169 | 3300046511 | Ga0495608_0325436 | Ga0495608_0325436_301_792 | 158 |
| 170 | 3300046531 | Ga0495665_0072295 | Ga0495665_0072295_788_1279 | 158 |
| 171 | 3300046533 | Ga0495640_0037748 | Ga0495640_0037748_2110_2601 | 158 |
| 172 | 3300046674 | Ga0495588_0465592 | Ga0495588_0465592_25_516 | 158 |
| 173 | 3300046680 | Ga0495646_0291021 | Ga0495646_0291021_178_669 | 158 |
| 174 | 3300046683 | Ga0495658_0209263 | Ga0495658_0209263_437_928 | 158 |
| 175 | 3300046690 | Ga0495624_0159652 | Ga0495624_0159652_144_635 | 158 |
| 176 | 3300047319 | Ga0495674_0145983 | Ga0495674_0145983_1000_1491 | 158 |
| 177 | 3300047321 | Ga0495676_0180582 | Ga0495676_0180582_426_917 | 158 |
| 178 | 3300047673 | Ga0495593_0150692 | Ga0495593_0150692_381_872 | 158 |
| 179 | 3300048089 | Ga0495614_0065358 | Ga0495614_0065358_348_839 | 158 |
| 180 | 3300048903 | Ga0496100_0387677 | Ga0496100_0387677_281_757 | 158 |
| 181 | 3300048908 | Ga0496105_0372233 | Ga0496105_0372233_517_996 | 158 |
| 182 | 3300048912 | Ga0496109_0740846 | Ga0496109_0740846_226_705 | 158 |
| 183 | 3300048915 | Ga0496112_0058201 | Ga0496112_0058201_1242_1718 | 158 |
| 184 | 3300048915 | Ga0496112_0070252 | Ga0496112_0070252_670_1149 | 158 |
| 185 | 3300048915 | Ga0496112_0335357 | Ga0496112_0335357_454_933 | 158 |
| 186 | 3300048915 | Ga0496112_0976810 | Ga0496112_0976810_163_642 | 158 |
| 187 | 3300048916 | Ga0496113_0054138 | Ga0496113_0054138_1242_1718 | 158 |
| 188 | 3300048920 | Ga0496117_0600105 | Ga0496117_0600105_14_490 | 158 |
| 189 | 3300048925 | Ga0496122_0004913 | Ga0496122_0004913_3028_3504 | 158 |
| 190 | 3300048926 | Ga0496123_0009435 | Ga0496123_0009435_3401_3877 | 158 |
| 191 | 3300048927 | Ga0496124_0443876 | Ga0496124_0443876_159_635 | 158 |
| 192 | 3300048929 | Ga0496126_0009442 | Ga0496126_0009442_4813_5289 | 158 |
| 193 | 3300049569 | Ga0501032_0001152 | Ga0501032_0001152_5437_5919 | 158 |
| 194 | 3300049571 | Ga0501034_0032813 | Ga0501034_0032813_1985_2467 | 158 |
| 195 | 3300049572 | Ga0501036_0013223 | Ga0501036_0013223_188_670 | 158 |
| 196 | 3300049573 | Ga0501037_0002998 | Ga0501037_0002998_2895_3377 | 158 |
| 197 | 3300049574 | Ga0501038_0003343 | Ga0501038_0003343_5565_6047 | 158 |
| 198 | 3300049575 | Ga0501039_0000887 | Ga0501039_0000887_19553_20035 | 158 |
| 199 | 3300049579 | Ga0501043_0002160 | Ga0501043_0002160_3238_3720 | 158 |
| 200 | 3300049586 | Ga0501070_0004347 | Ga0501070_0004347_4631_5113 | 158 |
| 201 | 3300049589 | Ga0501073_0117475 | Ga0501073_0117475_921_1403 | 158 |
| 202 | 3300049823 | Ga0501044_0403113 | Ga0501044_0403113_377_895 | 158 |
| 203 | 3300050511 | nmdc:mga08y16_1391576_c1 | nmdc:mga08y16_1391576_c1_44_535 | 158 |
| 204 | 3300050514 | nmdc:mga08x19_903965_c1 | nmdc:mga08x19_903965_c1_54_545 | 158 |
| 205 | 3300053083 | Ga0495655_0025457 | Ga0495655_0025457_694_1173 | 158 |
| 206 | 3300053085 | Ga0495619_0036492 | Ga0495619_0036492_397_888 | 158 |
| 207 | 3300053119 | Ga0500595_089341 | Ga0500595_089341_337_816 | 158 |
| 208 | 3300053129 | Ga0500628_074421 | Ga0500628_074421_221_700 | 158 |
| 209 | 3300005353 | Ga0070669_100003447 | Ga0070669_10000344710 | 159 |
| 210 | 3300005355 | Ga0070671_100074578 | Ga0070671_1000745783 | 159 |
| 211 | 3300005355 | Ga0070671_100155578 | Ga0070671_1001555783 | 159 |
| 212 | 3300005356 | Ga0070674_101573706 | Ga0070674_1015737061 | 159 |
| 213 | 3300005365 | Ga0070688_100913179 | Ga0070688_1009131792 | 159 |
| 214 | 3300005367 | Ga0070667_100000034 | Ga0070667_10000003498 | 159 |
| 215 | 3300005441 | Ga0070700_100340696 | Ga0070700_1003406962 | 159 |
| 216 | 3300005466 | Ga0070685_10288763 | Ga0070685_102887631 | 159 |
| 217 | 3300005536 | Ga0070697_101177817 | Ga0070697_1011778171 | 159 |
| 218 | 3300005544 | Ga0070686_100042792 | Ga0070686_1000427923 | 159 |
| 219 | 3300005548 | Ga0070665_100076253 | Ga0070665_1000762533 | 159 |
| 220 | 3300005548 | Ga0070665_100103991 | Ga0070665_1001039913 | 159 |
| 221 | 3300005617 | Ga0068859_100000228 | Ga0068859_10000022848 | 159 |
| 222 | 3300005618 | Ga0068864_101372683 | Ga0068864_1013726832 | 159 |
| 223 | 3300005841 | Ga0068863_100002759 | Ga0068863_1000027599 | 159 |
| 224 | 3300005841 | Ga0068863_100027391 | Ga0068863_1000273916 | 159 |
| 225 | 3300005843 | Ga0068860_100000011 | Ga0068860_100000011143 | 159 |
| 226 | 3300005844 | Ga0068862_100000139 | Ga0068862_10000013966 | 159 |
| 227 | 3300005844 | Ga0068862_100850848 | Ga0068862_1008508482 | 159 |
| 228 | 3300005937 | Ga0081455_10048108 | Ga0081455_100481084 | 159 |
| 229 | 3300005937 | Ga0081455_10095990 | Ga0081455_100959903 | 159 |
| 230 | 3300005983 | Ga0081540_1063160 | Ga0081540_10631602 | 159 |
