F472765

General Info

Members Datasets Scaffolds Average Seq Length
653 315 642 161

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10520136|Ga0207700_105201362
Length 168
Sequence VSRPRPVKGRHQARKRAVDLLFEAEARGLSPAEVVDVRTALAEAKPDVAPLPAYTQTVARGVGDQLAHIDDLISSHLQGWTLDRLPAVDRAILRVAVWELLHDDVPEPVAVDEAVQLAKELSTDDSPGFVNGVLGHVMLVTPQIRAAAQAVRGAVGSDTTPEEHGPQP

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
6 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
11 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
307 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
311 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
312 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.4
Nodule 0.15
Rhizoplane 9.04
Rhizosphere 70.9
Stem 0
Stem Tuber 0
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10028470 3300001990 Bacteria 1756
2 JGI24737J22298_10096655 3300001990 Bacteria 876
3 JGI24743J22301_10004175 3300001991 Bacteria 2336
4 JGI24750J21931_1008178 3300002070 Bacteria 1327
5 JGI24745J21846_1020926 3300002073 Bacteria 768
6 JGI24748J21848_1001688 3300002074 Bacteria 2458
7 JGI24738J21930_10075695 3300002075 Bacteria 701
8 JGI24749J21850_1041713 3300002076 Bacteria 673
9 JGI24744J21845_10001863 3300002077 Bacteria 4236
10 JGI24034J26672_10003153 3300002239 Bacteria 2293
11 JGI24034J26672_10028988 3300002239 Bacteria 895
12 JGI24742J22300_10032239 3300002244 Bacteria 918
13 Ga0070658_11071300 3300005327 Bacteria 701
14 Ga0070658_11184698 3300005327 Bacteria 664
15 Ga0070676_10108836 3300005328 Bacteria 1723
16 Ga0070683_100617025 3300005329 Bacteria 1038
17 Ga0070690_100070302 3300005330 Bacteria 2273
18 Ga0070677_10024995 3300005333 Bacteria 2226
19 Ga0070666_10059060 3300005335 Bacteria 2594
20 Ga0070680_100359376 3300005336 Bacteria 1239
21 Ga0070682_100020784 3300005337 Bacteria 3867
22 Ga0070682_100027764 3300005337 Bacteria 3398
23 Ga0068868_100002447 3300005338 Bacteria 12879
24 Ga0068868_100603366 3300005338 Bacteria 973
25 Ga0070660_100407619 3300005339 Bacteria 1125
26 Ga0070660_100522261 3300005339 Bacteria 989
27 Ga0070689_100050890 3300005340 Bacteria 3201
28 Ga0070689_100056655 3300005340 Bacteria 3039
29 Ga0070661_100691855 3300005344 Bacteria 830
30 Ga0070668_100002161 3300005347 Bacteria 14391
31 Ga0070668_100851224 3300005347 Bacteria 813
32 Ga0070669_100003447 3300005353 Bacteria 11397
33 Ga0070675_100059053 3300005354 Bacteria 3164
34 Ga0070671_100074578 3300005355 Bacteria 2834
35 Ga0070671_100093992 3300005355 Bacteria 2513
36 Ga0070671_100155578 3300005355 Bacteria 1931
37 Ga0070674_100011743 3300005356 Bacteria 5344
38 Ga0070674_100043876 3300005356 Bacteria 3044
39 Ga0070674_101573706 3300005356 Bacteria 592
40 Ga0070673_100476711 3300005364 Bacteria 1126
41 Ga0070673_100833987 3300005364 Bacteria 853
42 Ga0070688_100029765 3300005365 Bacteria 3272
43 Ga0070688_100291745 3300005365 Bacteria 1176
44 Ga0070688_100913179 3300005365 Bacteria 693
45 Ga0070659_100206977 3300005366 Bacteria 1616
46 Ga0070667_100000034 3300005367 Bacteria 173652
47 Ga0070667_100002881 3300005367 Bacteria 14788
48 Ga0070667_100303783 3300005367 Bacteria 1437
49 Ga0070667_101167993 3300005367 Bacteria 720
50 Ga0070703_10147350 3300005406 Bacteria 881
51 Ga0070709_10135573 3300005434 Bacteria 1686
52 Ga0070709_11221136 3300005434 Bacteria 605
53 Ga0070714_100169808 3300005435 Bacteria 1979
54 Ga0070714_100220999 3300005435 Bacteria 1741
55 Ga0070714_100290321 3300005435 Bacteria 1522
56 Ga0070714_100330481 3300005435 Bacteria 1427
57 Ga0070713_100260144 3300005436 Bacteria 1586
58 Ga0070713_100379472 3300005436 Bacteria 1317
59 Ga0070713_100860059 3300005436 Bacteria 871
60 Ga0070710_10000423 3300005437 Bacteria 19929
61 Ga0070710_10030661 3300005437 Bacteria 2895
62 Ga0070710_10105794 3300005437 Bacteria 1683
63 Ga0070701_10767381 3300005438 Bacteria 655
64 Ga0070711_100007390 3300005439 Bacteria 6682
65 Ga0070711_100020770 3300005439 Bacteria 4237
66 Ga0070705_100003301 3300005440 Bacteria 7926
67 Ga0070705_100511433 3300005440 Bacteria 913
68 Ga0070700_100001071 3300005441 Bacteria 13571
69 Ga0070700_100028795 3300005441 Bacteria 3307
70 Ga0070700_100340696 3300005441 Bacteria 1108
71 Ga0070694_100220739 3300005444 Bacteria 1421
72 Ga0070694_100634186 3300005444 Bacteria 863
73 Ga0070708_101542901 3300005445 Bacteria 619
74 Ga0070663_100002171 3300005455 Bacteria 10972
75 Ga0070663_100028798 3300005455 Bacteria 3786
76 Ga0070678_100000075 3300005456 Bacteria 37282
77 Ga0070678_100212217 3300005456 Bacteria 1604
78 Ga0070678_100766699 3300005456 Bacteria 874
79 Ga0068867_100002147 3300005459 Bacteria 13833
80 Ga0070685_10162617 3300005466 Bacteria 1424
81 Ga0070685_10288763 3300005466 Bacteria 1101
82 Ga0070685_10494033 3300005466 Bacteria 865
83 Ga0070679_101040829 3300005530 Bacteria 763
84 Ga0070697_101177817 3300005536 Bacteria 683
85 Ga0068853_100002826 3300005539 Bacteria 13152
86 Ga0068853_100276079 3300005539 Bacteria 1548
87 Ga0070672_101429988 3300005543 Bacteria 619
88 Ga0070686_100042792 3300005544 Bacteria 2839
89 Ga0070686_100475984 3300005544 Bacteria 965
90 Ga0070695_100021602 3300005545 Bacteria 3941
91 Ga0070696_100006661 3300005546 Bacteria 7716
92 Ga0070693_100003717 3300005547 Bacteria 7137
93 Ga0070693_100250061 3300005547 Bacteria 1175
94 Ga0070665_100030748 3300005548 Bacteria 5403
95 Ga0070665_100076253 3300005548 Bacteria 3360
96 Ga0070665_100103991 3300005548 Bacteria 2843
97 Ga0070704_100000415 3300005549 Bacteria 19786
98 Ga0068855_100111357 3300005563 Bacteria 3143
99 Ga0068855_101844032 3300005563 Bacteria 614
100 Ga0070664_100876245 3300005564 Bacteria 841
101 Ga0068854_100000209 3300005578 Bacteria 39503
102 Ga0068854_100075993 3300005578 Bacteria 2467
103 Ga0068854_100371601 3300005578 Bacteria 1176
104 Ga0070702_100055497 3300005615 Bacteria 2284
105 Ga0068852_100034595 3300005616 Bacteria 4205
106 Ga0068852_100467726 3300005616 Bacteria 1251
107 Ga0068859_100000228 3300005617 Bacteria 55135
108 Ga0068859_100006371 3300005617 Bacteria 11971
109 Ga0068859_100611201 3300005617 Bacteria 1183
110 Ga0068859_100658938 3300005617 Bacteria 1138
111 Ga0068864_100184186 3300005618 Bacteria 1911
112 Ga0068864_101372683 3300005618 Bacteria 708
113 Ga0068864_101890061 3300005618 Bacteria 603
114 Ga0068866_10000202 3300005718 Bacteria 27989
115 Ga0068866_10049914 3300005718 Bacteria 2123
116 Ga0068866_10507717 3300005718 Bacteria 799
117 Ga0068861_100001529 3300005719 Bacteria 14652
118 Ga0068863_100002759 3300005841 Bacteria 17397
119 Ga0068863_100027391 3300005841 Bacteria 5435
120 Ga0068863_100248869 3300005841 Bacteria 1716
121 Ga0068858_100059181 3300005842 Bacteria 3541
122 Ga0068858_100216359 3300005842 Bacteria 1814
123 Ga0068858_100219216 3300005842 Bacteria 1801
124 Ga0068860_100000011 3300005843 Bacteria 328172
125 Ga0068860_100001399 3300005843 Bacteria 26149
126 Ga0068860_100083428 3300005843 Bacteria 3039
127 Ga0068860_100201871 3300005843 Bacteria 1927
128 Ga0068862_100000139 3300005844 Bacteria 82475
129 Ga0068862_100009253 3300005844 Bacteria 8157
130 Ga0068862_100573992 3300005844 Bacteria 1080
131 Ga0068862_100850848 3300005844 Bacteria 894
132 Ga0081455_10041564 3300005937 Bacteria 4041
133 Ga0081455_10048108 3300005937 Bacteria 3687
134 Ga0081455_10095990 3300005937 Bacteria 2391
135 Ga0081538_10084471 3300005981 Bacteria 1672
136 Ga0081540_1063160 3300005983 Bacteria 1754
137 Ga0075365_10000694 3300006038 Bacteria 13537
138 Ga0075365_10021166 3300006038 Bacteria 4051
139 Ga0075365_10074187 3300006038 Bacteria 2294
140 Ga0075365_10218666 3300006038 Bacteria 1336
141 Ga0075365_10805280 3300006038 Bacteria 663
142 Ga0075368_10276575 3300006042 Bacteria 721
143 Ga0075363_100001512 3300006048 Bacteria 8880
144 Ga0075363_100002442 3300006048 Bacteria 7594
145 Ga0075363_100009800 3300006048 Bacteria 4515
146 Ga0075363_100012710 3300006048 Bacteria 4063
147 Ga0075363_100120930 3300006048 Bacteria 1462
148 Ga0075363_100123338 3300006048 Bacteria 1448
149 Ga0075364_10016218 3300006051 Bacteria 4634
150 Ga0075364_10019402 3300006051 Bacteria 4267
151 Ga0075364_10035521 3300006051 Bacteria 3221
152 Ga0075364_10036360 3300006051 Bacteria 3183
153 Ga0075364_10040610 3300006051 Bacteria 3018
154 Ga0075364_10123872 3300006051 Bacteria 1731
155 Ga0075364_10317768 3300006051 Bacteria 1060
156 Ga0070715_10007335 3300006163 Bacteria 3794
157 Ga0070715_10032186 3300006163 Bacteria 2134
158 Ga0070716_100005247 3300006173 Bacteria 6263
159 Ga0070716_100818061 3300006173 Bacteria 723
160 Ga0070712_100001001 3300006175 Bacteria 17008
161 Ga0070712_100011324 3300006175 Bacteria 5651
162 Ga0070712_100171429 3300006175 Bacteria 1684
163 Ga0075362_10020161 3300006177 Bacteria 2783
164 Ga0075362_10189766 3300006177 Bacteria 998
165 Ga0075367_10006967 3300006178 Bacteria 5757
166 Ga0075367_10090173 3300006178 Bacteria 1864
167 Ga0075367_10107060 3300006178 Bacteria 1714
168 Ga0075367_10268321 3300006178 Bacteria 1072
169 Ga0075369_10007707 3300006186 Bacteria 4115
170 Ga0075369_10010160 3300006186 Bacteria 3677
171 Ga0075369_10170206 3300006186 Bacteria 1000
172 Ga0075369_10205301 3300006186 Bacteria 910
173 Ga0097621_100244767 3300006237 Bacteria 1569