| 231 | 3300006038 | Ga0075365_10000694 | Ga0075365_1000069410 | 159 |
| 232 | 3300006048 | Ga0075363_100002442 | Ga0075363_1000024425 | 159 |
| 233 | 3300006051 | Ga0075364_10016218 | Ga0075364_100162184 | 159 |
| 234 | 3300006051 | Ga0075364_10123872 | Ga0075364_101238722 | 159 |
| 235 | 3300006173 | Ga0070716_100818061 | Ga0070716_1008180612 | 159 |
| 236 | 3300006177 | Ga0075362_10020161 | Ga0075362_100201613 | 159 |
| 237 | 3300006178 | Ga0075367_10090173 | Ga0075367_100901733 | 159 |
| 238 | 3300006186 | Ga0075369_10010160 | Ga0075369_100101603 | 159 |
| 239 | 3300006186 | Ga0075369_10205301 | Ga0075369_102053012 | 159 |
| 240 | 3300006931 | Ga0097620_100000228 | Ga0097620_10000022848 | 159 |
| 241 | 3300009092 | Ga0105250_10034476 | Ga0105250_100344762 | 159 |
| 242 | 3300009092 | Ga0105250_10061639 | Ga0105250_100616392 | 159 |
| 243 | 3300009101 | Ga0105247_10000067 | Ga0105247_1000006770 | 159 |
| 244 | 3300009174 | Ga0105241_10942241 | Ga0105241_109422411 | 159 |
| 245 | 3300009177 | Ga0105248_10000040 | Ga0105248_10000040103 | 159 |
| 246 | 3300009177 | Ga0105248_10425938 | Ga0105248_104259382 | 159 |
| 247 | 3300009177 | Ga0105248_11048738 | Ga0105248_110487382 | 159 |
| 248 | 3300009545 | Ga0105237_10979498 | Ga0105237_109794982 | 159 |
| 249 | 3300009553 | Ga0105249_10000001 | Ga0105249_10000001189 | 159 |
| 250 | 3300009553 | Ga0105249_10025675 | Ga0105249_100256756 | 159 |
| 251 | 3300009553 | Ga0105249_10919275 | Ga0105249_109192752 | 159 |
| 252 | 3300013105 | Ga0157369_10360718 | Ga0157369_103607182 | 159 |
| 253 | 3300013306 | Ga0163162_10066182 | Ga0163162_100661824 | 159 |
| 254 | 3300013306 | Ga0163162_10307995 | Ga0163162_103079952 | 159 |
| 255 | 3300014325 | Ga0163163_10157183 | Ga0163163_101571833 | 159 |
| 256 | 3300014968 | Ga0157379_10066276 | Ga0157379_100662762 | 159 |
| 257 | 3300025900 | Ga0207710_10000094 | Ga0207710_1000009471 | 159 |
| 258 | 3300025901 | Ga0207688_10160973 | Ga0207688_101609732 | 159 |
| 259 | 3300025923 | Ga0207681_10028367 | Ga0207681_100283674 | 159 |
| 260 | 3300025931 | Ga0207644_10010272 | Ga0207644_100102727 | 159 |
| 261 | 3300025931 | Ga0207644_10014182 | Ga0207644_100141823 | 159 |
| 262 | 3300025939 | Ga0207665_10568789 | Ga0207665_105687892 | 159 |
| 263 | 3300025941 | Ga0207711_10000126 | Ga0207711_1000012643 | 159 |
| 264 | 3300025961 | Ga0207712_10000006 | Ga0207712_10000006304 | 159 |
| 265 | 3300025986 | Ga0207658_10000108 | Ga0207658_1000010820 | 159 |
| 266 | 3300025986 | Ga0207658_10028606 | Ga0207658_100286064 | 159 |
| 267 | 3300026075 | Ga0207708_10386416 | Ga0207708_103864162 | 159 |
| 268 | 3300026088 | Ga0207641_10004858 | Ga0207641_100048589 | 159 |
| 269 | 3300026088 | Ga0207641_10018642 | Ga0207641_100186423 | 159 |
| 270 | 3300026088 | Ga0207641_11951286 | Ga0207641_119512861 | 159 |
| 271 | 3300026095 | Ga0207676_10508822 | Ga0207676_105088222 | 159 |
| 272 | 3300026095 | Ga0207676_11250944 | Ga0207676_112509442 | 159 |
| 273 | 3300026118 | Ga0207675_100425344 | Ga0207675_1004253442 | 159 |
| 274 | 3300028379 | Ga0268266_10003769 | Ga0268266_1000376915 | 159 |
| 275 | 3300028379 | Ga0268266_10005376 | Ga0268266_100053764 | 159 |
| 276 | 3300028380 | Ga0268265_10000032 | Ga0268265_10000032216 | 159 |
| 277 | 3300028381 | Ga0268264_10000026 | Ga0268264_10000026300 | 159 |
| 278 | 3300031731 | Ga0307405_11029269 | Ga0307405_110292692 | 159 |
| 279 | 3300031852 | Ga0307410_10881920 | Ga0307410_108819202 | 159 |
| 280 | 3300041410 | Ga0439461_0001053 | Ga0439461_0001053_1996_2475 | 159 |
| 281 | 3300041411 | Ga0439466_0006285 | Ga0439466_0006285_3207_3686 | 159 |
| 282 | 3300041411 | Ga0439466_0144465 | Ga0439466_0144465_171_650 | 159 |
| 283 | 3300041413 | Ga0439465_0017397 | Ga0439465_0017397_646_1125 | 159 |
| 284 | 3300041997 | Ga0439431_0000231 | Ga0439431_0000231_9926_10405 | 159 |
| 285 | 3300042002 | Ga0439442_012415 | Ga0439442_012415_188_667 | 159 |
| 286 | 3300042004 | Ga0439445_0069044 | Ga0439445_0069044_13_492 | 159 |
| 287 | 3300042435 | Ga0439434_0025194 | Ga0439434_0025194_462_941 | 159 |
| 288 | 3300042435 | Ga0439434_0084049 | Ga0439434_0084049_105_584 | 159 |
| 289 | 3300045976 | Ga0466967_0042267 | Ga0466967_0042267_2605_3084 | 159 |
| 290 | 3300046616 | Ga0495668_0266264 | Ga0495668_0266264_178_657 | 159 |
| 291 | 3300047320 | Ga0495672_0013924 | Ga0495672_0013924_4625_5104 | 159 |
| 292 | 3300047320 | Ga0495672_0116847 | Ga0495672_0116847_889_1371 | 159 |
| 293 | 3300047469 | Ga0495673_0001061 | Ga0495673_0001061_20496_20975 | 159 |
| 294 | 3300048903 | Ga0496100_0181901 | Ga0496100_0181901_938_1417 | 159 |
| 295 | 3300048904 | Ga0496101_0003004 | Ga0496101_0003004_9446_9943 | 159 |
| 296 | 3300048904 | Ga0496101_1191908 | Ga0496101_1191908_67_546 | 159 |
| 297 | 3300048905 | Ga0496102_0013028 | Ga0496102_0013028_2004_2483 | 159 |
| 298 | 3300048905 | Ga0496102_0016862 | Ga0496102_0016862_2462_2959 | 159 |
| 299 | 3300048905 | Ga0496102_0036031 | Ga0496102_0036031_3498_3977 | 159 |
| 300 | 3300048905 | Ga0496102_0040837 | Ga0496102_0040837_1900_2409 | 159 |
| 301 | 3300048905 | Ga0496102_0156138 | Ga0496102_0156138_1446_1943 | 159 |
| 302 | 3300048906 | Ga0496103_0000238 | Ga0496103_0000238_19731_20228 | 159 |
| 303 | 3300048907 | Ga0496104_0002275 | Ga0496104_0002275_12669_13148 | 159 |
| 304 | 3300048907 | Ga0496104_0381033 | Ga0496104_0381033_706_1212 | 159 |
| 305 | 3300048908 | Ga0496105_0075329 | Ga0496105_0075329_1256_1735 | 159 |
| 306 | 3300048910 | Ga0496107_0722137 | Ga0496107_0722137_157_636 | 159 |
| 307 | 3300048911 | Ga0496108_0089352 | Ga0496108_0089352_45_524 | 159 |
| 308 | 3300048911 | Ga0496108_0096097 | Ga0496108_0096097_1296_1775 | 159 |
| 309 | 3300048915 | Ga0496112_0075493 | Ga0496112_0075493_1035_1541 | 159 |
| 310 | 3300048916 | Ga0496113_0011555 | Ga0496113_0011555_1286_1792 | 159 |
| 311 | 3300048916 | Ga0496113_0306635 | Ga0496113_0306635_23_502 | 159 |
| 312 | 3300048917 | Ga0496114_0056543 | Ga0496114_0056543_214_711 | 159 |
| 313 | 3300048919 | Ga0496116_0049212 | Ga0496116_0049212_46_543 | 159 |
| 314 | 3300048919 | Ga0496116_0332611 | Ga0496116_0332611_23_532 | 159 |
| 315 | 3300048920 | Ga0496117_0000904 | Ga0496117_0000904_19051_19548 | 159 |
| 316 | 3300048921 | Ga0496118_0001360 | Ga0496118_0001360_24324_24821 | 159 |
| 317 | 3300048922 | Ga0496119_0004263 | Ga0496119_0004263_10117_10614 | 159 |
| 318 | 3300048922 | Ga0496119_0146059 | Ga0496119_0146059_113_592 | 159 |
| 319 | 3300048923 | Ga0496120_0047626 | Ga0496120_0047626_49_546 | 159 |
| 320 | 3300048924 | Ga0496121_0002871 | Ga0496121_0002871_24326_24823 | 159 |
| 321 | 3300048927 | Ga0496124_0025494 | Ga0496124_0025494_3015_3512 | 159 |
| 322 | 3300048928 | Ga0496125_0069855 | Ga0496125_0069855_1207_1704 | 159 |
| 323 | 3300048929 | Ga0496126_0156705 | Ga0496126_0156705_403_900 | 159 |
| 324 | 3300049585 | Ga0501069_0709299 | Ga0501069_0709299_103_582 | 159 |
| 325 | 3300049742 | Ga0501080_0446459 | Ga0501080_0446459_280_759 | 159 |
| 326 | 3300049823 | Ga0501044_0864028 | Ga0501044_0864028_238_717 | 159 |
| 327 | 3300050489 | nmdc:mga03683_14300_c1 | nmdc:mga03683_14300_c1_1217_1696 | 159 |
| 328 | 3300050489 | nmdc:mga03683_54316_c1 | nmdc:mga03683_54316_c1_721_1221 | 159 |
| 329 | 3300050490 | nmdc:mga03n38_4001_c1 | nmdc:mga03n38_4001_c1_3262_3741 | 159 |
| 330 | 3300050490 | nmdc:mga03n38_8312_c1 | nmdc:mga03n38_8312_c1_1246_1737 | 159 |
| 331 | 3300050491 | nmdc:mga00v17_3695_c1 | nmdc:mga00v17_3695_c1_2543_3022 | 159 |
| 332 | 3300050491 | nmdc:mga00v17_438228_c1 | nmdc:mga00v17_438228_c1_159_668 | 159 |
| 333 | 3300050491 | nmdc:mga00v17_59759_c1 | nmdc:mga00v17_59759_c1_25_504 | 159 |
| 334 | 3300050491 | nmdc:mga00v17_91425_c1 | nmdc:mga00v17_91425_c1_432_911 | 159 |
| 335 | 3300050492 | nmdc:mga0yw44_632285_c1 | nmdc:mga0yw44_632285_c1_168_668 | 159 |
| 336 | 3300050492 | nmdc:mga0yw44_988_c1 | nmdc:mga0yw44_988_c1_2731_3210 | 159 |
| 337 | 3300050496 | nmdc:mga07m45_318818_c1 | nmdc:mga07m45_318818_c1_135_614 | 159 |
| 338 | 3300050496 | nmdc:mga07m45_9656_c1 | nmdc:mga07m45_9656_c1_2540_3049 | 159 |
| 339 | 3300050516 | nmdc:mga0sz30_1043_c2 | nmdc:mga0sz30_1043_c2_2184_2663 | 159 |
| 340 | 3300050516 | nmdc:mga0sz30_178607_c1 | nmdc:mga0sz30_178607_c1_33_512 | 159 |
| 341 | 3300050516 | nmdc:mga0sz30_30910_c1 | nmdc:mga0sz30_30910_c1_380_880 | 159 |
| 342 | 3300050516 | nmdc:mga0sz30_32515_c1 | nmdc:mga0sz30_32515_c1_1524_2003 | 159 |
| 343 | 3300050516 | nmdc:mga0sz30_61224_c1 | nmdc:mga0sz30_61224_c1_116_625 | 159 |
| 344 | 3300053090 | Ga0500646_0032759 | Ga0500646_0032759_613_1110 | 159 |
| 345 | 3300001990 | JGI24737J22298_10028470 | JGI24737J22298_100284703 | 160 |
| 346 | 3300001990 | JGI24737J22298_10096655 | JGI24737J22298_100966552 | 160 |
| 347 | 3300001991 | JGI24743J22301_10004175 | JGI24743J22301_100041753 | 160 |
| 348 | 3300002070 | JGI24750J21931_1008178 | JGI24750J21931_10081782 | 160 |
| 349 | 3300002073 | JGI24745J21846_1020926 | JGI24745J21846_10209261 | 160 |
| 350 | 3300002074 | JGI24748J21848_1001688 | JGI24748J21848_10016882 | 160 |
| 351 | 3300002075 | JGI24738J21930_10075695 | JGI24738J21930_100756951 | 160 |
| 352 | 3300002076 | JGI24749J21850_1041713 | JGI24749J21850_10417132 | 160 |
| 353 | 3300002077 | JGI24744J21845_10001863 | JGI24744J21845_100018635 | 160 |
| 354 | 3300002239 | JGI24034J26672_10003153 | JGI24034J26672_100031531 | 160 |