174 Ga0075370_10059823 3300006353 Bacteria 2169
175 Ga0075370_10138488 3300006353 Bacteria 1422
176 Ga0068871_100289590 3300006358 Bacteria 1435
177 Ga0068871_100311962 3300006358 Bacteria 1383
178 Ga0075434_102125130 3300006871 Bacteria 566
179 Ga0068865_100000661 3300006881 Bacteria 19433
180 Ga0068865_100437596 3300006881 Bacteria 1078
181 Ga0097620_100000228 3300006931 Bacteria 55135
182 Ga0097620_100006372 3300006931 Bacteria 11971
183 Ga0097620_100611226 3300006931 Bacteria 1183
184 Ga0097620_100658951 3300006931 Bacteria 1138
185 Ga0075435_100708670 3300007076 Bacteria 875
186 Ga0105250_10034476 3300009092 Bacteria 2031
187 Ga0105250_10052083 3300009092 Bacteria 1642
188 Ga0105250_10061639 3300009092 Bacteria 1508
189 Ga0105240_10637863 3300009093 Bacteria 1169
190 Ga0105245_10127283 3300009098 Bacteria 2386
191 Ga0105247_10000067 3300009101 Bacteria 118585
192 Ga0105247_10000092 3300009101 Bacteria 97046
193 Ga0105247_10080146 3300009101 Bacteria 2056
194 Ga0105243_10001036 3300009148 Bacteria 25549
195 Ga0105243_10105820 3300009148 Bacteria 2344
196 Ga0105243_11081625 3300009148 Bacteria 809
197 Ga0105243_11999303 3300009148 Bacteria 614
198 Ga0105241_10733918 3300009174 Bacteria 904
199 Ga0105241_10942241 3300009174 Bacteria 804
200 Ga0105242_10000597 3300009176 Bacteria 28284
201 Ga0105242_10431904 3300009176 Bacteria 1237
202 Ga0105248_10000040 3300009177 Bacteria 172452
203 Ga0105248_10005718 3300009177 Bacteria 13656
204 Ga0105248_10035423 3300009177 Bacteria 5583
205 Ga0105248_10425938 3300009177 Bacteria 1495
206 Ga0105248_11048738 3300009177 Bacteria 921
207 Ga0105237_10040797 3300009545 Bacteria 4681
208 Ga0105237_10157556 3300009545 Bacteria 2268
209 Ga0105237_10979498 3300009545 Bacteria 852
210 Ga0105249_10000001 3300009553 Bacteria 504948
211 Ga0105249_10001140 3300009553 Bacteria 23514
212 Ga0105249_10025675 3300009553 Bacteria 5306
213 Ga0105249_10298919 3300009553 Bacteria 1614
214 Ga0105249_10919275 3300009553 Bacteria 942
215 Ga0105239_10090134 3300010375 Bacteria 3383
216 Ga0105246_10065212 3300011119 Bacteria 2546
217 Ga0105246_10974516 3300011119 Bacteria 766
218 Ga0105246_11041870 3300011119 Bacteria 743
219 Ga0157371_10204796 3300013102 Bacteria 1415
220 Ga0157371_10585675 3300013102 Bacteria 829
221 Ga0157369_10360718 3300013105 Bacteria 1509
222 Ga0157374_10086959 3300013296 Bacteria 2975
223 Ga0157374_10476467 3300013296 Bacteria 1251
224 Ga0157378_10002483 3300013297 Bacteria 16403
225 Ga0157378_10059112 3300013297 Bacteria 3420
226 Ga0157378_11215818 3300013297 Bacteria 793
227 Ga0163162_10018721 3300013306 Bacteria 6787
228 Ga0163162_10066182 3300013306 Bacteria 3662
229 Ga0163162_10245894 3300013306 Bacteria 1920
230 Ga0163162_10307995 3300013306 Bacteria 1716
231 Ga0163162_11144724 3300013306 Bacteria 882
232 Ga0163162_11316176 3300013306 Bacteria 821
233 Ga0157372_10002385 3300013307 Bacteria 20339
234 Ga0157372_11503556 3300013307 Bacteria 776
235 Ga0157375_10000305 3300013308 Bacteria 44365
236 Ga0157375_10535596 3300013308 Bacteria 1334
237 Ga0163163_10157183 3300014325 Bacteria 2318
238 Ga0163163_10224364 3300014325 Bacteria 1928
239 Ga0163163_11140132 3300014325 Bacteria 842
240 Ga0157380_10000732 3300014326 Bacteria 20467
241 Ga0157380_12012175 3300014326 Bacteria 640
242 Ga0157377_10094831 3300014745 Bacteria 1768
243 Ga0157379_10022633 3300014968 Bacteria 5568
244 Ga0157379_10066276 3300014968 Bacteria 3228
245 Ga0157379_10084885 3300014968 Bacteria 2837
246 Ga0163161_10004574 3300017792 Bacteria 9631
247 Ga0163161_10009223 3300017792 Bacteria 6822
248 Ga0163161_10265526 3300017792 Bacteria 1342
249 Ga0213876_10000817 3300021384 Bacteria 21042
250 Ga0213876_10038892 3300021384 Bacteria 2512
251 Ga0213876_10088889 3300021384 Bacteria 1636
252 Ga0213876_10139373 3300021384 Bacteria 1290
253 Ga0213875_10018051 3300021388 Bacteria 3404
254 Ga0213875_10024330 3300021388 Bacteria 2889
255 Ga0224572_1035175 3300024225 Bacteria 951
256 Ga0209025_1041064 3300025294 Bacteria 1988
257 Ga0207653_10091115 3300025885 Bacteria 1068
258 Ga0207692_10002656 3300025898 Bacteria 6879
259 Ga0207642_10000164 3300025899 Bacteria 19066
260 Ga0207642_10464897 3300025899 Bacteria 769
261 Ga0207710_10000094 3300025900 Bacteria 118590
262 Ga0207710_10020255 3300025900 Bacteria 2843
263 Ga0207688_10000096 3300025901 Bacteria 34565
264 Ga0207688_10000339 3300025901 Bacteria 21592
265 Ga0207688_10160973 3300025901 Bacteria 1330
266 Ga0207680_10048469 3300025903 Bacteria 2524
267 Ga0207680_11079440 3300025903 Bacteria 574
268 Ga0207647_10034535 3300025904 Bacteria 3227
269 Ga0207685_10010811 3300025905 Bacteria 2715
270 Ga0207685_10016497 3300025905 Bacteria 2366
271 Ga0207699_10479287 3300025906 Bacteria 896
272 Ga0207654_10527518 3300025911 Bacteria 837
273 Ga0207671_10574578 3300025914 Bacteria 899
274 Ga0207671_10584305 3300025914 Bacteria 890
275 Ga0207693_10000634 3300025915 Bacteria 31449
276 Ga0207693_10000717 3300025915 Bacteria 29831
277 Ga0207663_10036412 3300025916 Bacteria 2960
278 Ga0207660_10620460 3300025917 Bacteria 881
279 Ga0207662_10087424 3300025918 Bacteria 1912
280 Ga0207657_10243012 3300025919 Bacteria 1437
281 Ga0207681_10028367 3300025923 Bacteria 3625
282 Ga0207681_10066232 3300025923 Bacteria 2500
283 Ga0207659_10038839 3300025926 Bacteria 3314
284 Ga0207687_10001922 3300025927 Bacteria 14298
285 Ga0207687_10017942 3300025927 Bacteria 4670
286 Ga0207700_10450071 3300025928 Bacteria 1135
287 Ga0207700_10520136 3300025928 Bacteria 1054
288 Ga0207664_10184588 3300025929 Bacteria 1792
289 Ga0207664_10605549 3300025929 Bacteria 984
290 Ga0207664_11008833 3300025929 Bacteria 746
291 Ga0207644_10010272 3300025931 Bacteria 6169
292 Ga0207644_10014182 3300025931 Bacteria 5331
293 Ga0207644_10125771 3300025931 Bacteria 1957
294 Ga0207690_10312034 3300025932 Bacteria 1234
295 Ga0207706_10023920 3300025933 Bacteria 5481
296 Ga0207686_10031551 3300025934 Bacteria 3147
297 Ga0207686_10309401 3300025934 Bacteria 1176
298 Ga0207686_10719007 3300025934 Bacteria 795
299 Ga0207709_10015396 3300025935 Bacteria 4240
300 Ga0207709_10111098 3300025935 Bacteria 1833
301 Ga0207670_10005154 3300025936 Bacteria 7145
302 Ga0207670_10494212 3300025936 Bacteria 992
303 Ga0207669_10002349 3300025937 Bacteria 8037
304 Ga0207704_10175834 3300025938 Bacteria 1541
305 Ga0207665_10002349 3300025939 Bacteria 12773
306 Ga0207665_10031991 3300025939 Bacteria 3483
307 Ga0207665_10435910 3300025939 Bacteria 1003
308 Ga0207665_10568789 3300025939 Bacteria 882
309 Ga0207665_10633602 3300025939 Bacteria 837
310 Ga0207691_10074146 3300025940 Bacteria 3069
311 Ga0207711_10000126 3300025941 Bacteria 80235
312 Ga0207711_10114555 3300025941 Bacteria 2401
313 Ga0207689_10029503 3300025942 Bacteria 4580
314 Ga0207689_10330811 3300025942 Bacteria 1265
315 Ga0207679_10858304 3300025945 Bacteria 829
316 Ga0207667_10278466 3300025949 Bacteria 1709
317 Ga0207712_10000006 3300025961 Bacteria 573204
318 Ga0207712_10008843 3300025961 Bacteria 6367
319 Ga0207668_10004608 3300025972 Bacteria 8106
320 Ga0207640_10013966 3300025981 Bacteria 4612
321 Ga0207640_10265749 3300025981 Bacteria 1339
322 Ga0207640_10659150 3300025981 Bacteria 893
323 Ga0207658_10000108 3300025986 Bacteria 90165
324 Ga0207658_10007702 3300025986 Bacteria 7334
325 Ga0207658_10028606 3300025986 Bacteria 3926
326 Ga0207658_11074299 3300025986 Bacteria 735
327 Ga0207677_10001300 3300026023 Bacteria 13408
328 Ga0207677_10057209 3300026023 Bacteria 2676
329 Ga0207703_10028770 3300026035 Bacteria 4384
330 Ga0207703_10162284 3300026035 Bacteria 1958
331 Ga0207639_10019367 3300026041 Bacteria 4852
332 Ga0207639_10250904 3300026041 Bacteria 1543
333 Ga0207678_10004438 3300026067 Bacteria 12622
334 Ga0207678_10025301 3300026067 Bacteria 5182
335 Ga0207678_11251419 3300026067 Bacteria 657
336 Ga0207708_10068628 3300026075 Bacteria 2713
337 Ga0207708_10386416 3300026075 Bacteria 1155
338 Ga0207708_10765685 3300026075 Bacteria 829
339 Ga0207702_10640121 3300026078 Bacteria 1045
340 Ga0207641_10004858 3300026088 Bacteria 11567
341 Ga0207641_10018642 3300026088 Bacteria 5688
342 Ga0207641_10409857 3300026088 Bacteria 1303
343 Ga0207641_11951286 3300026088 Bacteria 588
344 Ga0207648_10001107 3300026089 Bacteria 30199
345 Ga0207676_10160976 3300026095 Bacteria 1944
346 Ga0207676_10508822 3300026095 Bacteria 1145
347 Ga0207676_11250944 3300026095 Bacteria 736
348 Ga0207675_100000555 3300026118 Bacteria 36440
349 Ga0207675_100016977 3300026118 Bacteria 6802
350 Ga0207675_100425344 3300026118 Bacteria 1312
351 Ga0207683_10000795 3300026121 Bacteria 28807
352 Ga0207683_10087918 3300026121 Bacteria 2764
353 Ga0207698_10061977 3300026142 Bacteria 2918
354 Ga0207698_10330721 3300026142 Bacteria 1431
355 Ga0207698_10414057 3300026142 Bacteria 1291
356 Ga0207698_11152272 3300026142 Bacteria 789
357 Ga0268266_10003769 3300028379 Bacteria 14856
358 Ga0268266_10005376 3300028379 Bacteria 11963
359 Ga0268266_10037420 3300028379 Bacteria 4134
360 Ga0268266_11038692 3300028379 Bacteria 793
361 Ga0268266_11288999 3300028379 Bacteria 706
362 Ga0268265_10000032 3300028380 Bacteria 225953
363 Ga0268265_10005171 3300028380 Bacteria 8940