| 355 | 3300002239 | JGI24034J26672_10028988 | JGI24034J26672_100289882 | 160 |
| 356 | 3300002244 | JGI24742J22300_10032239 | JGI24742J22300_100322392 | 160 |
| 357 | 3300005327 | Ga0070658_11184698 | Ga0070658_111846981 | 160 |
| 358 | 3300005328 | Ga0070676_10108836 | Ga0070676_101088361 | 160 |
| 359 | 3300005330 | Ga0070690_100070302 | Ga0070690_1000703021 | 160 |
| 360 | 3300005333 | Ga0070677_10024995 | Ga0070677_100249953 | 160 |
| 361 | 3300005335 | Ga0070666_10059060 | Ga0070666_100590603 | 160 |
| 362 | 3300005336 | Ga0070680_100359376 | Ga0070680_1003593762 | 160 |
| 363 | 3300005337 | Ga0070682_100020784 | Ga0070682_1000207844 | 160 |
| 364 | 3300005338 | Ga0068868_100002447 | Ga0068868_10000244710 | 160 |
| 365 | 3300005338 | Ga0068868_100603366 | Ga0068868_1006033661 | 160 |
| 366 | 3300005339 | Ga0070660_100407619 | Ga0070660_1004076192 | 160 |
| 367 | 3300005340 | Ga0070689_100050890 | Ga0070689_1000508901 | 160 |
| 368 | 3300005340 | Ga0070689_100056655 | Ga0070689_1000566553 | 160 |
| 369 | 3300005347 | Ga0070668_100002161 | Ga0070668_10000216111 | 160 |
| 370 | 3300005347 | Ga0070668_100851224 | Ga0070668_1008512241 | 160 |
| 371 | 3300005354 | Ga0070675_100059053 | Ga0070675_1000590535 | 160 |
| 372 | 3300005355 | Ga0070671_100093992 | Ga0070671_1000939923 | 160 |
| 373 | 3300005356 | Ga0070674_100011743 | Ga0070674_1000117435 | 160 |
| 374 | 3300005356 | Ga0070674_100043876 | Ga0070674_1000438764 | 160 |
| 375 | 3300005364 | Ga0070673_100476711 | Ga0070673_1004767112 | 160 |
| 376 | 3300005364 | Ga0070673_100833987 | Ga0070673_1008339872 | 160 |
| 377 | 3300005365 | Ga0070688_100029765 | Ga0070688_1000297653 | 160 |
| 378 | 3300005365 | Ga0070688_100291745 | Ga0070688_1002917452 | 160 |
| 379 | 3300005366 | Ga0070659_100206977 | Ga0070659_1002069773 | 160 |
| 380 | 3300005367 | Ga0070667_100002881 | Ga0070667_1000028812 | 160 |
| 381 | 3300005367 | Ga0070667_101167993 | Ga0070667_1011679931 | 160 |
| 382 | 3300005406 | Ga0070703_10147350 | Ga0070703_101473502 | 160 |
| 383 | 3300005434 | Ga0070709_10135573 | Ga0070709_101355733 | 160 |
| 384 | 3300005434 | Ga0070709_11221136 | Ga0070709_112211361 | 160 |
| 385 | 3300005435 | Ga0070714_100169808 | Ga0070714_1001698081 | 160 |
| 386 | 3300005435 | Ga0070714_100290321 | Ga0070714_1002903211 | 160 |
| 387 | 3300005437 | Ga0070710_10000423 | Ga0070710_100004236 | 160 |
| 388 | 3300005437 | Ga0070710_10030661 | Ga0070710_100306613 | 160 |
| 389 | 3300005438 | Ga0070701_10767381 | Ga0070701_107673812 | 160 |
| 390 | 3300005439 | Ga0070711_100007390 | Ga0070711_1000073907 | 160 |
| 391 | 3300005439 | Ga0070711_100020770 | Ga0070711_1000207702 | 160 |
| 392 | 3300005440 | Ga0070705_100003301 | Ga0070705_1000033012 | 160 |
| 393 | 3300005440 | Ga0070705_100511433 | Ga0070705_1005114332 | 160 |
| 394 | 3300005441 | Ga0070700_100001071 | Ga0070700_10000107115 | 160 |
| 395 | 3300005441 | Ga0070700_100028795 | Ga0070700_1000287952 | 160 |
| 396 | 3300005444 | Ga0070694_100220739 | Ga0070694_1002207392 | 160 |
| 397 | 3300005444 | Ga0070694_100634186 | Ga0070694_1006341862 | 160 |
| 398 | 3300005445 | Ga0070708_101542901 | Ga0070708_1015429011 | 160 |
| 399 | 3300005455 | Ga0070663_100002171 | Ga0070663_1000021716 | 160 |
| 400 | 3300005456 | Ga0070678_100000075 | Ga0070678_10000007517 | 160 |
| 401 | 3300005456 | Ga0070678_100212217 | Ga0070678_1002122172 | 160 |
| 402 | 3300005459 | Ga0068867_100002147 | Ga0068867_10000214711 | 160 |
| 403 | 3300005466 | Ga0070685_10494033 | Ga0070685_104940332 | 160 |
| 404 | 3300005539 | Ga0068853_100002826 | Ga0068853_10000282616 | 160 |
| 405 | 3300005539 | Ga0068853_100276079 | Ga0068853_1002760793 | 160 |
| 406 | 3300005543 | Ga0070672_101429988 | Ga0070672_1014299882 | 160 |
| 407 | 3300005544 | Ga0070686_100475984 | Ga0070686_1004759841 | 160 |
| 408 | 3300005545 | Ga0070695_100021602 | Ga0070695_1000216022 | 160 |
| 409 | 3300005546 | Ga0070696_100006661 | Ga0070696_10000666110 | 160 |
| 410 | 3300005547 | Ga0070693_100003717 | Ga0070693_1000037172 | 160 |
| 411 | 3300005547 | Ga0070693_100250061 | Ga0070693_1002500612 | 160 |
| 412 | 3300005548 | Ga0070665_100030748 | Ga0070665_1000307488 | 160 |
| 413 | 3300005549 | Ga0070704_100000415 | Ga0070704_1000004153 | 160 |
| 414 | 3300005563 | Ga0068855_101844032 | Ga0068855_1018440321 | 160 |
| 415 | 3300005578 | Ga0068854_100000209 | Ga0068854_10000020919 | 160 |
| 416 | 3300005578 | Ga0068854_100075993 | Ga0068854_1000759933 | 160 |
| 417 | 3300005615 | Ga0070702_100055497 | Ga0070702_1000554971 | 160 |
| 418 | 3300005616 | Ga0068852_100034595 | Ga0068852_1000345953 | 160 |
| 419 | 3300005617 | Ga0068859_100006371 | Ga0068859_10000637116 | 160 |
| 420 | 3300005617 | Ga0068859_100611201 | Ga0068859_1006112012 | 160 |
| 421 | 3300005617 | Ga0068859_100658938 | Ga0068859_1006589381 | 160 |
| 422 | 3300005618 | Ga0068864_100184186 | Ga0068864_1001841862 | 160 |
| 423 | 3300005618 | Ga0068864_101890061 | Ga0068864_1018900611 | 160 |
| 424 | 3300005718 | Ga0068866_10000202 | Ga0068866_1000020225 | 160 |
| 425 | 3300005718 | Ga0068866_10049914 | Ga0068866_100499143 | 160 |
| 426 | 3300005718 | Ga0068866_10507717 | Ga0068866_105077172 | 160 |
| 427 | 3300005719 | Ga0068861_100001529 | Ga0068861_1000015299 | 160 |
| 428 | 3300005841 | Ga0068863_100248869 | Ga0068863_1002488692 | 160 |
| 429 | 3300005842 | Ga0068858_100059181 | Ga0068858_1000591815 | 160 |
| 430 | 3300005842 | Ga0068858_100216359 | Ga0068858_1002163591 | 160 |
| 431 | 3300005842 | Ga0068858_100219216 | Ga0068858_1002192162 | 160 |
| 432 | 3300005843 | Ga0068860_100001399 | Ga0068860_10000139913 | 160 |
| 433 | 3300005843 | Ga0068860_100083428 | Ga0068860_1000834283 | 160 |
| 434 | 3300005843 | Ga0068860_100201871 | Ga0068860_1002018711 | 160 |
| 435 | 3300005844 | Ga0068862_100009253 | Ga0068862_1000092538 | 160 |
| 436 | 3300005844 | Ga0068862_100573992 | Ga0068862_1005739921 | 160 |
| 437 | 3300005981 | Ga0081538_10084471 | Ga0081538_100844712 | 160 |
| 438 | 3300006038 | Ga0075365_10021166 | Ga0075365_100211662 | 160 |
| 439 | 3300006048 | Ga0075363_100009800 | Ga0075363_1000098004 | 160 |
| 440 | 3300006048 | Ga0075363_100012710 | Ga0075363_1000127102 | 160 |
| 441 | 3300006048 | Ga0075363_100120930 | Ga0075363_1001209302 | 160 |
| 442 | 3300006051 | Ga0075364_10019402 | Ga0075364_100194025 | 160 |
| 443 | 3300006051 | Ga0075364_10040610 | Ga0075364_100406104 | 160 |
| 444 | 3300006051 | Ga0075364_10317768 | Ga0075364_103177682 | 160 |
| 445 | 3300006163 | Ga0070715_10007335 | Ga0070715_100073356 | 160 |
| 446 | 3300006163 | Ga0070715_10032186 | Ga0070715_100321864 | 160 |
| 447 | 3300006173 | Ga0070716_100005247 | Ga0070716_1000052473 | 160 |
| 448 | 3300006175 | Ga0070712_100001001 | Ga0070712_10000100115 | 160 |
| 449 | 3300006175 | Ga0070712_100011324 | Ga0070712_1000113247 | 160 |
| 450 | 3300006177 | Ga0075362_10189766 | Ga0075362_101897662 | 160 |
| 451 | 3300006178 | Ga0075367_10006967 | Ga0075367_100069677 | 160 |
| 452 | 3300006178 | Ga0075367_10107060 | Ga0075367_101070602 | 160 |
| 453 | 3300006186 | Ga0075369_10170206 | Ga0075369_101702062 | 160 |
| 454 | 3300006237 | Ga0097621_100244767 | Ga0097621_1002447672 | 160 |
| 455 | 3300006353 | Ga0075370_10059823 | Ga0075370_100598233 | 160 |
| 456 | 3300006353 | Ga0075370_10138488 | Ga0075370_101384882 | 160 |
| 457 | 3300006358 | Ga0068871_100289590 | Ga0068871_1002895902 | 160 |
| 458 | 3300006358 | Ga0068871_100311962 | Ga0068871_1003119622 | 160 |
| 459 | 3300006881 | Ga0068865_100000661 | Ga0068865_10000066124 | 160 |
| 460 | 3300006881 | Ga0068865_100437596 | Ga0068865_1004375962 | 160 |
| 461 | 3300006931 | Ga0097620_100006372 | Ga0097620_1000063723 | 160 |
| 462 | 3300006931 | Ga0097620_100611226 | Ga0097620_1006112262 | 160 |
| 463 | 3300006931 | Ga0097620_100658951 | Ga0097620_1006589512 | 160 |
| 464 | 3300007076 | Ga0075435_100708670 | Ga0075435_1007086701 | 160 |
| 465 | 3300009092 | Ga0105250_10052083 | Ga0105250_100520832 | 160 |
| 466 | 3300009098 | Ga0105245_10127283 | Ga0105245_101272834 | 160 |
| 467 | 3300009101 | Ga0105247_10000092 | Ga0105247_1000009211 | 160 |
| 468 | 3300009101 | Ga0105247_10080146 | Ga0105247_100801461 | 160 |
| 469 | 3300009148 | Ga0105243_10001036 | Ga0105243_1000103619 | 160 |
| 470 | 3300009148 | Ga0105243_10105820 | Ga0105243_101058202 | 160 |
| 471 | 3300009148 | Ga0105243_11081625 | Ga0105243_110816252 | 160 |
| 472 | 3300009174 | Ga0105241_10733918 | Ga0105241_107339181 | 160 |
| 473 | 3300009176 | Ga0105242_10000597 | Ga0105242_1000059719 | 160 |
| 474 | 3300009176 | Ga0105242_10431904 | Ga0105242_104319042 | 160 |
| 475 | 3300009177 | Ga0105248_10005718 | Ga0105248_1000571818 | 160 |
| 476 | 3300009177 | Ga0105248_10035423 | Ga0105248_100354232 | 160 |
| 477 | 3300009545 | Ga0105237_10157556 | Ga0105237_101575562 | 160 |
| 478 | 3300009553 | Ga0105249_10001140 | Ga0105249_1000114019 | 160 |
| 479 | 3300009553 | Ga0105249_10298919 | Ga0105249_102989193 | 160 |
| 480 | 3300010375 | Ga0105239_10090134 | Ga0105239_100901343 | 160 |
| 481 | 3300011119 | Ga0105246_10065212 | Ga0105246_100652123 | 160 |
| 482 | 3300011119 | Ga0105246_10974516 | Ga0105246_109745162 | 160 |
| 483 | 3300011119 | Ga0105246_11041870 | Ga0105246_110418701 | 160 |
| 484 | 3300013102 | Ga0157371_10204796 | Ga0157371_102047963 | 160 |