364 Ga0268264_10000026 3300028381 Bacteria 459088
365 Ga0268264_10010060 3300028381 Bacteria 7830
366 Ga0268264_10147774 3300028381 Bacteria 2103
367 Ga0307405_10184464 3300031731 Bacteria 1501
368 Ga0307405_11029269 3300031731 Bacteria 704
369 Ga0307410_10881920 3300031852 Bacteria 765
370 Ga0307407_10102762 3300031903 Bacteria 1778
371 Ga0307409_100109219 3300031995 Bacteria 2316
372 Ga0307409_101707167 3300031995 Bacteria 658
373 Ga0307416_101179957 3300032002 Bacteria 871
374 Ga0307416_102347418 3300032002 Bacteria 633
375 Ga0307414_10141581 3300032004 Bacteria 1884
376 Ga0307411_10392426 3300032005 Bacteria 1145
377 Ga0307415_100025121 3300032126 Bacteria 3733
378 Ga0373932_0070853 3300035112 Bacteria 1081
379 Ga0373960_0031948 3300035121 Bacteria 1476
380 Ga0373943_0055212 3300035170 Bacteria 1967
381 Ga0373962_0055165 3300035242 Bacteria 1154
382 Ga0316582_0363370 3300036647 Bacteria 996
383 Ga0436364_0182063 3300037853 Bacteria 3933
384 Ga0436364_0829857 3300037853 Bacteria 1475
385 Ga0436364_1324934 3300037853 Bacteria 6135
386 Ga0436365_0191332 3300039437 Bacteria 8367
387 Ga0436365_0308474 3300039437 Bacteria 32517
388 Ga0436365_0619963 3300039437 Bacteria 8309
389 Ga0436365_1880606 3300039437 Bacteria 3206
390 Ga0436361_0289718 3300039447 Bacteria 1061
391 Ga0439461_0000660 3300041410 Bacteria 4983
392 Ga0439461_0001053 3300041410 Bacteria 4152
393 Ga0439466_0006285 3300041411 Bacteria 4522
394 Ga0439466_0017969 3300041411 Bacteria 2541
395 Ga0439466_0144465 3300041411 Bacteria 729
396 Ga0439465_0013714 3300041413 Bacteria 2523
397 Ga0439465_0017397 3300041413 Bacteria 2244
398 Ga0451789_1111759 3300041443 Bacteria 979
399 Ga0439431_0000231 3300041997 Bacteria 11288
400 Ga0439442_003399 3300042002 Bacteria 3146
401 Ga0439442_012415 3300042002 Bacteria 1742
402 Ga0439445_0069044 3300042004 Bacteria 975
403 Ga0439434_0025194 3300042435 Bacteria 1794
404 Ga0439434_0059574 3300042435 Bacteria 1192
405 Ga0439434_0084049 3300042435 Bacteria 1012
406 Ga0466969_0098062 3300044656 Bacteria 1382
407 Ga0466972_0050787 3300044658 Bacteria 2001
408 Ga0466972_0070800 3300044658 Bacteria 1664
409 Ga0466972_0191181 3300044658 Bacteria 959
410 Ga0466972_0257834 3300044658 Bacteria 815
411 Ga0466965_0012698 3300044683 Bacteria 3966
412 Ga0466965_0018506 3300044683 Bacteria 3340
413 Ga0466966_0005651 3300044684 Bacteria 8226
414 Ga0466963_0016907 3300044694 Bacteria 4544
415 Ga0466964_0798735 3300044706 Bacteria 533
416 Ga0466971_0193229 3300044719 Bacteria 959
417 Ga0466971_0202401 3300044719 Bacteria 937
418 Ga0466968_0000991 3300044735 Bacteria 9976
419 Ga0466968_0020056 3300044735 Bacteria 2695
420 Ga0466970_0009874 3300044765 Bacteria 4832
421 Ga0466970_0235938 3300044765 Bacteria 1023
422 Ga0466957_0010713 3300044842 Bacteria 5272
423 Ga0466957_0040071 3300044842 Bacteria 2828
424 Ga0466957_1393757 3300044842 Bacteria 510
425 Ga0466960_0003659 3300044901 Bacteria 5931
426 Ga0466960_0012369 3300044901 Bacteria 3599
427 Ga0466960_0047430 3300044901 Bacteria 2060
428 Ga0466960_0102515 3300044901 Bacteria 1476
429 Ga0466959_0034592 3300045049 Bacteria 3737
430 Ga0466959_0052465 3300045049 Bacteria 2986
431 Ga0466959_0157436 3300045049 Bacteria 1598
432 Ga0466958_0035849 3300045836 Bacteria 2965
433 Ga0466958_0232120 3300045836 Bacteria 1178
434 Ga0466958_0320054 3300045836 Bacteria 997
435 Ga0466967_0042267 3300045976 Bacteria 3937
436 Ga0466967_0047921 3300045976 Bacteria 3728
437 Ga0466967_0325764 3300045976 Bacteria 1483
438 Ga0466967_0342341 3300045976 Bacteria 1446
439 Ga0466967_0569252 3300045976 Bacteria 1116
440 Ga0466967_1398493 3300045976 Bacteria 697
441 Ga0495603_0035005 3300046455 Bacteria 3018
442 Ga0495629_0058598 3300046459 Bacteria 2693
443 Ga0495638_0006741 3300046460 Bacteria 8318
444 Ga0495641_0132167 3300046461 Bacteria 1114
445 Ga0495582_0334826 3300046473 Bacteria 871
446 Ga0495639_0686851 3300046475 Bacteria 528
447 Ga0495662_0099083 3300046476 Bacteria 1425
448 Ga0495596_0242398 3300046500 Bacteria 700
449 Ga0495608_0325436 3300046511 Bacteria 949
450 Ga0495665_0072295 3300046531 Bacteria 1816
451 Ga0495640_0037748 3300046533 Bacteria 3404
452 Ga0495609_0286882 3300046538 Bacteria 672
453 Ga0495668_0266264 3300046616 Bacteria 938
454 Ga0495611_0247821 3300046648 Bacteria 826
455 Ga0495635_0542149 3300046663 Bacteria 763
456 Ga0495588_0465592 3300046674 Bacteria 663
457 Ga0495646_0291021 3300046680 Bacteria 866
458 Ga0495658_0209263 3300046683 Bacteria 1218
459 Ga0495669_0329596 3300046684 Bacteria 737
460 Ga0495624_0159652 3300046690 Bacteria 1378
461 Ga0495649_0293399 3300046694 Bacteria 829
462 Ga0495674_0145983 3300047319 Bacteria 1986
463 Ga0495672_0013924 3300047320 Bacteria 5529
464 Ga0495672_0116847 3300047320 Bacteria 1424
465 Ga0495676_0180582 3300047321 Bacteria 1479
466 Ga0495683_0000381 3300047323 Bacteria 36243
467 Ga0495673_0001061 3300047469 Bacteria 24141
468 Ga0495686_0177994 3300047472 Bacteria 1234
469 Ga0495593_0150692 3300047673 Bacteria 1176
470 Ga0495614_0065358 3300048089 Bacteria 1565
471 Ga0496100_0005184 3300048903 Bacteria 6991
472 Ga0496100_0008547 3300048903 Bacteria 5714
473 Ga0496100_0022949 3300048903 Bacteria 3783
474 Ga0496100_0181901 3300048903 Bacteria 1521
475 Ga0496100_0387677 3300048903 Bacteria 1062
476 Ga0496101_0000011 3300048904 Bacteria 272153
477 Ga0496101_0003004 3300048904 Bacteria 10394
478 Ga0496101_0757096 3300048904 Bacteria 766
479 Ga0496101_0788764 3300048904 Bacteria 749
480 Ga0496101_1191908 3300048904 Bacteria 597
481 Ga0496102_0000012 3300048905 Bacteria 315470
482 Ga0496102_0001872 3300048905 Bacteria 18125
483 Ga0496102_0013028 3300048905 Bacteria 7198
484 Ga0496102_0016862 3300048905 Bacteria 6390
485 Ga0496102_0031471 3300048905 Bacteria 4760
486 Ga0496102_0036031 3300048905 Bacteria 4456
487 Ga0496102_0040837 3300048905 Bacteria 4199
488 Ga0496102_0135691 3300048905 Bacteria 2306
489 Ga0496102_0156138 3300048905 Bacteria 2145
490 Ga0496102_0241085 3300048905 Bacteria 1705
491 Ga0496102_0375929 3300048905 Bacteria 1337
492 Ga0496103_0000005 3300048906 Bacteria 505416
493 Ga0496103_0000238 3300048906 Bacteria 53761
494 Ga0496103_0000277 3300048906 Bacteria 48396
495 Ga0496104_0002275 3300048907 Bacteria 16561
496 Ga0496104_0158612 3300048907 Bacteria 2171
497 Ga0496104_0381033 3300048907 Bacteria 1323
498 Ga0496105_0075329 3300048908 Bacteria 2787
499 Ga0496105_0216572 3300048908 Bacteria 1560
500 Ga0496105_0372233 3300048908 Bacteria 1138
501 Ga0496106_0000372 3300048909 Bacteria 31847
502 Ga0496106_0030493 3300048909 Bacteria 4020
503 Ga0496106_0212290 3300048909 Bacteria 1542
504 Ga0496106_0255258 3300048909 Bacteria 1402
505 Ga0496107_0001450 3300048910 Bacteria 14665
506 Ga0496107_0047803 3300048910 Bacteria 3081
507 Ga0496107_0064415 3300048910 Bacteria 2657
508 Ga0496107_0722137 3300048910 Bacteria 732
509 Ga0496108_0075141 3300048911 Bacteria 2854
510 Ga0496108_0089352 3300048911 Bacteria 2618
511 Ga0496108_0096097 3300048911 Bacteria 2523
512 Ga0496109_0027943 3300048912 Bacteria 5042
513 Ga0496109_0740846 3300048912 Bacteria 920
514 Ga0496109_0836677 3300048912 Bacteria 858
515 Ga0496110_0480322 3300048913 Bacteria 1132
516 Ga0496112_0058201 3300048915 Bacteria 3806
517 Ga0496112_0070252 3300048915 Bacteria 3460
518 Ga0496112_0075493 3300048915 Bacteria 3333
519 Ga0496112_0075802 3300048915 Bacteria 3326
520 Ga0496112_0335357 3300048915 Bacteria 1456
521 Ga0496112_0976810 3300048915 Bacteria 767
522 Ga0496113_0011555 3300048916 Bacteria 5898
523 Ga0496113_0054138 3300048916 Bacteria 3002
524 Ga0496113_0306635 3300048916 Bacteria 1272
525 Ga0496114_0003618 3300048917 Bacteria 11882
526 Ga0496114_0056543 3300048917 Bacteria 3275
527 Ga0496115_0016385 3300048918 Bacteria 5644
528 Ga0496115_0161955 3300048918 Bacteria 1849
529 Ga0496116_0000050 3300048919 Bacteria 311670
530 Ga0496116_0049212 3300048919 Bacteria 2821
531 Ga0496116_0332611 3300048919 Bacteria 705
532 Ga0496117_0000042 3300048920 Bacteria 315470
533 Ga0496117_0000904 3300048920 Bacteria 45615
534 Ga0496117_0102024 3300048920 Bacteria 1812
535 Ga0496117_0600105 3300048920 Bacteria 515
536 Ga0496118_0000037 3300048921 Bacteria 315470
537 Ga0496118_0000694 3300048921 Bacteria 54687
538 Ga0496118_0001360 3300048921 Bacteria 36838
539 Ga0496119_0004263 3300048922 Bacteria 14329
540 Ga0496119_0146059 3300048922 Bacteria 1272
541 Ga0496119_0152336 3300048922 Bacteria 1237
542 Ga0496119_0363809 3300048922 Bacteria 697
543 Ga0496120_0047626 3300048923 Bacteria 2471
544 Ga0496120_0201476 3300048923 Bacteria 963
545 Ga0496121_0001091 3300048924 Bacteria 47947
546 Ga0496121_0002871 3300048924 Bacteria 25391
547 Ga0496122_0004913 3300048925 Bacteria 16215
548 Ga0496123_0009435 3300048926 Bacteria 8789
549 Ga0496124_0025494 3300048927 Bacteria 5354
550 Ga0496124_0443876 3300048927 Bacteria 887
551 Ga0496125_0069855 3300048928 Bacteria 2752
552 Ga0496126_0000236 3300048929 Bacteria 119350
553 Ga0496126_0009442 3300048929 Bacteria 10357
554 Ga0496126_0156705 3300048929 Bacteria 1948
555 Ga0496126_0158798 3300048929 Bacteria 1933
556 Ga0501032_0001152 3300049569 Bacteria 21169
557 Ga0501032_0037570 3300049569 Bacteria 3301