| 485 | 3300013102 | Ga0157371_10585675 | Ga0157371_105856751 | 160 |
| 486 | 3300013296 | Ga0157374_10086959 | Ga0157374_100869592 | 160 |
| 487 | 3300013296 | Ga0157374_10476467 | Ga0157374_104764671 | 160 |
| 488 | 3300013297 | Ga0157378_10002483 | Ga0157378_100024836 | 160 |
| 489 | 3300013297 | Ga0157378_10059112 | Ga0157378_100591125 | 160 |
| 490 | 3300013297 | Ga0157378_11215818 | Ga0157378_112158182 | 160 |
| 491 | 3300013306 | Ga0163162_10018721 | Ga0163162_100187212 | 160 |
| 492 | 3300013306 | Ga0163162_10245894 | Ga0163162_102458942 | 160 |
| 493 | 3300013306 | Ga0163162_11144724 | Ga0163162_111447242 | 160 |
| 494 | 3300013306 | Ga0163162_11316176 | Ga0163162_113161762 | 160 |
| 495 | 3300013307 | Ga0157372_10002385 | Ga0157372_100023852 | 160 |
| 496 | 3300013307 | Ga0157372_11503556 | Ga0157372_115035561 | 160 |
| 497 | 3300013308 | Ga0157375_10000305 | Ga0157375_1000030543 | 160 |
| 498 | 3300013308 | Ga0157375_10535596 | Ga0157375_105355962 | 160 |
| 499 | 3300014325 | Ga0163163_10224364 | Ga0163163_102243642 | 160 |
| 500 | 3300014326 | Ga0157380_10000732 | Ga0157380_100007323 | 160 |
| 501 | 3300014326 | Ga0157380_12012175 | Ga0157380_120121751 | 160 |
| 502 | 3300014745 | Ga0157377_10094831 | Ga0157377_100948312 | 160 |
| 503 | 3300014968 | Ga0157379_10022633 | Ga0157379_100226338 | 160 |
| 504 | 3300014968 | Ga0157379_10084885 | Ga0157379_100848853 | 160 |
| 505 | 3300017792 | Ga0163161_10004574 | Ga0163161_1000457410 | 160 |
| 506 | 3300017792 | Ga0163161_10009223 | Ga0163161_100092232 | 160 |
| 507 | 3300017792 | Ga0163161_10265526 | Ga0163161_102655262 | 160 |
| 508 | 3300025294 | Ga0209025_1041064 | Ga0209025_10410643 | 160 |
| 509 | 3300025885 | Ga0207653_10091115 | Ga0207653_100911151 | 160 |
| 510 | 3300025898 | Ga0207692_10002656 | Ga0207692_100026563 | 160 |
| 511 | 3300025899 | Ga0207642_10000164 | Ga0207642_1000016411 | 160 |
| 512 | 3300025899 | Ga0207642_10464897 | Ga0207642_104648972 | 160 |
| 513 | 3300025900 | Ga0207710_10020255 | Ga0207710_100202553 | 160 |
| 514 | 3300025901 | Ga0207688_10000096 | Ga0207688_1000009615 | 160 |
| 515 | 3300025901 | Ga0207688_10000339 | Ga0207688_1000033915 | 160 |
| 516 | 3300025903 | Ga0207680_10048469 | Ga0207680_100484693 | 160 |
| 517 | 3300025903 | Ga0207680_11079440 | Ga0207680_110794401 | 160 |
| 518 | 3300025904 | Ga0207647_10034535 | Ga0207647_100345353 | 160 |
| 519 | 3300025905 | Ga0207685_10010811 | Ga0207685_100108114 | 160 |
| 520 | 3300025905 | Ga0207685_10016497 | Ga0207685_100164973 | 160 |
| 521 | 3300025906 | Ga0207699_10479287 | Ga0207699_104792872 | 160 |
| 522 | 3300025911 | Ga0207654_10527518 | Ga0207654_105275182 | 160 |
| 523 | 3300025914 | Ga0207671_10584305 | Ga0207671_105843051 | 160 |
| 524 | 3300025915 | Ga0207693_10000634 | Ga0207693_1000063414 | 160 |
| 525 | 3300025915 | Ga0207693_10000717 | Ga0207693_1000071732 | 160 |
| 526 | 3300025916 | Ga0207663_10036412 | Ga0207663_100364123 | 160 |
| 527 | 3300025917 | Ga0207660_10620460 | Ga0207660_106204601 | 160 |
| 528 | 3300025918 | Ga0207662_10087424 | Ga0207662_100874242 | 160 |
| 529 | 3300025919 | Ga0207657_10243012 | Ga0207657_102430122 | 160 |
| 530 | 3300025923 | Ga0207681_10066232 | Ga0207681_100662321 | 160 |
| 531 | 3300025926 | Ga0207659_10038839 | Ga0207659_100388395 | 160 |
| 532 | 3300025927 | Ga0207687_10001922 | Ga0207687_1000192212 | 160 |
| 533 | 3300025927 | Ga0207687_10017942 | Ga0207687_100179422 | 160 |
| 534 | 3300025929 | Ga0207664_10605549 | Ga0207664_106055492 | 160 |
| 535 | 3300025929 | Ga0207664_11008833 | Ga0207664_110088331 | 160 |
| 536 | 3300025931 | Ga0207644_10125771 | Ga0207644_101257713 | 160 |
| 537 | 3300025933 | Ga0207706_10023920 | Ga0207706_100239205 | 160 |
| 538 | 3300025934 | Ga0207686_10031551 | Ga0207686_100315512 | 160 |
| 539 | 3300025934 | Ga0207686_10309401 | Ga0207686_103094012 | 160 |
| 540 | 3300025935 | Ga0207709_10015396 | Ga0207709_100153966 | 160 |
| 541 | 3300025935 | Ga0207709_10111098 | Ga0207709_101110982 | 160 |
| 542 | 3300025936 | Ga0207670_10005154 | Ga0207670_100051548 | 160 |
| 543 | 3300025936 | Ga0207670_10494212 | Ga0207670_104942121 | 160 |
| 544 | 3300025937 | Ga0207669_10002349 | Ga0207669_1000234910 | 160 |
| 545 | 3300025938 | Ga0207704_10175834 | Ga0207704_101758342 | 160 |
| 546 | 3300025939 | Ga0207665_10002349 | Ga0207665_100023493 | 160 |
| 547 | 3300025939 | Ga0207665_10031991 | Ga0207665_100319912 | 160 |
| 548 | 3300025940 | Ga0207691_10074146 | Ga0207691_100741463 | 160 |
| 549 | 3300025941 | Ga0207711_10114555 | Ga0207711_101145552 | 160 |
| 550 | 3300025942 | Ga0207689_10029503 | Ga0207689_100295033 | 160 |
| 551 | 3300025942 | Ga0207689_10330811 | Ga0207689_103308112 | 160 |
| 552 | 3300025949 | Ga0207667_10278466 | Ga0207667_102784662 | 160 |
| 553 | 3300025961 | Ga0207712_10008843 | Ga0207712_100088435 | 160 |
| 554 | 3300025972 | Ga0207668_10004608 | Ga0207668_1000460810 | 160 |
| 555 | 3300025981 | Ga0207640_10013966 | Ga0207640_100139666 | 160 |
| 556 | 3300025981 | Ga0207640_10265749 | Ga0207640_102657491 | 160 |
| 557 | 3300025986 | Ga0207658_10007702 | Ga0207658_1000770210 | 160 |
| 558 | 3300025986 | Ga0207658_11074299 | Ga0207658_110742992 | 160 |
| 559 | 3300026023 | Ga0207677_10001300 | Ga0207677_1000130018 | 160 |
| 560 | 3300026023 | Ga0207677_10057209 | Ga0207677_100572092 | 160 |
| 561 | 3300026035 | Ga0207703_10028770 | Ga0207703_100287706 | 160 |
| 562 | 3300026035 | Ga0207703_10162284 | Ga0207703_101622843 | 160 |
| 563 | 3300026041 | Ga0207639_10019367 | Ga0207639_100193675 | 160 |
| 564 | 3300026041 | Ga0207639_10250904 | Ga0207639_102509042 | 160 |
| 565 | 3300026067 | Ga0207678_10004438 | Ga0207678_100044386 | 160 |
| 566 | 3300026075 | Ga0207708_10068628 | Ga0207708_100686283 | 160 |
| 567 | 3300026075 | Ga0207708_10765685 | Ga0207708_107656852 | 160 |
| 568 | 3300026078 | Ga0207702_10640121 | Ga0207702_106401212 | 160 |
| 569 | 3300026088 | Ga0207641_10409857 | Ga0207641_104098573 | 160 |
| 570 | 3300026089 | Ga0207648_10001107 | Ga0207648_1000110716 | 160 |
| 571 | 3300026095 | Ga0207676_10160976 | Ga0207676_101609763 | 160 |
| 572 | 3300026118 | Ga0207675_100000555 | Ga0207675_10000055519 | 160 |
| 573 | 3300026118 | Ga0207675_100016977 | Ga0207675_1000169778 | 160 |
| 574 | 3300026121 | Ga0207683_10000795 | Ga0207683_1000079523 | 160 |
| 575 | 3300026142 | Ga0207698_10061977 | Ga0207698_100619774 | 160 |
| 576 | 3300026142 | Ga0207698_10414057 | Ga0207698_104140571 | 160 |
| 577 | 3300026142 | Ga0207698_11152272 | Ga0207698_111522721 | 160 |
| 578 | 3300028379 | Ga0268266_10037420 | Ga0268266_100374206 | 160 |
| 579 | 3300028379 | Ga0268266_11288999 | Ga0268266_112889991 | 160 |
| 580 | 3300028380 | Ga0268265_10005171 | Ga0268265_1000517110 | 160 |
| 581 | 3300028381 | Ga0268264_10010060 | Ga0268264_1001006010 | 160 |
| 582 | 3300028381 | Ga0268264_10147774 | Ga0268264_101477742 | 160 |
| 583 | 3300031731 | Ga0307405_10184464 | Ga0307405_101844643 | 160 |
| 584 | 3300031903 | Ga0307407_10102762 | Ga0307407_101027623 | 160 |
| 585 | 3300031995 | Ga0307409_100109219 | Ga0307409_1001092194 | 160 |
| 586 | 3300031995 | Ga0307409_101707167 | Ga0307409_1017071672 | 160 |
| 587 | 3300032002 | Ga0307416_101179957 | Ga0307416_1011799572 | 160 |
| 588 | 3300032002 | Ga0307416_102347418 | Ga0307416_1023474181 | 160 |
| 589 | 3300032004 | Ga0307414_10141581 | Ga0307414_101415813 | 160 |
| 590 | 3300032005 | Ga0307411_10392426 | Ga0307411_103924262 | 160 |
| 591 | 3300032126 | Ga0307415_100025121 | Ga0307415_1000251214 | 160 |
| 592 | 3300035112 | Ga0373932_0070853 | Ga0373932_0070853_32_514 | 160 |
| 593 | 3300035121 | Ga0373960_0031948 | Ga0373960_0031948_473_961 | 160 |
| 594 | 3300035242 | Ga0373962_0055165 | Ga0373962_0055165_157_639 | 160 |
| 595 | 3300041410 | Ga0439461_0000660 | Ga0439461_0000660_1411_1899 | 160 |
| 596 | 3300041411 | Ga0439466_0017969 | Ga0439466_0017969_1313_1801 | 160 |
| 597 | 3300041413 | Ga0439465_0013714 | Ga0439465_0013714_527_1015 | 160 |
| 598 | 3300042002 | Ga0439442_003399 | Ga0439442_003399_419_907 | 160 |
| 599 | 3300042435 | Ga0439434_0059574 | Ga0439434_0059574_223_711 | 160 |
| 600 | 3300044658 | Ga0466972_0050787 | Ga0466972_0050787_732_1220 | 160 |
| 601 | 3300044658 | Ga0466972_0070800 | Ga0466972_0070800_555_1043 | 160 |
| 602 | 3300044735 | Ga0466968_0020056 | Ga0466968_0020056_2031_2519 | 160 |
| 603 | 3300044901 | Ga0466960_0102515 | Ga0466960_0102515_40_528 | 160 |
| 604 | 3300045049 | Ga0466959_0157436 | Ga0466959_0157436_385_873 | 160 |
| 605 | 3300045836 | Ga0466958_0320054 | Ga0466958_0320054_90_578 | 160 |
| 606 | 3300045976 | Ga0466967_0569252 | Ga0466967_0569252_462_953 | 160 |
| 607 | 3300046500 | Ga0495596_0242398 | Ga0495596_0242398_38_526 | 160 |
| 608 | 3300046538 | Ga0495609_0286882 | Ga0495609_0286882_126_614 | 160 |
| 609 | 3300046648 | Ga0495611_0247821 | Ga0495611_0247821_189_677 | 160 |
| 610 | 3300046684 | Ga0495669_0329596 | Ga0495669_0329596_81_569 | 160 |
| 611 | 3300047323 | Ga0495683_0000381 | Ga0495683_0000381_5346_5855 | 160 |
| 612 | 3300048903 | Ga0496100_0008547 | Ga0496100_0008547_4031_4513 | 160 |
| 613 | 3300048903 | Ga0496100_0022949 | Ga0496100_0022949_2694_3188 | 160 |
| 614 | 3300048904 | Ga0496101_0757096 | Ga0496101_0757096_94_582 | 160 |
| 615 | 3300048905 | Ga0496102_0001872 | Ga0496102_0001872_10563_11045 | 160 |