558 Ga0501032_0154505 3300049569 Bacteria 1508
559 Ga0501033_0038775 3300049570 Bacteria 3559
560 Ga0501034_0002753 3300049571 Bacteria 20648
561 Ga0501034_0032813 3300049571 Bacteria 5272
562 Ga0501034_0276823 3300049571 Bacteria 1618
563 Ga0501036_0013223 3300049572 Bacteria 6854
564 Ga0501036_0062835 3300049572 Bacteria 3145
565 Ga0501037_0002998 3300049573 Bacteria 12259
566 Ga0501037_0077962 3300049573 Bacteria 2404
567 Ga0501038_0003343 3300049574 Bacteria 14956
568 Ga0501039_0000887 3300049575 Bacteria 21753
569 Ga0501043_0002160 3300049579 Bacteria 16773
570 Ga0501043_0066196 3300049579 Bacteria 2837
571 Ga0501046_0001024 3300049580 Bacteria 27292
572 Ga0501047_0088989 3300049581 Bacteria 2964
573 Ga0501047_0606626 3300049581 Bacteria 916
574 Ga0501048_0151490 3300049582 Bacteria 1640
575 Ga0501069_0709299 3300049585 Bacteria 607
576 Ga0501070_0004347 3300049586 Bacteria 12181
577 Ga0501070_0009277 3300049586 Bacteria 8322
578 Ga0501070_1125583 3300049586 Bacteria 605
579 Ga0501073_0117475 3300049589 Bacteria 1843
580 Ga0501074_0610934 3300049590 Bacteria 771
581 Ga0501080_0041695 3300049742 Bacteria 4276
582 Ga0501080_0446459 3300049742 Bacteria 1160
583 Ga0501035_0003983 3300049822 Bacteria 14082
584 Ga0501044_0008894 3300049823 Bacteria 10976
585 Ga0501044_0403113 3300049823 Bacteria 1280
586 Ga0501044_0864028 3300049823 Bacteria 781
587 nmdc:mga03683_14300_c1 3300050489 Bacteria 2934
588 nmdc:mga03683_54316_c1 3300050489 Bacteria 1679
589 nmdc:mga03683_78811_c1 3300050489 Bacteria 1419
590 nmdc:mga03n38_113533_c1 3300050490 Bacteria 1322
591 nmdc:mga03n38_15808_c1 3300050490 Bacteria 2922
592 nmdc:mga03n38_3016_c1 3300050490 Bacteria 3780
593 nmdc:mga03n38_366703_c1 3300050490 Bacteria 787
594 nmdc:mga03n38_4001_c1 3300050490 Bacteria 4816
595 nmdc:mga03n38_8312_c1 3300050490 Bacteria 3718
596 nmdc:mga00v17_10423_c1 3300050491 Bacteria 5074
597 nmdc:mga00v17_155612_c1 3300050491 Bacteria 1470
598 nmdc:mga00v17_170118_c1 3300050491 Bacteria 1405
599 nmdc:mga00v17_347012_c1 3300050491 Bacteria 965
600 nmdc:mga00v17_3695_c1 3300050491 Bacteria 7906
601 nmdc:mga00v17_438228_c1 3300050491 Bacteria 848
602 nmdc:mga00v17_54243_c1 3300050491 Bacteria 2445
603 nmdc:mga00v17_59759_c1 3300050491 Bacteria 2340
604 nmdc:mga00v17_85154_c1 3300050491 Bacteria 1979
605 nmdc:mga00v17_91425_c1 3300050491 Bacteria 1912
606 nmdc:mga00v17_98692_c1 3300050491 Bacteria 1842
607 nmdc:mga0yw44_100068_c1 3300050492 Bacteria 1845
608 nmdc:mga0yw44_35816_c1 3300050492 Bacteria 2920
609 nmdc:mga0yw44_632285_c1 3300050492 Bacteria 727
610 nmdc:mga0yw44_72395_c1 3300050492 Bacteria 2142
611 nmdc:mga0yw44_7865_c2 3300050492 Bacteria 4050
612 nmdc:mga0yw44_988_c1 3300050492 Bacteria 4723
613 nmdc:mga0k408_105819_c2 3300050493 Bacteria 660
614 nmdc:mga06z11_13879_c1 3300050494 Bacteria 3551
615 nmdc:mga06z11_255541_c1 3300050494 Bacteria 1033
616 nmdc:mga07m45_13609_c1 3300050496 Bacteria 4321
617 nmdc:mga07m45_204846_c1 3300050496 Bacteria 1148
618 nmdc:mga07m45_305812_c1 3300050496 Bacteria 924
619 nmdc:mga07m45_318818_c1 3300050496 Bacteria 903
620 nmdc:mga07m45_9452_c1 3300050496 Bacteria 5059
621 nmdc:mga07m45_9656_c1 3300050496 Bacteria 5014
622 nmdc:mga0qj67_49997_c1 3300050509 Bacteria 3304
623 nmdc:mga08y16_1391576_c1 3300050511 Bacteria 665
624 nmdc:mga0rr50_653270_c1 3300050513 Bacteria 897
625 nmdc:mga08x19_903965_c1 3300050514 Bacteria 627
626 nmdc:mga0sz30_1043_c2 3300050516 Bacteria 3228
627 nmdc:mga0sz30_142591_c1 3300050516 Bacteria 1058
628 nmdc:mga0sz30_178607_c1 3300050516 Bacteria 941
629 nmdc:mga0sz30_30910_c1 3300050516 Bacteria 936
630 nmdc:mga0sz30_32515_c1 3300050516 Bacteria 2164
631 nmdc:mga0sz30_5516_c1 3300050516 Bacteria 4645
632 nmdc:mga0sz30_61224_c1 3300050516 Bacteria 1608
633 Ga0500635_0001178 3300053080 Bacteria 6260
634 Ga0495655_0025457 3300053083 Bacteria 1384
635 Ga0495619_0036492 3300053085 Bacteria 3202
636 Ga0500643_207979 3300053087 Bacteria 525
637 Ga0500646_0032759 3300053090 Bacteria 1435
638 Ga0500595_089341 3300053119 Bacteria 893
639 Ga0500628_074421 3300053129 Bacteria 857
640 Ga0500642_0036279 3300053130 Bacteria 2100
641 Ga0500652_000914 3300053131 Bacteria 9744
642 Ga0466962_0066899 3300061719 Bacteria 1715

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0037570 Ga0501032_0037570_2083_2538 140
2 3300049570 Ga0501033_0038775 Ga0501033_0038775_1706_2161 140
3 3300049571 Ga0501034_0002753 Ga0501034_0002753_13708_14163 140
4 3300049572 Ga0501036_0062835 Ga0501036_0062835_688_1143 140
5 3300049573 Ga0501037_0077962 Ga0501037_0077962_448_903 140
6 3300049579 Ga0501043_0066196 Ga0501043_0066196_866_1321 140
7 3300049580 Ga0501046_0001024 Ga0501046_0001024_10856_11311 140
8 3300049581 Ga0501047_0088989 Ga0501047_0088989_901_1356 140
9 3300049582 Ga0501048_0151490 Ga0501048_0151490_1131_1586 140
10 3300049586 Ga0501070_0009277 Ga0501070_0009277_3382_3837 140
11 3300049742 Ga0501080_0041695 Ga0501080_0041695_1028_1483 140
12 3300049822 Ga0501035_0003983 Ga0501035_0003983_3254_3709 140
13 3300037853 Ga0436364_0829857 Ga0436364_0829857_842_1306 143
14 3300039437 Ga0436365_0191332 Ga0436365_0191332_5062_5526 143
15 3300049569 Ga0501032_0154505 Ga0501032_0154505_31_501 143
16 3300026121 Ga0207683_10087918 Ga0207683_100879183 148
17 3300046663 Ga0495635_0542149 Ga0495635_0542149_182_661 148
18 3300044706 Ga0466964_0798735 Ga0466964_0798735_13_471 149
19 3300048904 Ga0496101_0788764 Ga0496101_0788764_137_640 149
20 3300005563 Ga0068855_100111357 Ga0068855_1001113572 150
21 3300009093 Ga0105240_10637863 Ga0105240_106378632 150
22 3300009545 Ga0105237_10040797 Ga0105237_100407975 150
23 3300025914 Ga0207671_10574578 Ga0207671_105745781 150
24 3300044842 Ga0466957_1393757 Ga0466957_1393757_27_485 150
25 3300048903 Ga0496100_0005184 Ga0496100_0005184_5715_6194 150
26 3300048904 Ga0496101_0000011 Ga0496101_0000011_160926_161405 150
27 3300048905 Ga0496102_0000012 Ga0496102_0000012_142136_142615 150
28 3300048905 Ga0496102_0375929 Ga0496102_0375929_493_951 150
29 3300048906 Ga0496103_0000005 Ga0496103_0000005_172848_173327 150
30 3300048909 Ga0496106_0030493 Ga0496106_0030493_3225_3704 150
31 3300048910 Ga0496107_0064415 Ga0496107_0064415_1796_2275 150
32 3300048919 Ga0496116_0000050 Ga0496116_0000050_138357_138836 150
33 3300048920 Ga0496117_0000042 Ga0496117_0000042_172856_173335 150
34 3300048920 Ga0496117_0102024 Ga0496117_0102024_1249_1707 150
35 3300048921 Ga0496118_0000037 Ga0496118_0000037_172856_173335 150
36 3300048921 Ga0496118_0000694 Ga0496118_0000694_38288_38746 150
37 3300048922 Ga0496119_0152336 Ga0496119_0152336_132_611 150
38 3300048922 Ga0496119_0363809 Ga0496119_0363809_87_566 150
39 3300048923 Ga0496120_0201476 Ga0496120_0201476_208_687 150
40 3300048924 Ga0496121_0001091 Ga0496121_0001091_512_991 150
41 3300048929 Ga0496126_0000236 Ga0496126_0000236_94100_94579 150
42 3300048929 Ga0496126_0158798 Ga0496126_0158798_347_871 150
43 iso_pu_bacteria 2738541264 2738668684 150
44 iso_pu_bacteria 2738541356 2739147876 150
45 3300021384 Ga0213876_10139373 Ga0213876_101393732 151
46 3300039437 Ga0436365_1880606 Ga0436365_1880606_825_1283 151
47 3300053130 Ga0500642_0036279 Ga0500642_0036279_219_686 151
48 3300005436 Ga0070713_100379472 Ga0070713_1003794722 152
49 3300005937 Ga0081455_10041564 Ga0081455_100415645 152
50 3300044719 Ga0466971_0202401 Ga0466971_0202401_16_492 152
51 3300061719 Ga0466962_0066899 Ga0466962_0066899_987_1463 152
52 3300005436 Ga0070713_100260144 Ga0070713_1002601442 154
53 3300005436 Ga0070713_100860059 Ga0070713_1008600591 154
54 3300005437 Ga0070710_10105794 Ga0070710_101057944 154
55 3300006038 Ga0075365_10074187 Ga0075365_100741872 154
56 3300006042 Ga0075368_10276575 Ga0075368_102765752 154
57 3300006048 Ga0075363_100001512 Ga0075363_1000015127 154
58 3300006051 Ga0075364_10036360 Ga0075364_100363604 154
59 3300006178 Ga0075367_10268321 Ga0075367_102683212 154
60 3300006186 Ga0075369_10007707 Ga0075369_100077072 154
61 3300021384 Ga0213876_10000817 Ga0213876_100008178 154
62 3300021388 Ga0213875_10018051 Ga0213875_100180513 154
63 3300036647 Ga0316582_0363370 Ga0316582_0363370_114_587 154
64 3300037853 Ga0436364_1324934 Ga0436364_1324934_1974_2474 154
65 3300039437 Ga0436365_0308474 Ga0436365_0308474_12768_13268 154
66 3300044656 Ga0466969_0098062 Ga0466969_0098062_592_1065 154
67 3300044684 Ga0466966_0005651 Ga0466966_0005651_3791_4264 154
68 3300044694 Ga0466963_0016907 Ga0466963_0016907_2050_2523 154
69 3300044719 Ga0466971_0193229 Ga0466971_0193229_272_745 154
70 3300044765 Ga0466970_0235938 Ga0466970_0235938_406_879 154
71 3300044842 Ga0466957_0040071 Ga0466957_0040071_1229_1702 154
72 3300044901 Ga0466960_0047430 Ga0466960_0047430_186_683 154
73 3300045049 Ga0466959_0052465 Ga0466959_0052465_154_627 154
74 3300045836 Ga0466958_0035849 Ga0466958_0035849_1043_1516 154
75 3300045976 Ga0466967_0047921 Ga0466967_0047921_3045_3542 154
76 3300050490 nmdc:mga03n38_3016_c1 nmdc:mga03n38_3016_c1_160_642 154
77 3300050491 nmdc:mga00v17_170118_c1 nmdc:mga00v17_170118_c1_74_556 154
78 3300050492 nmdc:mga0yw44_72395_c1 nmdc:mga0yw44_72395_c1_1023_1505 154
79 3300050494 nmdc:mga06z11_255541_c1 nmdc:mga06z11_255541_c1_50_532 154
80 3300050496 nmdc:mga07m45_9452_c1 nmdc:mga07m45_9452_c1_1112_1594 154
81 3300050516 nmdc:mga0sz30_5516_c1 nmdc:mga0sz30_5516_c1_2248_2730 154
82 iso_pu_bacteria 2738541274 2738705095 154
83 iso_pu_bacteria 2738543028 2739332792 154
84 iso_pu_bacteria 2842134933 2842138055 154
85 iso_pu_bacteria 2902799365 2902801186 154
86 iso_pu_bacteria 2929212328 2929215348 154
87 iso_pu_bacteria 2939582691 2939585936 154
88 3300005435 Ga0070714_100330481 Ga0070714_1003304812 155
89 3300025928 Ga0207700_10450071 Ga0207700_104500712 155
90 3300025929 Ga0207664_10184588 Ga0207664_101845882 155
91 3300039447 Ga0436361_0289718 Ga0436361_0289718_225_719 155
92 3300050489 nmdc:mga03683_78811_c1 nmdc:mga03683_78811_c1_574_1059 155
93 3300053087 Ga0500643_207979 Ga0500643_207979_18_506 155
94 iso_pu_bacteria 2643221715 2644633583 155
95 iso_pu_bacteria 2902792274 2902796062 155
96 iso_pu_bacteria 2902810491 2902815113 155
97 3300005578 Ga0068854_100371601 Ga0068854_1003716012 156
98 3300005616 Ga0068852_100467726 Ga0068852_1004677261 156
99 3300006038 Ga0075365_10805280 Ga0075365_108052802 156
100 3300006175 Ga0070712_100171429 Ga0070712_1001714292 156
101 3300025928 Ga0207700_10520136 Ga0207700_105201362 156
102 3300025932 Ga0207690_10312034 Ga0207690_103120343 156
103 3300025939 Ga0207665_10435910 Ga0207665_104359102 156
104 3300025981 Ga0207640_10659150 Ga0207640_106591502 156
105 3300047472 Ga0495686_0177994 Ga0495686_0177994_290_763 156
106 3300049823 Ga0501044_0008894 Ga0501044_0008894_6052_6540 156
107 3300005435 Ga0070714_100220999 Ga0070714_1002209993 157
108 3300005530 Ga0070679_101040829 Ga0070679_1010408292 157
109 3300006038 Ga0075365_10218666 Ga0075365_102186662 157
110 3300006051 Ga0075364_10035521 Ga0075364_100355213 157
111 3300006871 Ga0075434_102125130 Ga0075434_1021251301 157
112 3300021388 Ga0213875_10024330 Ga0213875_100243303 157
113 3300026067 Ga0207678_11251419 Ga0207678_112514191 157
114 3300037853 Ga0436364_0182063 Ga0436364_0182063_2530_3027 157
115 3300045976 Ga0466967_0325764 Ga0466967_0325764_318_800 157
116 3300046694 Ga0495649_0293399 Ga0495649_0293399_26_529 157
117 3300048905 Ga0496102_0241085 Ga0496102_0241085_398_889 157
118 3300049590 Ga0501074_0610934 Ga0501074_0610934_18_527 157
119 3300050491 nmdc:mga00v17_347012_c1 nmdc:mga00v17_347012_c1_381_860 157
120 3300050491 nmdc:mga00v17_85154_c1 nmdc:mga00v17_85154_c1_1407_1886 157
121 3300050492 nmdc:mga0yw44_100068_c1 nmdc:mga0yw44_100068_c1_766_1245 157
122 3300053080 Ga0500635_0001178 Ga0500635_0001178_5641_6135 157
123 3300053131 Ga0500652_000914 Ga0500652_000914_3224_3718 157
124 3300005327 Ga0070658_11071300 Ga0070658_110713002 158
125 3300005329 Ga0070683_100617025 Ga0070683_1006170252 158
126 3300005337 Ga0070682_100027764 Ga0070682_1000277642 158
127 3300005339 Ga0070660_100522261 Ga0070660_1005222612 158
128 3300005344 Ga0070661_100691855 Ga0070661_1006918552 158
129 3300005367 Ga0070667_100303783 Ga0070667_1003037831 158
130 3300005455 Ga0070663_100028798 Ga0070663_1000287986 158
131 3300005456 Ga0070678_100766699 Ga0070678_1007666992 158
132 3300005466 Ga0070685_10162617 Ga0070685_101626172 158
133 3300005564 Ga0070664_100876245 Ga0070664_1008762451 158
134 3300006048 Ga0075363_100123338 Ga0075363_1001233382 158
135 3300009148 Ga0105243_11999303 Ga0105243_119993032 158
136 3300014325 Ga0163163_11140132 Ga0163163_111401322 158
137 3300021384 Ga0213876_10038892 Ga0213876_100388922 158
138 3300021384 Ga0213876_10088889 Ga0213876_100888893 158
139 3300024225 Ga0224572_1035175 Ga0224572_10351752 158
140 3300025934 Ga0207686_10719007 Ga0207686_107190072 158
141 3300025939 Ga0207665_10633602 Ga0207665_106336022 158
142 3300025945 Ga0207679_10858304 Ga0207679_108583042 158
143 3300026067 Ga0207678_10025301 Ga0207678_100253017 158
144 3300026142 Ga0207698_10330721 Ga0207698_103307213 158
145 3300028379 Ga0268266_11038692 Ga0268266_110386921 158
146 3300035170 Ga0373943_0055212 Ga0373943_0055212_1463_1954 158
147 3300039437 Ga0436365_0619963 Ga0436365_0619963_3417_3923 158
148 3300041443 Ga0451789_1111759 Ga0451789_1111759_401_880 158
149 3300044658 Ga0466972_0191181 Ga0466972_0191181_398_874 158
150 3300044658 Ga0466972_0257834 Ga0466972_0257834_228_710 158
151 3300044683 Ga0466965_0012698 Ga0466965_0012698_1182_1658 158
152 3300044683 Ga0466965_0018506 Ga0466965_0018506_1456_1938 158
153 3300044735 Ga0466968_0000991 Ga0466968_0000991_1386_1862 158
154 3300044765 Ga0466970_0009874 Ga0466970_0009874_614_1090 158
155 3300044842 Ga0466957_0010713 Ga0466957_0010713_2340_2816 158
156 3300044901 Ga0466960_0003659 Ga0466960_0003659_3079_3555 158
157 3300044901 Ga0466960_0012369 Ga0466960_0012369_1869_2351 158
158 3300045049 Ga0466959_0034592 Ga0466959_0034592_280_792 158
159 3300045836 Ga0466958_0232120 Ga0466958_0232120_114_590 158
160 3300045976 Ga0466967_0342341 Ga0466967_0342341_251_727 158
161 3300045976 Ga0466967_1398493 Ga0466967_1398493_76_555 158
162 3300046455 Ga0495603_0035005 Ga0495603_0035005_229_720 158
163 3300046459 Ga0495629_0058598 Ga0495629_0058598_1266_1757 158
164 3300046460 Ga0495638_0006741 Ga0495638_0006741_108_587 158
165 3300046461 Ga0495641_0132167 Ga0495641_0132167_45_536 158
166 3300046473 Ga0495582_0334826 Ga0495582_0334826_91_582 158
167 3300046475 Ga0495639_0686851 Ga0495639_0686851_21_512 158
168 3300046476 Ga0495662_0099083 Ga0495662_0099083_491_982 158
169 3300046511 Ga0495608_0325436 Ga0495608_0325436_301_792 158
170 3300046531 Ga0495665_0072295 Ga0495665_0072295_788_1279 158
171 3300046533 Ga0495640_0037748 Ga0495640_0037748_2110_2601 158
172 3300046674 Ga0495588_0465592 Ga0495588_0465592_25_516 158
173 3300046680 Ga0495646_0291021 Ga0495646_0291021_178_669 158
174 3300046683 Ga0495658_0209263 Ga0495658_0209263_437_928 158
175 3300046690 Ga0495624_0159652 Ga0495624_0159652_144_635 158
176 3300047319 Ga0495674_0145983 Ga0495674_0145983_1000_1491 158
177 3300047321 Ga0495676_0180582 Ga0495676_0180582_426_917 158
178 3300047673 Ga0495593_0150692 Ga0495593_0150692_381_872 158
179 3300048089 Ga0495614_0065358 Ga0495614_0065358_348_839 158
180 3300048903 Ga0496100_0387677 Ga0496100_0387677_281_757 158
181 3300048908 Ga0496105_0372233 Ga0496105_0372233_517_996 158
182 3300048912 Ga0496109_0740846 Ga0496109_0740846_226_705 158
183 3300048915 Ga0496112_0058201 Ga0496112_0058201_1242_1718 158
184 3300048915 Ga0496112_0070252 Ga0496112_0070252_670_1149 158
185 3300048915 Ga0496112_0335357 Ga0496112_0335357_454_933 158
186 3300048915 Ga0496112_0976810 Ga0496112_0976810_163_642 158
187 3300048916 Ga0496113_0054138 Ga0496113_0054138_1242_1718 158
188 3300048920 Ga0496117_0600105 Ga0496117_0600105_14_490 158
189 3300048925 Ga0496122_0004913 Ga0496122_0004913_3028_3504 158
190 3300048926 Ga0496123_0009435 Ga0496123_0009435_3401_3877 158
191 3300048927 Ga0496124_0443876 Ga0496124_0443876_159_635 158
192 3300048929 Ga0496126_0009442 Ga0496126_0009442_4813_5289 158
193 3300049569 Ga0501032_0001152 Ga0501032_0001152_5437_5919 158
194 3300049571 Ga0501034_0032813 Ga0501034_0032813_1985_2467 158
195 3300049572 Ga0501036_0013223 Ga0501036_0013223_188_670 158
196 3300049573 Ga0501037_0002998 Ga0501037_0002998_2895_3377 158
197 3300049574 Ga0501038_0003343 Ga0501038_0003343_5565_6047 158
198 3300049575 Ga0501039_0000887 Ga0501039_0000887_19553_20035 158
199 3300049579 Ga0501043_0002160 Ga0501043_0002160_3238_3720 158
200 3300049586 Ga0501070_0004347 Ga0501070_0004347_4631_5113 158
201 3300049589 Ga0501073_0117475 Ga0501073_0117475_921_1403 158
202 3300049823 Ga0501044_0403113 Ga0501044_0403113_377_895 158
203 3300050511 nmdc:mga08y16_1391576_c1 nmdc:mga08y16_1391576_c1_44_535 158
204 3300050514 nmdc:mga08x19_903965_c1 nmdc:mga08x19_903965_c1_54_545 158
205 3300053083 Ga0495655_0025457 Ga0495655_0025457_694_1173 158
206 3300053085 Ga0495619_0036492 Ga0495619_0036492_397_888 158
207 3300053119 Ga0500595_089341 Ga0500595_089341_337_816 158
208 3300053129 Ga0500628_074421 Ga0500628_074421_221_700 158
209 3300005353 Ga0070669_100003447 Ga0070669_10000344710 159
210 3300005355 Ga0070671_100074578 Ga0070671_1000745783 159
211 3300005355 Ga0070671_100155578 Ga0070671_1001555783 159
212 3300005356 Ga0070674_101573706 Ga0070674_1015737061 159
213 3300005365 Ga0070688_100913179 Ga0070688_1009131792 159
214 3300005367 Ga0070667_100000034 Ga0070667_10000003498 159
215 3300005441 Ga0070700_100340696 Ga0070700_1003406962 159
216 3300005466 Ga0070685_10288763 Ga0070685_102887631 159
217 3300005536 Ga0070697_101177817 Ga0070697_1011778171 159
218 3300005544 Ga0070686_100042792 Ga0070686_1000427923 159
219 3300005548 Ga0070665_100076253 Ga0070665_1000762533 159
220 3300005548 Ga0070665_100103991 Ga0070665_1001039913 159
221 3300005617 Ga0068859_100000228 Ga0068859_10000022848 159
222 3300005618 Ga0068864_101372683 Ga0068864_1013726832 159
223 3300005841 Ga0068863_100002759 Ga0068863_1000027599 159
224 3300005841 Ga0068863_100027391 Ga0068863_1000273916 159
225 3300005843 Ga0068860_100000011 Ga0068860_100000011143 159
226 3300005844 Ga0068862_100000139 Ga0068862_10000013966 159
227 3300005844 Ga0068862_100850848 Ga0068862_1008508482 159
228 3300005937 Ga0081455_10048108 Ga0081455_100481084 159
229 3300005937 Ga0081455_10095990 Ga0081455_100959903 159
230 3300005983 Ga0081540_1063160 Ga0081540_10631602 159
231 3300006038 Ga0075365_10000694 Ga0075365_1000069410 159
232 3300006048 Ga0075363_100002442 Ga0075363_1000024425 159
233 3300006051 Ga0075364_10016218 Ga0075364_100162184 159
234 3300006051 Ga0075364_10123872 Ga0075364_101238722 159
235 3300006173 Ga0070716_100818061 Ga0070716_1008180612 159
236 3300006177 Ga0075362_10020161 Ga0075362_100201613 159
237 3300006178 Ga0075367_10090173 Ga0075367_100901733 159
238 3300006186 Ga0075369_10010160 Ga0075369_100101603 159
239 3300006186 Ga0075369_10205301 Ga0075369_102053012 159
240 3300006931 Ga0097620_100000228 Ga0097620_10000022848 159
241 3300009092 Ga0105250_10034476 Ga0105250_100344762 159
242 3300009092 Ga0105250_10061639 Ga0105250_100616392 159
243 3300009101 Ga0105247_10000067 Ga0105247_1000006770 159
244 3300009174 Ga0105241_10942241 Ga0105241_109422411 159
245 3300009177 Ga0105248_10000040 Ga0105248_10000040103 159
246 3300009177 Ga0105248_10425938 Ga0105248_104259382 159
247 3300009177 Ga0105248_11048738 Ga0105248_110487382 159
248 3300009545 Ga0105237_10979498 Ga0105237_109794982 159
249 3300009553 Ga0105249_10000001 Ga0105249_10000001189 159
250 3300009553 Ga0105249_10025675 Ga0105249_100256756 159
251 3300009553 Ga0105249_10919275 Ga0105249_109192752 159
252 3300013105 Ga0157369_10360718 Ga0157369_103607182 159
253 3300013306 Ga0163162_10066182 Ga0163162_100661824 159
254 3300013306 Ga0163162_10307995 Ga0163162_103079952 159
255 3300014325 Ga0163163_10157183 Ga0163163_101571833 159
256 3300014968 Ga0157379_10066276 Ga0157379_100662762 159
257 3300025900 Ga0207710_10000094 Ga0207710_1000009471 159
258 3300025901 Ga0207688_10160973 Ga0207688_101609732 159
259 3300025923 Ga0207681_10028367 Ga0207681_100283674 159
260 3300025931 Ga0207644_10010272 Ga0207644_100102727 159
261 3300025931 Ga0207644_10014182 Ga0207644_100141823 159
262 3300025939 Ga0207665_10568789 Ga0207665_105687892 159
263 3300025941 Ga0207711_10000126 Ga0207711_1000012643 159
264 3300025961 Ga0207712_10000006 Ga0207712_10000006304 159
265 3300025986 Ga0207658_10000108 Ga0207658_1000010820 159
266 3300025986 Ga0207658_10028606 Ga0207658_100286064 159
267 3300026075 Ga0207708_10386416 Ga0207708_103864162 159
268 3300026088 Ga0207641_10004858 Ga0207641_100048589 159
269 3300026088 Ga0207641_10018642 Ga0207641_100186423 159
270 3300026088 Ga0207641_11951286 Ga0207641_119512861 159
271 3300026095 Ga0207676_10508822 Ga0207676_105088222 159
272 3300026095 Ga0207676_11250944 Ga0207676_112509442 159
273 3300026118 Ga0207675_100425344 Ga0207675_1004253442 159
274 3300028379 Ga0268266_10003769 Ga0268266_1000376915 159
275 3300028379 Ga0268266_10005376 Ga0268266_100053764 159
276 3300028380 Ga0268265_10000032 Ga0268265_10000032216 159
277 3300028381 Ga0268264_10000026 Ga0268264_10000026300 159
278 3300031731 Ga0307405_11029269 Ga0307405_110292692 159
279 3300031852 Ga0307410_10881920 Ga0307410_108819202 159
280 3300041410 Ga0439461_0001053 Ga0439461_0001053_1996_2475 159
281 3300041411 Ga0439466_0006285 Ga0439466_0006285_3207_3686 159
282 3300041411 Ga0439466_0144465 Ga0439466_0144465_171_650 159
283 3300041413 Ga0439465_0017397 Ga0439465_0017397_646_1125 159
284 3300041997 Ga0439431_0000231 Ga0439431_0000231_9926_10405 159
285 3300042002 Ga0439442_012415 Ga0439442_012415_188_667 159
286 3300042004 Ga0439445_0069044 Ga0439445_0069044_13_492 159
287 3300042435 Ga0439434_0025194 Ga0439434_0025194_462_941 159
288 3300042435 Ga0439434_0084049 Ga0439434_0084049_105_584 159
289 3300045976 Ga0466967_0042267 Ga0466967_0042267_2605_3084 159
290 3300046616 Ga0495668_0266264 Ga0495668_0266264_178_657 159
291 3300047320 Ga0495672_0013924 Ga0495672_0013924_4625_5104 159
292 3300047320 Ga0495672_0116847 Ga0495672_0116847_889_1371 159
293 3300047469 Ga0495673_0001061 Ga0495673_0001061_20496_20975 159
294 3300048903 Ga0496100_0181901 Ga0496100_0181901_938_1417 159
295 3300048904 Ga0496101_0003004 Ga0496101_0003004_9446_9943 159
296 3300048904 Ga0496101_1191908 Ga0496101_1191908_67_546 159
297 3300048905 Ga0496102_0013028 Ga0496102_0013028_2004_2483 159
298 3300048905 Ga0496102_0016862 Ga0496102_0016862_2462_2959 159
299 3300048905 Ga0496102_0036031 Ga0496102_0036031_3498_3977 159
300 3300048905 Ga0496102_0040837 Ga0496102_0040837_1900_2409 159
301 3300048905 Ga0496102_0156138 Ga0496102_0156138_1446_1943 159
302 3300048906 Ga0496103_0000238 Ga0496103_0000238_19731_20228 159
303 3300048907 Ga0496104_0002275 Ga0496104_0002275_12669_13148 159
304 3300048907 Ga0496104_0381033 Ga0496104_0381033_706_1212 159
305 3300048908 Ga0496105_0075329 Ga0496105_0075329_1256_1735 159
306 3300048910 Ga0496107_0722137 Ga0496107_0722137_157_636 159
307 3300048911 Ga0496108_0089352 Ga0496108_0089352_45_524 159
308 3300048911 Ga0496108_0096097 Ga0496108_0096097_1296_1775 159
309 3300048915 Ga0496112_0075493 Ga0496112_0075493_1035_1541 159
310 3300048916 Ga0496113_0011555 Ga0496113_0011555_1286_1792 159
311 3300048916 Ga0496113_0306635 Ga0496113_0306635_23_502 159
312 3300048917 Ga0496114_0056543 Ga0496114_0056543_214_711 159
313 3300048919 Ga0496116_0049212 Ga0496116_0049212_46_543 159
314 3300048919 Ga0496116_0332611 Ga0496116_0332611_23_532 159
315 3300048920 Ga0496117_0000904 Ga0496117_0000904_19051_19548 159
316 3300048921 Ga0496118_0001360 Ga0496118_0001360_24324_24821 159
317 3300048922 Ga0496119_0004263 Ga0496119_0004263_10117_10614 159
318 3300048922 Ga0496119_0146059 Ga0496119_0146059_113_592 159
319 3300048923 Ga0496120_0047626 Ga0496120_0047626_49_546 159
320 3300048924 Ga0496121_0002871 Ga0496121_0002871_24326_24823 159
321 3300048927 Ga0496124_0025494 Ga0496124_0025494_3015_3512 159
322 3300048928 Ga0496125_0069855 Ga0496125_0069855_1207_1704 159
323 3300048929 Ga0496126_0156705 Ga0496126_0156705_403_900 159
324 3300049585 Ga0501069_0709299 Ga0501069_0709299_103_582 159
325 3300049742 Ga0501080_0446459 Ga0501080_0446459_280_759 159
326 3300049823 Ga0501044_0864028 Ga0501044_0864028_238_717 159
327 3300050489 nmdc:mga03683_14300_c1 nmdc:mga03683_14300_c1_1217_1696 159
328 3300050489 nmdc:mga03683_54316_c1 nmdc:mga03683_54316_c1_721_1221 159
329 3300050490 nmdc:mga03n38_4001_c1 nmdc:mga03n38_4001_c1_3262_3741 159
330 3300050490 nmdc:mga03n38_8312_c1 nmdc:mga03n38_8312_c1_1246_1737 159
331 3300050491 nmdc:mga00v17_3695_c1 nmdc:mga00v17_3695_c1_2543_3022 159
332 3300050491 nmdc:mga00v17_438228_c1 nmdc:mga00v17_438228_c1_159_668 159
333 3300050491 nmdc:mga00v17_59759_c1 nmdc:mga00v17_59759_c1_25_504 159
334 3300050491 nmdc:mga00v17_91425_c1 nmdc:mga00v17_91425_c1_432_911 159
335 3300050492 nmdc:mga0yw44_632285_c1 nmdc:mga0yw44_632285_c1_168_668 159
336 3300050492 nmdc:mga0yw44_988_c1 nmdc:mga0yw44_988_c1_2731_3210 159
337 3300050496 nmdc:mga07m45_318818_c1 nmdc:mga07m45_318818_c1_135_614 159
338 3300050496 nmdc:mga07m45_9656_c1 nmdc:mga07m45_9656_c1_2540_3049 159
339 3300050516 nmdc:mga0sz30_1043_c2 nmdc:mga0sz30_1043_c2_2184_2663 159
340 3300050516 nmdc:mga0sz30_178607_c1 nmdc:mga0sz30_178607_c1_33_512 159
341 3300050516 nmdc:mga0sz30_30910_c1 nmdc:mga0sz30_30910_c1_380_880 159
342 3300050516 nmdc:mga0sz30_32515_c1 nmdc:mga0sz30_32515_c1_1524_2003 159
343 3300050516 nmdc:mga0sz30_61224_c1 nmdc:mga0sz30_61224_c1_116_625 159
344 3300053090 Ga0500646_0032759 Ga0500646_0032759_613_1110 159
345 3300001990 JGI24737J22298_10028470 JGI24737J22298_100284703 160
346 3300001990 JGI24737J22298_10096655 JGI24737J22298_100966552 160
347 3300001991 JGI24743J22301_10004175 JGI24743J22301_100041753 160
348 3300002070 JGI24750J21931_1008178 JGI24750J21931_10081782 160
349 3300002073 JGI24745J21846_1020926 JGI24745J21846_10209261 160
350 3300002074 JGI24748J21848_1001688 JGI24748J21848_10016882 160
351 3300002075 JGI24738J21930_10075695 JGI24738J21930_100756951 160
352 3300002076 JGI24749J21850_1041713 JGI24749J21850_10417132 160
353 3300002077 JGI24744J21845_10001863 JGI24744J21845_100018635 160
354 3300002239 JGI24034J26672_10003153 JGI24034J26672_100031531 160
355 3300002239 JGI24034J26672_10028988 JGI24034J26672_100289882 160
356 3300002244 JGI24742J22300_10032239 JGI24742J22300_100322392 160
357 3300005327 Ga0070658_11184698 Ga0070658_111846981 160
358 3300005328 Ga0070676_10108836 Ga0070676_101088361 160
359 3300005330 Ga0070690_100070302 Ga0070690_1000703021 160
360 3300005333 Ga0070677_10024995 Ga0070677_100249953 160
361 3300005335 Ga0070666_10059060 Ga0070666_100590603 160
362 3300005336 Ga0070680_100359376 Ga0070680_1003593762 160
363 3300005337 Ga0070682_100020784 Ga0070682_1000207844 160
364 3300005338 Ga0068868_100002447 Ga0068868_10000244710 160
365 3300005338 Ga0068868_100603366 Ga0068868_1006033661 160
366 3300005339 Ga0070660_100407619 Ga0070660_1004076192 160
367 3300005340 Ga0070689_100050890 Ga0070689_1000508901 160
368 3300005340 Ga0070689_100056655 Ga0070689_1000566553 160
369 3300005347 Ga0070668_100002161 Ga0070668_10000216111 160
370 3300005347 Ga0070668_100851224 Ga0070668_1008512241 160
371 3300005354 Ga0070675_100059053 Ga0070675_1000590535 160
372 3300005355 Ga0070671_100093992 Ga0070671_1000939923 160
373 3300005356 Ga0070674_100011743 Ga0070674_1000117435 160
374 3300005356 Ga0070674_100043876 Ga0070674_1000438764 160
375 3300005364 Ga0070673_100476711 Ga0070673_1004767112 160
376 3300005364 Ga0070673_100833987 Ga0070673_1008339872 160
377 3300005365 Ga0070688_100029765 Ga0070688_1000297653 160
378 3300005365 Ga0070688_100291745 Ga0070688_1002917452 160
379 3300005366 Ga0070659_100206977 Ga0070659_1002069773 160
380 3300005367 Ga0070667_100002881 Ga0070667_1000028812 160
381 3300005367 Ga0070667_101167993 Ga0070667_1011679931 160
382 3300005406 Ga0070703_10147350 Ga0070703_101473502 160
383 3300005434 Ga0070709_10135573 Ga0070709_101355733 160
384 3300005434 Ga0070709_11221136 Ga0070709_112211361 160
385 3300005435 Ga0070714_100169808 Ga0070714_1001698081 160
386 3300005435 Ga0070714_100290321 Ga0070714_1002903211 160
387 3300005437 Ga0070710_10000423 Ga0070710_100004236 160
388 3300005437 Ga0070710_10030661 Ga0070710_100306613 160
389 3300005438 Ga0070701_10767381 Ga0070701_107673812 160
390 3300005439 Ga0070711_100007390 Ga0070711_1000073907 160
391 3300005439 Ga0070711_100020770 Ga0070711_1000207702 160
392 3300005440 Ga0070705_100003301 Ga0070705_1000033012 160
393 3300005440 Ga0070705_100511433 Ga0070705_1005114332 160
394 3300005441 Ga0070700_100001071 Ga0070700_10000107115 160
395 3300005441 Ga0070700_100028795 Ga0070700_1000287952 160
396 3300005444 Ga0070694_100220739 Ga0070694_1002207392 160
397 3300005444 Ga0070694_100634186 Ga0070694_1006341862 160
398 3300005445 Ga0070708_101542901 Ga0070708_1015429011 160
399 3300005455 Ga0070663_100002171 Ga0070663_1000021716 160
400 3300005456 Ga0070678_100000075 Ga0070678_10000007517 160
401 3300005456 Ga0070678_100212217 Ga0070678_1002122172 160
402 3300005459 Ga0068867_100002147 Ga0068867_10000214711 160
403 3300005466 Ga0070685_10494033 Ga0070685_104940332 160
404 3300005539 Ga0068853_100002826 Ga0068853_10000282616 160
405 3300005539 Ga0068853_100276079 Ga0068853_1002760793 160
406 3300005543 Ga0070672_101429988 Ga0070672_1014299882 160
407 3300005544 Ga0070686_100475984 Ga0070686_1004759841 160
408 3300005545 Ga0070695_100021602 Ga0070695_1000216022 160
409 3300005546 Ga0070696_100006661 Ga0070696_10000666110 160
410 3300005547 Ga0070693_100003717 Ga0070693_1000037172 160
411 3300005547 Ga0070693_100250061 Ga0070693_1002500612 160
412 3300005548 Ga0070665_100030748 Ga0070665_1000307488 160
413 3300005549 Ga0070704_100000415 Ga0070704_1000004153 160
414 3300005563 Ga0068855_101844032 Ga0068855_1018440321 160
415 3300005578 Ga0068854_100000209 Ga0068854_10000020919 160
416 3300005578 Ga0068854_100075993 Ga0068854_1000759933 160
417 3300005615 Ga0070702_100055497 Ga0070702_1000554971 160
418 3300005616 Ga0068852_100034595 Ga0068852_1000345953 160
419 3300005617 Ga0068859_100006371 Ga0068859_10000637116 160
420 3300005617 Ga0068859_100611201 Ga0068859_1006112012 160
421 3300005617 Ga0068859_100658938 Ga0068859_1006589381 160
422 3300005618 Ga0068864_100184186 Ga0068864_1001841862 160
423 3300005618 Ga0068864_101890061 Ga0068864_1018900611 160
424 3300005718 Ga0068866_10000202 Ga0068866_1000020225 160
425 3300005718 Ga0068866_10049914 Ga0068866_100499143 160
426 3300005718 Ga0068866_10507717 Ga0068866_105077172 160
427 3300005719 Ga0068861_100001529 Ga0068861_1000015299 160
428 3300005841 Ga0068863_100248869 Ga0068863_1002488692 160
429 3300005842 Ga0068858_100059181 Ga0068858_1000591815 160
430 3300005842 Ga0068858_100216359 Ga0068858_1002163591 160
431 3300005842 Ga0068858_100219216 Ga0068858_1002192162 160
432 3300005843 Ga0068860_100001399 Ga0068860_10000139913 160
433 3300005843 Ga0068860_100083428 Ga0068860_1000834283 160
434 3300005843 Ga0068860_100201871 Ga0068860_1002018711 160
435 3300005844 Ga0068862_100009253 Ga0068862_1000092538 160
436 3300005844 Ga0068862_100573992 Ga0068862_1005739921 160
437 3300005981 Ga0081538_10084471 Ga0081538_100844712 160
438 3300006038 Ga0075365_10021166 Ga0075365_100211662 160
439 3300006048 Ga0075363_100009800 Ga0075363_1000098004 160
440 3300006048 Ga0075363_100012710 Ga0075363_1000127102 160
441 3300006048 Ga0075363_100120930 Ga0075363_1001209302 160
442 3300006051 Ga0075364_10019402 Ga0075364_100194025 160
443 3300006051 Ga0075364_10040610 Ga0075364_100406104 160
444 3300006051 Ga0075364_10317768 Ga0075364_103177682 160
445 3300006163 Ga0070715_10007335 Ga0070715_100073356 160
446 3300006163 Ga0070715_10032186 Ga0070715_100321864 160
447 3300006173 Ga0070716_100005247 Ga0070716_1000052473 160
448 3300006175 Ga0070712_100001001 Ga0070712_10000100115 160
449 3300006175 Ga0070712_100011324 Ga0070712_1000113247 160
450 3300006177 Ga0075362_10189766 Ga0075362_101897662 160
451 3300006178 Ga0075367_10006967 Ga0075367_100069677 160
452 3300006178 Ga0075367_10107060 Ga0075367_101070602 160
453 3300006186 Ga0075369_10170206 Ga0075369_101702062 160
454 3300006237 Ga0097621_100244767 Ga0097621_1002447672 160
455 3300006353 Ga0075370_10059823 Ga0075370_100598233 160
456 3300006353 Ga0075370_10138488 Ga0075370_101384882 160
457 3300006358 Ga0068871_100289590 Ga0068871_1002895902 160
458 3300006358 Ga0068871_100311962 Ga0068871_1003119622 160
459 3300006881 Ga0068865_100000661 Ga0068865_10000066124 160
460 3300006881 Ga0068865_100437596 Ga0068865_1004375962 160
461 3300006931 Ga0097620_100006372 Ga0097620_1000063723 160
462 3300006931 Ga0097620_100611226 Ga0097620_1006112262 160
463 3300006931 Ga0097620_100658951 Ga0097620_1006589512 160
464 3300007076 Ga0075435_100708670 Ga0075435_1007086701 160
465 3300009092 Ga0105250_10052083 Ga0105250_100520832 160
466 3300009098 Ga0105245_10127283 Ga0105245_101272834 160
467 3300009101 Ga0105247_10000092 Ga0105247_1000009211 160
468 3300009101 Ga0105247_10080146 Ga0105247_100801461 160
469 3300009148 Ga0105243_10001036 Ga0105243_1000103619 160
470 3300009148 Ga0105243_10105820 Ga0105243_101058202 160
471 3300009148 Ga0105243_11081625 Ga0105243_110816252 160
472 3300009174 Ga0105241_10733918 Ga0105241_107339181 160
473 3300009176 Ga0105242_10000597 Ga0105242_1000059719 160
474 3300009176 Ga0105242_10431904 Ga0105242_104319042 160
475 3300009177 Ga0105248_10005718 Ga0105248_1000571818 160
476 3300009177 Ga0105248_10035423 Ga0105248_100354232 160
477 3300009545 Ga0105237_10157556 Ga0105237_101575562 160
478 3300009553 Ga0105249_10001140 Ga0105249_1000114019 160
479 3300009553 Ga0105249_10298919 Ga0105249_102989193 160
480 3300010375 Ga0105239_10090134 Ga0105239_100901343 160
481 3300011119 Ga0105246_10065212 Ga0105246_100652123 160
482 3300011119 Ga0105246_10974516 Ga0105246_109745162 160
483 3300011119 Ga0105246_11041870 Ga0105246_110418701 160
484 3300013102 Ga0157371_10204796 Ga0157371_102047963 160
485 3300013102 Ga0157371_10585675 Ga0157371_105856751 160
486 3300013296 Ga0157374_10086959 Ga0157374_100869592 160
487 3300013296 Ga0157374_10476467 Ga0157374_104764671 160
488 3300013297 Ga0157378_10002483 Ga0157378_100024836 160
489 3300013297 Ga0157378_10059112 Ga0157378_100591125 160
490 3300013297 Ga0157378_11215818 Ga0157378_112158182 160
491 3300013306 Ga0163162_10018721 Ga0163162_100187212 160
492 3300013306 Ga0163162_10245894 Ga0163162_102458942 160
493 3300013306 Ga0163162_11144724 Ga0163162_111447242 160
494 3300013306 Ga0163162_11316176 Ga0163162_113161762 160
495 3300013307 Ga0157372_10002385 Ga0157372_100023852 160
496 3300013307 Ga0157372_11503556 Ga0157372_115035561 160
497 3300013308 Ga0157375_10000305 Ga0157375_1000030543 160
498 3300013308 Ga0157375_10535596 Ga0157375_105355962 160
499 3300014325 Ga0163163_10224364 Ga0163163_102243642 160
500 3300014326 Ga0157380_10000732 Ga0157380_100007323 160
501 3300014326 Ga0157380_12012175 Ga0157380_120121751 160
502 3300014745 Ga0157377_10094831 Ga0157377_100948312 160
503 3300014968 Ga0157379_10022633 Ga0157379_100226338 160
504 3300014968 Ga0157379_10084885 Ga0157379_100848853 160
505 3300017792 Ga0163161_10004574 Ga0163161_1000457410 160
506 3300017792 Ga0163161_10009223 Ga0163161_100092232 160
507 3300017792 Ga0163161_10265526 Ga0163161_102655262 160
508 3300025294 Ga0209025_1041064 Ga0209025_10410643 160
509 3300025885 Ga0207653_10091115 Ga0207653_100911151 160
510 3300025898 Ga0207692_10002656 Ga0207692_100026563 160
511 3300025899 Ga0207642_10000164 Ga0207642_1000016411 160
512 3300025899 Ga0207642_10464897 Ga0207642_104648972 160
513 3300025900 Ga0207710_10020255 Ga0207710_100202553 160
514 3300025901 Ga0207688_10000096 Ga0207688_1000009615 160
515 3300025901 Ga0207688_10000339 Ga0207688_1000033915 160
516 3300025903 Ga0207680_10048469 Ga0207680_100484693 160
517 3300025903 Ga0207680_11079440 Ga0207680_110794401 160
518 3300025904 Ga0207647_10034535 Ga0207647_100345353 160
519 3300025905 Ga0207685_10010811 Ga0207685_100108114 160
520 3300025905 Ga0207685_10016497 Ga0207685_100164973 160
521 3300025906 Ga0207699_10479287 Ga0207699_104792872 160
522 3300025911 Ga0207654_10527518 Ga0207654_105275182 160
523 3300025914 Ga0207671_10584305 Ga0207671_105843051 160
524 3300025915 Ga0207693_10000634 Ga0207693_1000063414 160
525 3300025915 Ga0207693_10000717 Ga0207693_1000071732 160
526 3300025916 Ga0207663_10036412 Ga0207663_100364123 160
527 3300025917 Ga0207660_10620460 Ga0207660_106204601 160
528 3300025918 Ga0207662_10087424 Ga0207662_100874242 160
529 3300025919 Ga0207657_10243012 Ga0207657_102430122 160
530 3300025923 Ga0207681_10066232 Ga0207681_100662321 160
531 3300025926 Ga0207659_10038839 Ga0207659_100388395 160
532 3300025927 Ga0207687_10001922 Ga0207687_1000192212 160
533 3300025927 Ga0207687_10017942 Ga0207687_100179422 160
534 3300025929 Ga0207664_10605549 Ga0207664_106055492 160
535 3300025929 Ga0207664_11008833 Ga0207664_110088331 160
536 3300025931 Ga0207644_10125771 Ga0207644_101257713 160
537 3300025933 Ga0207706_10023920 Ga0207706_100239205 160
538 3300025934 Ga0207686_10031551 Ga0207686_100315512 160
539 3300025934 Ga0207686_10309401 Ga0207686_103094012 160
540 3300025935 Ga0207709_10015396 Ga0207709_100153966 160
541 3300025935 Ga0207709_10111098 Ga0207709_101110982 160
542 3300025936 Ga0207670_10005154 Ga0207670_100051548 160
543 3300025936 Ga0207670_10494212 Ga0207670_104942121 160
544 3300025937 Ga0207669_10002349 Ga0207669_1000234910 160
545 3300025938 Ga0207704_10175834 Ga0207704_101758342 160
546 3300025939 Ga0207665_10002349 Ga0207665_100023493 160
547 3300025939 Ga0207665_10031991 Ga0207665_100319912 160
548 3300025940 Ga0207691_10074146 Ga0207691_100741463 160
549 3300025941 Ga0207711_10114555 Ga0207711_101145552 160
550 3300025942 Ga0207689_10029503 Ga0207689_100295033 160
551 3300025942 Ga0207689_10330811 Ga0207689_103308112 160
552 3300025949 Ga0207667_10278466 Ga0207667_102784662 160
553 3300025961 Ga0207712_10008843 Ga0207712_100088435 160
554 3300025972 Ga0207668_10004608 Ga0207668_1000460810 160
555 3300025981 Ga0207640_10013966 Ga0207640_100139666 160
556 3300025981 Ga0207640_10265749 Ga0207640_102657491 160
557 3300025986 Ga0207658_10007702 Ga0207658_1000770210 160
558 3300025986 Ga0207658_11074299 Ga0207658_110742992 160
559 3300026023 Ga0207677_10001300 Ga0207677_1000130018 160
560 3300026023 Ga0207677_10057209 Ga0207677_100572092 160
561 3300026035 Ga0207703_10028770 Ga0207703_100287706 160
562 3300026035 Ga0207703_10162284 Ga0207703_101622843 160
563 3300026041 Ga0207639_10019367 Ga0207639_100193675 160
564 3300026041 Ga0207639_10250904 Ga0207639_102509042 160
565 3300026067 Ga0207678_10004438 Ga0207678_100044386 160
566 3300026075 Ga0207708_10068628 Ga0207708_100686283 160
567 3300026075 Ga0207708_10765685 Ga0207708_107656852 160
568 3300026078 Ga0207702_10640121 Ga0207702_106401212 160
569 3300026088 Ga0207641_10409857 Ga0207641_104098573 160
570 3300026089 Ga0207648_10001107 Ga0207648_1000110716 160
571 3300026095 Ga0207676_10160976 Ga0207676_101609763 160
572 3300026118 Ga0207675_100000555 Ga0207675_10000055519 160
573 3300026118 Ga0207675_100016977 Ga0207675_1000169778 160
574 3300026121 Ga0207683_10000795 Ga0207683_1000079523 160
575 3300026142 Ga0207698_10061977 Ga0207698_100619774 160
576 3300026142 Ga0207698_10414057 Ga0207698_104140571 160
577 3300026142 Ga0207698_11152272 Ga0207698_111522721 160
578 3300028379 Ga0268266_10037420 Ga0268266_100374206 160
579 3300028379 Ga0268266_11288999 Ga0268266_112889991 160
580 3300028380 Ga0268265_10005171 Ga0268265_1000517110 160
581 3300028381 Ga0268264_10010060 Ga0268264_1001006010 160
582 3300028381 Ga0268264_10147774 Ga0268264_101477742 160
583 3300031731 Ga0307405_10184464 Ga0307405_101844643 160
584 3300031903 Ga0307407_10102762 Ga0307407_101027623 160
585 3300031995 Ga0307409_100109219 Ga0307409_1001092194 160
586 3300031995 Ga0307409_101707167 Ga0307409_1017071672 160
587 3300032002 Ga0307416_101179957 Ga0307416_1011799572 160
588 3300032002 Ga0307416_102347418 Ga0307416_1023474181 160
589 3300032004 Ga0307414_10141581 Ga0307414_101415813 160
590 3300032005 Ga0307411_10392426 Ga0307411_103924262 160
591 3300032126 Ga0307415_100025121 Ga0307415_1000251214 160
592 3300035112 Ga0373932_0070853 Ga0373932_0070853_32_514 160
593 3300035121 Ga0373960_0031948 Ga0373960_0031948_473_961 160
594 3300035242 Ga0373962_0055165 Ga0373962_0055165_157_639 160
595 3300041410 Ga0439461_0000660 Ga0439461_0000660_1411_1899 160
596 3300041411 Ga0439466_0017969 Ga0439466_0017969_1313_1801 160
597 3300041413 Ga0439465_0013714 Ga0439465_0013714_527_1015 160
598 3300042002 Ga0439442_003399 Ga0439442_003399_419_907 160
599 3300042435 Ga0439434_0059574 Ga0439434_0059574_223_711 160
600 3300044658 Ga0466972_0050787 Ga0466972_0050787_732_1220 160
601 3300044658 Ga0466972_0070800 Ga0466972_0070800_555_1043 160
602 3300044735 Ga0466968_0020056 Ga0466968_0020056_2031_2519 160
603 3300044901 Ga0466960_0102515 Ga0466960_0102515_40_528 160
604 3300045049 Ga0466959_0157436 Ga0466959_0157436_385_873 160
605 3300045836 Ga0466958_0320054 Ga0466958_0320054_90_578 160
606 3300045976 Ga0466967_0569252 Ga0466967_0569252_462_953 160
607 3300046500 Ga0495596_0242398 Ga0495596_0242398_38_526 160
608 3300046538 Ga0495609_0286882 Ga0495609_0286882_126_614 160
609 3300046648 Ga0495611_0247821 Ga0495611_0247821_189_677 160
610 3300046684 Ga0495669_0329596 Ga0495669_0329596_81_569 160
611 3300047323 Ga0495683_0000381 Ga0495683_0000381_5346_5855 160
612 3300048903 Ga0496100_0008547 Ga0496100_0008547_4031_4513 160
613 3300048903 Ga0496100_0022949 Ga0496100_0022949_2694_3188 160
614 3300048904 Ga0496101_0757096 Ga0496101_0757096_94_582 160
615 3300048905 Ga0496102_0001872 Ga0496102_0001872_10563_11045 160
616 3300048905 Ga0496102_0031471 Ga0496102_0031471_4232_4720 160
617 3300048905 Ga0496102_0135691 Ga0496102_0135691_703_1191 160
618 3300048906 Ga0496103_0000277 Ga0496103_0000277_385_867 160
619 3300048907 Ga0496104_0158612 Ga0496104_0158612_970_1464 160
620 3300048908 Ga0496105_0216572 Ga0496105_0216572_120_629 160
621 3300048909 Ga0496106_0000372 Ga0496106_0000372_3494_3976 160
622 3300048909 Ga0496106_0212290 Ga0496106_0212290_987_1481 160
623 3300048909 Ga0496106_0255258 Ga0496106_0255258_496_984 160
624 3300048910 Ga0496107_0001450 Ga0496107_0001450_7643_8125 160
625 3300048910 Ga0496107_0047803 Ga0496107_0047803_476_964 160
626 3300048911 Ga0496108_0075141 Ga0496108_0075141_2098_2586 160
627 3300048912 Ga0496109_0027943 Ga0496109_0027943_2694_3182 160
628 3300048912 Ga0496109_0836677 Ga0496109_0836677_323_817 160
629 3300048913 Ga0496110_0480322 Ga0496110_0480322_48_542 160
630 3300048915 Ga0496112_0075802 Ga0496112_0075802_641_1129 160
631 3300048917 Ga0496114_0003618 Ga0496114_0003618_406_888 160
632 3300048918 Ga0496115_0016385 Ga0496115_0016385_654_1136 160
633 3300048918 Ga0496115_0161955 Ga0496115_0161955_576_1064 160
634 3300049571 Ga0501034_0276823 Ga0501034_0276823_280_828 160
635 3300049581 Ga0501047_0606626 Ga0501047_0606626_165_671 160
636 3300049586 Ga0501070_1125583 Ga0501070_1125583_23_571 160
637 3300050490 nmdc:mga03n38_113533_c1 nmdc:mga03n38_113533_c1_412_900 160
638 3300050490 nmdc:mga03n38_15808_c1 nmdc:mga03n38_15808_c1_840_1349 160
639 3300050490 nmdc:mga03n38_366703_c1 nmdc:mga03n38_366703_c1_180_689 160
640 3300050491 nmdc:mga00v17_10423_c1 nmdc:mga00v17_10423_c1_3166_3654 160
641 3300050491 nmdc:mga00v17_155612_c1 nmdc:mga00v17_155612_c1_88_597 160
642 3300050491 nmdc:mga00v17_54243_c1 nmdc:mga00v17_54243_c1_1439_1948 160
643 3300050491 nmdc:mga00v17_98692_c1 nmdc:mga00v17_98692_c1_201_689 160
644 3300050492 nmdc:mga0yw44_35816_c1 nmdc:mga0yw44_35816_c1_378_911 160
645 3300050492 nmdc:mga0yw44_7865_c2 nmdc:mga0yw44_7865_c2_227_736 160
646 3300050493 nmdc:mga0k408_105819_c2 nmdc:mga0k408_105819_c2_13_546 160
647 3300050494 nmdc:mga06z11_13879_c1 nmdc:mga06z11_13879_c1_695_1228 160
648 3300050496 nmdc:mga07m45_13609_c1 nmdc:mga07m45_13609_c1_3636_4169 160
649 3300050496 nmdc:mga07m45_204846_c1 nmdc:mga07m45_204846_c1_148_636 160
650 3300050496 nmdc:mga07m45_305812_c1 nmdc:mga07m45_305812_c1_204_713 160
651 3300050509 nmdc:mga0qj67_49997_c1 nmdc:mga0qj67_49997_c1_2614_3102 160
652 3300050513 nmdc:mga0rr50_653270_c1 nmdc:mga0rr50_653270_c1_339_833 160
653 3300050516 nmdc:mga0sz30_142591_c1 nmdc:mga0sz30_142591_c1_169_684 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

11

139

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.9898 10 139
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.9749 10 139
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.8687 11 146
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.8613 10 142
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.8461 11 146
ID Description Score Start End Superfamily
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9898 10 139 1.10.940.10
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9749 10 139 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.96 1 139 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9532 1 139 1.10.940.10
af_Q8VYC4_72_208_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8864 54 146 1.10.940.10
ID Description Score Start End GO Terms
AF-X8DQL5-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9994 19 149 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-X8FE46-F1-model_v4 deleted 0.9989 49 155
AF-A0A2R5H5G6-F1-model_v4 deleted 0.9981 19 154
AF-X8ATC2-F1-model_v4 deleted 0.9981 49 156
AF-A0A837ZUH8-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9974 9 149 GO:0003723
GO:0005829
GO:0006353
GO:0031564

Feature Viewer

pLDDT pTM Quality
90.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map