| 616 | 3300048905 | Ga0496102_0031471 | Ga0496102_0031471_4232_4720 | 160 |
| 617 | 3300048905 | Ga0496102_0135691 | Ga0496102_0135691_703_1191 | 160 |
| 618 | 3300048906 | Ga0496103_0000277 | Ga0496103_0000277_385_867 | 160 |
| 619 | 3300048907 | Ga0496104_0158612 | Ga0496104_0158612_970_1464 | 160 |
| 620 | 3300048908 | Ga0496105_0216572 | Ga0496105_0216572_120_629 | 160 |
| 621 | 3300048909 | Ga0496106_0000372 | Ga0496106_0000372_3494_3976 | 160 |
| 622 | 3300048909 | Ga0496106_0212290 | Ga0496106_0212290_987_1481 | 160 |
| 623 | 3300048909 | Ga0496106_0255258 | Ga0496106_0255258_496_984 | 160 |
| 624 | 3300048910 | Ga0496107_0001450 | Ga0496107_0001450_7643_8125 | 160 |
| 625 | 3300048910 | Ga0496107_0047803 | Ga0496107_0047803_476_964 | 160 |
| 626 | 3300048911 | Ga0496108_0075141 | Ga0496108_0075141_2098_2586 | 160 |
| 627 | 3300048912 | Ga0496109_0027943 | Ga0496109_0027943_2694_3182 | 160 |
| 628 | 3300048912 | Ga0496109_0836677 | Ga0496109_0836677_323_817 | 160 |
| 629 | 3300048913 | Ga0496110_0480322 | Ga0496110_0480322_48_542 | 160 |
| 630 | 3300048915 | Ga0496112_0075802 | Ga0496112_0075802_641_1129 | 160 |
| 631 | 3300048917 | Ga0496114_0003618 | Ga0496114_0003618_406_888 | 160 |
| 632 | 3300048918 | Ga0496115_0016385 | Ga0496115_0016385_654_1136 | 160 |
| 633 | 3300048918 | Ga0496115_0161955 | Ga0496115_0161955_576_1064 | 160 |
| 634 | 3300049571 | Ga0501034_0276823 | Ga0501034_0276823_280_828 | 160 |
| 635 | 3300049581 | Ga0501047_0606626 | Ga0501047_0606626_165_671 | 160 |
| 636 | 3300049586 | Ga0501070_1125583 | Ga0501070_1125583_23_571 | 160 |
| 637 | 3300050490 | nmdc:mga03n38_113533_c1 | nmdc:mga03n38_113533_c1_412_900 | 160 |
| 638 | 3300050490 | nmdc:mga03n38_15808_c1 | nmdc:mga03n38_15808_c1_840_1349 | 160 |
| 639 | 3300050490 | nmdc:mga03n38_366703_c1 | nmdc:mga03n38_366703_c1_180_689 | 160 |
| 640 | 3300050491 | nmdc:mga00v17_10423_c1 | nmdc:mga00v17_10423_c1_3166_3654 | 160 |
| 641 | 3300050491 | nmdc:mga00v17_155612_c1 | nmdc:mga00v17_155612_c1_88_597 | 160 |
| 642 | 3300050491 | nmdc:mga00v17_54243_c1 | nmdc:mga00v17_54243_c1_1439_1948 | 160 |
| 643 | 3300050491 | nmdc:mga00v17_98692_c1 | nmdc:mga00v17_98692_c1_201_689 | 160 |
| 644 | 3300050492 | nmdc:mga0yw44_35816_c1 | nmdc:mga0yw44_35816_c1_378_911 | 160 |
| 645 | 3300050492 | nmdc:mga0yw44_7865_c2 | nmdc:mga0yw44_7865_c2_227_736 | 160 |
| 646 | 3300050493 | nmdc:mga0k408_105819_c2 | nmdc:mga0k408_105819_c2_13_546 | 160 |
| 647 | 3300050494 | nmdc:mga06z11_13879_c1 | nmdc:mga06z11_13879_c1_695_1228 | 160 |
| 648 | 3300050496 | nmdc:mga07m45_13609_c1 | nmdc:mga07m45_13609_c1_3636_4169 | 160 |
| 649 | 3300050496 | nmdc:mga07m45_204846_c1 | nmdc:mga07m45_204846_c1_148_636 | 160 |
| 650 | 3300050496 | nmdc:mga07m45_305812_c1 | nmdc:mga07m45_305812_c1_204_713 | 160 |
| 651 | 3300050509 | nmdc:mga0qj67_49997_c1 | nmdc:mga0qj67_49997_c1_2614_3102 | 160 |
| 652 | 3300050513 | nmdc:mga0rr50_653270_c1 | nmdc:mga0rr50_653270_c1_339_833 | 160 |
| 653 | 3300050516 | nmdc:mga0sz30_142591_c1 | nmdc:mga0sz30_142591_c1_169_684 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1eyv-assembly1.cif.gz_A | the crystal structure of nusb from mycobacterium tuberculosis | 0.9898 | 10 | 139 |
| 1eyv-assembly1.cif.gz_A | the crystal structure of nusb from mycobacterium tuberculosis | 0.9749 | 10 | 139 |
| 3imq-assembly1.cif.gz_A | crystal structure of the nusb101-s10(delta loop) complex | 0.8687 | 11 | 146 |
| 1tzx-assembly2.cif.gz_B | t. maritima nusb, p3221 | 0.8613 | 10 | 142 |
| 3d3c-assembly3.cif.gz_C | structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. | 0.8461 | 11 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1eyvA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9898 | 10 | 139 | 1.10.940.10 |
| 1eyvA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9749 | 10 | 139 | 1.10.940.10 |
| af_P9WIV1_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.96 | 1 | 139 | 1.10.940.10 |
| af_P9WIV1_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9532 | 1 | 139 | 1.10.940.10 |
| af_Q8VYC4_72_208_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8864 | 54 | 146 | 1.10.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X8DQL5-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 0.9994 | 19 | 149 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-X8FE46-F1-model_v4 | deleted | 0.9989 | 49 | 155 |
|
| AF-A0A2R5H5G6-F1-model_v4 | deleted | 0.9981 | 19 | 154 |
|
| AF-X8ATC2-F1-model_v4 | deleted | 0.9981 | 49 | 156 |
|
| AF-A0A837ZUH8-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 0.9974 | 9 | 149 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar