F472697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 486 | 1304 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300044706|Ga0466964_0230648|Ga0466964_0230648_110_688 |
| Length | 186 |
| Sequence | MVGRGYAIFDTAIGRCGIIWSSTGVVAVQLPEAREIDTRRRIFQAHPEAREQQPPLNTELAIEGIVGLLHGSDPDFSDVSLDAGGISAFNRRVYEYTCTILRGETRTYHEIAQALGASAAAIAKNPYMLIVPCHRVLEAGNYAGRISPYGGVISKRRLLSLEGANPVASKTLFEVLLPVAPPRAPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 51 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 52 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 55 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 77 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 78 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 79 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 80 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 150 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 151 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 154 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 161 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 251 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 254 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 261 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 263 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 264 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 265 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 266 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 267 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 268 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 270 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 271 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 272 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 273 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 274 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 275 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 276 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 281 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 284 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 285 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 286 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 287 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 289 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 290 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 291 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 292 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 293 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 295 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 297 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 298 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 299 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 303 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 304 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 305 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 306 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 307 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 308 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 309 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 310 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 311 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 312 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 313 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 314 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 315 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 316 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 317 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 318 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 319 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 320 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 321 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 322 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 323 | 2791355199 | |||
| 324 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 325 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 326 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 327 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 328 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 329 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 330 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 331 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 332 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 333 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 334 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 335 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 336 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 337 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 338 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 339 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 340 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 341 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 342 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 343 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 344 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 345 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 346 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 347 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 348 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 349 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 350 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 351 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 352 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 353 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 354 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 355 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 356 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 357 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 358 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 359 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 360 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 361 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 362 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 363 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 364 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 365 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 366 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 367 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 368 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 369 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 370 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 371 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 372 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 373 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 374 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 375 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 376 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 377 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 378 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 379 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 380 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 381 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 382 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 383 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 384 | 2904699407 | |||
| 385 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 386 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 387 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 388 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 389 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 390 | 2922368715 | |||
| 391 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 392 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 393 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 394 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 395 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 396 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 397 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 398 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 399 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 400 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 401 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 402 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 403 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 404 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 405 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 406 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 407 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 408 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 409 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 410 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 411 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 412 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 413 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 414 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 415 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 416 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 417 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 418 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 419 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 420 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 421 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 422 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 423 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 424 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 425 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 426 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 427 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 428 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 429 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 430 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 431 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 432 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 433 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 434 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 435 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 436 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 437 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 438 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 439 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 440 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 441 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 442 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 443 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 444 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 445 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 446 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 447 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 448 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 449 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 450 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 451 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 452 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 453 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 454 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 455 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 456 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 457 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 458 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 459 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 460 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 461 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 462 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 463 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 464 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 465 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 466 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 467 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 468 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 469 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 470 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 471 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 472 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 473 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 474 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 475 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 476 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 477 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 478 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 479 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 480 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 481 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 482 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 483 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 484 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 485 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 486 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.11 |
| Metatranscriptomes | 0 |
| Isolates | 27.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.25 |
| Nodule | 22.24 |
| Rhizoplane | 6.44 |
| Rhizosphere | 38.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466964_0230648 | 3300044706 | Bacteria | 903 |
| 2 | JGI24739J22299_10061109 | 3300001989 | Bacteria | 1190 |
| 3 | JGI25153J46596_10000657 | 3300003215 | Bacteria | 21147 |
| 4 | JGI25153J46596_10008218 | 3300003215 | Bacteria | 5019 |
| 5 | JGI25160J50197_1000486 | 3300003354 | Bacteria | 23951 |
| 6 | JGI25160J50197_1011041 | 3300003354 | Bacteria | 3228 |
| 7 | JGI25404J52841_10010788 | 3300003659 | Bacteria | 1966 |
| 8 | Ga0055529_1011245 | 3300003763 | Bacteria | 1152 |
| 9 | Ga0055526_1041721 | 3300003771 | Bacteria | 1140 |
| 10 | Ga0055531_10007130 | 3300003794 | Bacteria | 6168 |
| 11 | Ga0055543_1001606 | 3300004625 | Bacteria | 8671 |
| 12 | Ga0065165_1001966 | 3300005262 | Bacteria | 19466 |
| 13 | Ga0065165_1002218 | 3300005262 | Bacteria | 17339 |
| 14 | Ga0065165_1003663 | 3300005262 | Bacteria | 10488 |
| 15 | Ga0070658_10084641 | 3300005327 | Bacteria | 2607 |
| 16 | Ga0068869_100227527 | 3300005334 | Bacteria | 1481 |
| 17 | Ga0070661_100111451 | 3300005344 | Bacteria | 2043 |
| 18 | Ga0070668_100218819 | 3300005347 | Bacteria | 1570 |
| 19 | Ga0070668_100555756 | 3300005347 | Bacteria | 999 |
| 20 | Ga0070668_100585566 | 3300005347 | Bacteria | 974 |
| 21 | Ga0070671_100004121 | 3300005355 | Bacteria | 11476 |
| 22 | Ga0070667_100026636 | 3300005367 | Bacteria | 4809 |
| 23 | Ga0070709_10004180 | 3300005434 | Bacteria | 7779 |
| 24 | Ga0070713_100113086 | 3300005436 | Bacteria | 2370 |
| 25 | Ga0070713_100734824 | 3300005436 | Bacteria | 944 |
| 26 | Ga0070710_10009184 | 3300005437 | Bacteria | 4832 |
| 27 | Ga0070711_100014471 | 3300005439 | Bacteria | 4971 |
| 28 | Ga0070705_100368918 | 3300005440 | Bacteria | 1053 |
| 29 | Ga0070663_100038020 | 3300005455 | Bacteria | 3354 |
| 30 | Ga0070663_100362178 | 3300005455 | Bacteria | 1176 |
| 31 | Ga0070663_100386023 | 3300005455 | Bacteria | 1142 |
| 32 | Ga0068867_100434591 | 3300005459 | Bacteria | 1115 |
| 33 | Ga0068853_100851321 | 3300005539 | Bacteria | 875 |
| 34 | Ga0070693_100496524 | 3300005547 | Bacteria | 865 |
| 35 | Ga0070665_100017815 | 3300005548 | Bacteria | 7130 |
| 36 | Ga0070665_100022309 | 3300005548 | Bacteria | 6370 |
| 37 | Ga0070665_100728661 | 3300005548 | Bacteria | 1005 |
| 38 | Ga0068855_100672005 | 3300005563 | Bacteria | 1111 |
| 39 | Ga0068854_100090384 | 3300005578 | Bacteria | 2277 |
| 40 | Ga0068854_100127219 | 3300005578 | Bacteria | 1942 |
| 41 | Ga0068856_100048537 | 3300005614 | Bacteria | 4184 |
| 42 | Ga0068856_100052457 | 3300005614 | Bacteria | 4021 |
| 43 | Ga0068856_100693422 | 3300005614 | Bacteria | 1039 |
| 44 | Ga0070702_100776896 | 3300005615 | Bacteria | 738 |
| 45 | Ga0068852_100371243 | 3300005616 | Bacteria | 1402 |
| 46 | Ga0068861_100276824 | 3300005719 | Bacteria | 1443 |
| 47 | Ga0068863_100191464 | 3300005841 | Bacteria | 1966 |
| 48 | Ga0068860_100000629 | 3300005843 | Bacteria | 41623 |
| 49 | Ga0068860_100447230 | 3300005843 | Bacteria | 1284 |
| 50 | Ga0068860_100798628 | 3300005843 | Bacteria | 957 |
| 51 | Ga0081455_10004380 | 3300005937 | Bacteria | 15903 |
| 52 | Ga0081455_10050729 | 3300005937 | Bacteria | 3565 |
| 53 | Ga0081455_10558131 | 3300005937 | Bacteria | 756 |
| 54 | Ga0081540_1000663 | 3300005983 | Bacteria | 32432 |
| 55 | Ga0081540_1004994 | 3300005983 | Bacteria | 9970 |
| 56 | Ga0081540_1007119 | 3300005983 | Bacteria | 8028 |
| 57 | Ga0081540_1013959 | 3300005983 | Bacteria | 5184 |
| 58 | Ga0081540_1071851 | 3300005983 | Bacteria | 1597 |
| 59 | Ga0081540_1107190 | 3300005983 | Bacteria | 1190 |
| 60 | Ga0081539_10000902 | 3300005985 | Bacteria | 56412 |
| 61 | Ga0081539_10175551 | 3300005985 | Bacteria | 1009 |
| 62 | Ga0070717_10069825 | 3300006028 | Bacteria | 2926 |
| 63 | Ga0070717_10131974 | 3300006028 | Bacteria | 2149 |
| 64 | Ga0075365_10026761 | 3300006038 | Bacteria | 3665 |
| 65 | Ga0075365_10050580 | 3300006038 | Bacteria | 2741 |
| 66 | Ga0075365_10094603 | 3300006038 | Bacteria | 2040 |
| 67 | Ga0075365_10110631 | 3300006038 | Bacteria | 1887 |
| 68 | Ga0075368_10010204 | 3300006042 | Bacteria | 3392 |
| 69 | Ga0075368_10085351 | 3300006042 | Bacteria | 1288 |
| 70 | Ga0075363_100021973 | 3300006048 | Bacteria | 3221 |
| 71 | Ga0075364_10017052 | 3300006051 | Bacteria | 4529 |
| 72 | Ga0070716_100086700 | 3300006173 | Bacteria | 1884 |
| 73 | Ga0070716_100264992 | 3300006173 | Bacteria | 1178 |
| 74 | Ga0070712_100043114 | 3300006175 | Bacteria | 3105 |
| 75 | Ga0070712_100470241 | 3300006175 | Bacteria | 1050 |
| 76 | Ga0075362_10065181 | 3300006177 | Bacteria | 1654 |
| 77 | Ga0075367_10103597 | 3300006178 | Bacteria | 1741 |
| 78 | Ga0075366_10021518 | 3300006195 | Bacteria | 3749 |
| 79 | Ga0075366_10026379 | 3300006195 | Bacteria | 3403 |
| 80 | Ga0097621_100788621 | 3300006237 | Bacteria | 880 |
| 81 | Ga0075370_10027768 | 3300006353 | Bacteria | 3143 |
| 82 | Ga0075370_10035051 | 3300006353 | Bacteria | 2815 |
| 83 | Ga0099825_1032747 | 3300006941 | Bacteria | 2079 |
| 84 | Ga0099824_1008958 | 3300006942 | Bacteria | 12537 |
| 85 | Ga0099822_1044570 | 3300006943 | Bacteria | 2184 |
| 86 | Ga0075435_100095471 | 3300007076 | Bacteria | 2459 |
| 87 | Ga0099794_10035878 | 3300007265 | Bacteria | 2341 |
| 88 | Ga0099794_10083057 | 3300007265 | Bacteria | 1582 |
| 89 | Ga0099795_10062898 | 3300007788 | Bacteria | 1382 |
| 90 | Ga0105240_10002869 | 3300009093 | Bacteria | 27260 |
| 91 | Ga0105240_10564534 | 3300009093 | Bacteria | 1257 |
| 92 | Ga0105245_10065023 | 3300009098 | Bacteria | 3298 |
| 93 | Ga0105245_10067476 | 3300009098 | Bacteria | 3240 |
| 94 | Ga0105247_10016547 | 3300009101 | Bacteria | 4421 |
| 95 | Ga0105247_10134514 | 3300009101 | Bacteria | 1614 |
| 96 | Ga0105247_10331234 | 3300009101 | Bacteria | 1065 |
| 97 | Ga0105237_10050966 | 3300009545 | Bacteria | 4159 |
| 98 | Ga0105237_10374174 | 3300009545 | Bacteria | 1429 |
| 99 | Ga0105238_10474298 | 3300009551 | Bacteria | 1250 |
| 100 | Ga0105238_10979855 | 3300009551 | Bacteria | 866 |
| 101 | Ga0099796_10026446 | 3300010159 | Bacteria | 1843 |
| 102 | Ga0099796_10037369 | 3300010159 | Bacteria | 1623 |
| 103 | Ga0105239_10045796 | 3300010375 | Bacteria | 4793 |
| 104 | Ga0105239_10144971 | 3300010375 | Bacteria | 2648 |
| 105 | Ga0105239_10154204 | 3300010375 | Bacteria | 2565 |
| 106 | Ga0105239_10324211 | 3300010375 | Bacteria | 1737 |
| 107 | Ga0105239_11271064 | 3300010375 | Bacteria | 849 |
| 108 | Ga0105246_10173968 | 3300011119 | Bacteria | 1651 |
| 109 | Ga0157370_10315636 | 3300013104 | Bacteria | 1442 |
| 110 | Ga0157374_10525156 | 3300013296 | Bacteria | 1190 |
| 111 | Ga0157378_10149421 | 3300013297 | Bacteria | 2176 |
| 112 | Ga0163162_10092320 | 3300013306 | Bacteria | 3111 |
| 113 | Ga0157372_10653081 | 3300013307 | Bacteria | 1225 |
| 114 | Ga0157375_10463026 | 3300013308 | Bacteria | 1433 |
| 115 | Ga0163163_10408481 | 3300014325 | Bacteria | 1416 |
| 116 | Ga0182008_10205307 | 3300014497 | Bacteria | 1004 |
| 117 | Ga0157379_10107462 | 3300014968 | Bacteria | 2505 |
| 118 | Ga0157376_10638863 | 3300014969 | Bacteria | 1063 |
| 119 | Ga0182006_1124811 | 3300015261 | Bacteria | 891 |
| 120 | Ga0163161_10515133 | 3300017792 | Bacteria | 976 |
| 121 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 122 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 123 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 124 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 125 | Ga0213873_10006963 | 3300021358 | Bacteria | 2246 |
| 126 | Ga0213876_10001113 | 3300021384 | Bacteria | 17196 |
| 127 | Ga0209563_102406 | 3300025230 | Bacteria | 4246 |
| 128 | Ga0209677_105081 | 3300025253 | Bacteria | 3554 |
| 129 | Ga0209148_1000904 | 3300025254 | Bacteria | 20182 |
| 130 | Ga0209233_1002498 | 3300025261 | Bacteria | 6743 |
| 131 | Ga0209455_1014906 | 3300025272 | Bacteria | 1734 |
| 132 | Ga0209564_1002641 | 3300025295 | Bacteria | 13692 |
| 133 | Ga0209564_1046056 | 3300025295 | Bacteria | 1115 |
| 134 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 135 | Ga0209758_1000389 | 3300025297 | Bacteria | 75919 |
| 136 | Ga0209758_1000716 | 3300025297 | Bacteria | 48984 |
| 137 | Ga0209758_1001131 | 3300025297 | Bacteria | 34274 |
| 138 | Ga0209758_1042364 | 3300025297 | Bacteria | 1689 |
| 139 | Ga0209256_1005691 | 3300025299 | Bacteria | 7003 |
| 140 | Ga0207426_1000380 | 3300025302 | Bacteria | 76046 |
| 141 | Ga0207426_1000832 | 3300025302 | Bacteria | 32765 |
| 142 | Ga0207426_1015195 | 3300025302 | Bacteria | 2798 |
| 143 | Ga0207426_1063987 | 3300025302 | Bacteria | 1047 |
| 144 | Ga0209257_1001378 | 3300025304 | Bacteria | 29161 |
| 145 | Ga0209257_1036344 | 3300025304 | Bacteria | 1514 |
| 146 | Ga0207697_10203874 | 3300025315 | Bacteria | 870 |
| 147 | Ga0207656_10186644 | 3300025321 | Bacteria | 997 |
| 148 | Ga0207692_10006034 | 3300025898 | Bacteria | 4898 |
| 149 | Ga0207710_10215574 | 3300025900 | Bacteria | 952 |
| 150 | Ga0207688_10129808 | 3300025901 | Bacteria | 1477 |
| 151 | Ga0207647_10005598 | 3300025904 | Bacteria | 9180 |
| 152 | Ga0207699_10422839 | 3300025906 | Bacteria | 952 |
| 153 | Ga0207699_10565457 | 3300025906 | Bacteria | 826 |
| 154 | Ga0207654_10104411 | 3300025911 | Bacteria | 1752 |
| 155 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 156 | Ga0207671_10002455 | 3300025914 | Bacteria | 19836 |
| 157 | Ga0207671_10035782 | 3300025914 | Bacteria | 3682 |
| 158 | Ga0207671_10079524 | 3300025914 | Bacteria | 2457 |
| 159 | Ga0207693_10044808 | 3300025915 | Bacteria | 3476 |
| 160 | Ga0207657_10082129 | 3300025919 | Bacteria | 2705 |
| 161 | Ga0207649_10114842 | 3300025920 | Bacteria | 1805 |
| 162 | Ga0207681_10461574 | 3300025923 | Bacteria | 1035 |
| 163 | Ga0207694_10451721 | 3300025924 | Bacteria | 1073 |
| 164 | Ga0207694_10451864 | 3300025924 | Bacteria | 1073 |
| 165 | Ga0207664_10015510 | 3300025929 | Bacteria | 5533 |
| 166 | Ga0207644_10100932 | 3300025931 | Bacteria | 2168 |
| 167 | Ga0207706_10143394 | 3300025933 | Bacteria | 2102 |
| 168 | Ga0207665_10040737 | 3300025939 | Bacteria | 3101 |
| 169 | Ga0207665_10244568 | 3300025939 | Bacteria | 1323 |
| 170 | Ga0207711_10623192 | 3300025941 | Bacteria | 1006 |
| 171 | Ga0207679_10826353 | 3300025945 | Bacteria | 845 |
| 172 | Ga0207667_10539826 | 3300025949 | Bacteria | 1180 |
| 173 | Ga0207668_10151617 | 3300025972 | Bacteria | 1795 |
| 174 | Ga0207668_10557387 | 3300025972 | Bacteria | 993 |
| 175 | Ga0207639_10716202 | 3300026041 | Bacteria | 929 |
| 176 | Ga0207678_10170318 | 3300026067 | Bacteria | 1859 |
| 177 | Ga0207678_10202236 | 3300026067 | Bacteria | 1699 |
| 178 | Ga0207678_10243868 | 3300026067 | Bacteria | 1539 |
| 179 | Ga0207678_10652403 | 3300026067 | Bacteria | 925 |
| 180 | Ga0207702_10442942 | 3300026078 | Bacteria | 1259 |
| 181 | Ga0207648_10154934 | 3300026089 | Bacteria | 2022 |
| 182 | Ga0207676_10282909 | 3300026095 | Bacteria | 1507 |
| 183 | Ga0207674_10461271 | 3300026116 | Bacteria | 1228 |
| 184 | Ga0207683_10428525 | 3300026121 | Bacteria | 1219 |
| 185 | Ga0207698_11054859 | 3300026142 | Bacteria | 824 |
| 186 | Ga0209389_1000168 | 3300027296 | Bacteria | 52990 |
| 187 | Ga0209389_1000180 | 3300027296 | Bacteria | 49331 |
| 188 | Ga0209589_1000570 | 3300027357 | Bacteria | 52985 |
| 189 | Ga0209489_101190 | 3300027361 | Bacteria | 52985 |
| 190 | Ga0209489_101411 | 3300027361 | Bacteria | 49331 |
| 191 | Ga0209700_101443 | 3300027363 | Bacteria | 49345 |
| 192 | Ga0209813_10008452 | 3300027866 | Bacteria | 2602 |
| 193 | Ga0268266_10026711 | 3300028379 | Bacteria | 4912 |
| 194 | Ga0268266_10596114 | 3300028379 | Bacteria | 1061 |
| 195 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 196 | Ga0268264_10584991 | 3300028381 | Bacteria | 1099 |
| 197 | Ga0265332_10004766 | 3300031238 | Bacteria | 6323 |
| 198 | Ga0307509_10015871 | 3300031507 | Bacteria | 8751 |
| 199 | Ga0307509_10196584 | 3300031507 | Bacteria | 1859 |
| 200 | Ga0307516_10324669 | 3300031730 | Bacteria | 1209 |
| 201 | Ga0307516_10375323 | 3300031730 | Bacteria | 1084 |
| 202 | Ga0307510_10003428 | 3300033180 | Bacteria | 18490 |
| 203 | Ga0307510_10231821 | 3300033180 | Bacteria | 1348 |
| 204 | Ga0373923_0328128 | 3300035111 | Bacteria | 728 |
| 205 | Ga0373943_0204990 | 3300035170 | Bacteria | 1093 |
| 206 | Ga0373935_0051160 | 3300035692 | Bacteria | 2623 |
| 207 | Ga0373927_0070829 | 3300035695 | Bacteria | 2256 |
| 208 | Ga0373927_0131819 | 3300035695 | Bacteria | 1633 |
| 209 | Ga0373947_0360184 | 3300035725 | Bacteria | 977 |
| 210 | Ga0373937_0047523 | 3300036401 | Bacteria | 3927 |
| 211 | Ga0373925_0260509 | 3300037068 | Bacteria | 1393 |
| 212 | Ga0373925_0322514 | 3300037068 | Bacteria | 1250 |
| 213 | Ga0395899_0019135 | 3300037312 | Bacteria | 5204 |
| 214 | Ga0395900_0000937 | 3300037418 | Bacteria | 38218 |
| 215 | Ga0395898_0005127 | 3300037466 | Bacteria | 14184 |
| 216 | Ga0395905_0003588 | 3300037471 | Bacteria | 16513 |
| 217 | Ga0395901_0006000 | 3300038443 | Bacteria | 12306 |
| 218 | Ga0436365_0133064 | 3300039437 | Bacteria | 19710 |
| 219 | Ga0436365_1032974 | 3300039437 | Bacteria | 2023 |
| 220 | Ga0436360_0419422 | 3300039438 | Bacteria | 2289 |
| 221 | Ga0436361_0326411 | 3300039447 | Bacteria | 4688 |
| 222 | Ga0436363_0595544 | 3300039450 | Bacteria | 2881 |
| 223 | Ga0436363_1633359 | 3300039450 | Bacteria | 1098 |
| 224 | Ga0436362_0549978 | 3300039453 | Bacteria | 2914 |
| 225 | Ga0451791_1361674 | 3300041451 | Bacteria | 867 |
| 226 | Ga0451800_0306270 | 3300041459 | Bacteria | 825 |
| 227 | Ga0451833_0295131 | 3300041491 | Bacteria | 1337 |
| 228 | Ga0451843_0212572 | 3300041509 | Bacteria | 1402 |
| 229 | Ga0466972_0000171 | 3300044658 | Bacteria | 50915 |
| 230 | Ga0466972_0025991 | 3300044658 | Bacteria | 2899 |
| 231 | Ga0466972_0108509 | 3300044658 | Bacteria | 1312 |
| 232 | Ga0466965_0055440 | 3300044683 | Bacteria | 1973 |
| 233 | Ga0466966_0000287 | 3300044684 | Bacteria | 33106 |
| 234 | Ga0466961_0000126 | 3300044693 | Bacteria | 51032 |
| 235 | Ga0466961_0105953 | 3300044693 | Bacteria | 1770 |
| 236 | Ga0466963_0097828 | 3300044694 | Bacteria | 2005 |
| 237 | Ga0466968_0208542 | 3300044735 | Bacteria | 917 |
| 238 | Ga0466970_0015519 | 3300044765 | Bacteria | 3919 |
| 239 | Ga0466959_0020395 | 3300045049 | Bacteria | 4882 |
| 240 | Ga0466967_0733372 | 3300045976 | Bacteria | 979 |
| 241 | Ga0495592_0024033 | 3300046454 | Bacteria | 4635 |
| 242 | Ga0495592_0364976 | 3300046454 | Bacteria | 922 |
| 243 | Ga0495603_0168766 | 3300046455 | Bacteria | 1268 |
| 244 | Ga0495629_0010820 | 3300046459 | Bacteria | 6636 |
| 245 | Ga0495638_0095236 | 3300046460 | Bacteria | 1788 |
| 246 | Ga0495641_0148770 | 3300046461 | Bacteria | 1046 |
| 247 | Ga0495651_0031577 | 3300046462 | Bacteria | 4130 |
| 248 | Ga0495651_0041817 | 3300046462 | Bacteria | 3560 |
| 249 | Ga0495653_0066422 | 3300046463 | Bacteria | 2713 |
| 250 | Ga0495605_0135676 | 3300046474 | Bacteria | 1107 |
| 251 | Ga0495605_0151406 | 3300046474 | Bacteria | 1035 |
| 252 | Ga0495639_0067292 | 3300046475 | Bacteria | 1650 |
| 253 | Ga0495664_0036240 | 3300046477 | Bacteria | 2907 |
| 254 | Ga0495585_0130992 | 3300046492 | Bacteria | 1320 |
| 255 | Ga0495594_0277634 | 3300046499 | Bacteria | 955 |
| 256 | Ga0495607_0247209 | 3300046501 | Bacteria | 860 |
| 257 | Ga0495606_0049462 | 3300046507 | Bacteria | 2756 |
| 258 | Ga0495606_0068647 | 3300046507 | Bacteria | 2242 |
| 259 | Ga0495606_0207221 | 3300046507 | Bacteria | 1113 |
| 260 | Ga0495606_0474323 | 3300046507 | Bacteria | 636 |
| 261 | Ga0495608_0314315 | 3300046511 | Bacteria | 968 |
| 262 | Ga0495610_0160537 | 3300046512 | Bacteria | 951 |
| 263 | Ga0495616_0010409 | 3300046513 | Bacteria | 5384 |
| 264 | Ga0495620_0102345 | 3300046515 | Bacteria | 1141 |
| 265 | Ga0495620_0109483 | 3300046515 | Bacteria | 1096 |
| 266 | Ga0495620_0134591 | 3300046515 | Bacteria | 969 |
| 267 | Ga0495628_0010621 | 3300046516 | Bacteria | 7810 |
| 268 | Ga0495630_0253406 | 3300046517 | Bacteria | 1345 |
| 269 | Ga0495632_0076674 | 3300046519 | Bacteria | 1599 |
| 270 | Ga0495643_0010141 | 3300046522 | Bacteria | 5810 |
| 271 | Ga0495648_0003301 | 3300046524 | Bacteria | 14240 |
| 272 | Ga0495648_0117813 | 3300046524 | Bacteria | 1433 |
| 273 | Ga0495652_0005571 | 3300046529 | Bacteria | 11837 |
| 274 | Ga0495652_0137668 | 3300046529 | Bacteria | 1924 |
| 275 | Ga0495587_0236605 | 3300046536 | Bacteria | 1028 |
| 276 | Ga0495609_0170711 | 3300046538 | Bacteria | 919 |
| 277 | Ga0495645_0482064 | 3300046543 | Bacteria | 778 |
| 278 | Ga0495622_0005984 | 3300046557 | Bacteria | 5651 |
| 279 | Ga0495622_0016782 | 3300046557 | Bacteria | 3410 |
| 280 | Ga0495667_0157052 | 3300046559 | Bacteria | 1463 |
| 281 | Ga0495668_0365471 | 3300046616 | Bacteria | 792 |
| 282 | Ga0495625_0073571 | 3300046660 | Bacteria | 2395 |
| 283 | Ga0495625_0221949 | 3300046660 | Bacteria | 1238 |
| 284 | Ga0495625_0301860 | 3300046660 | Bacteria | 1024 |
| 285 | Ga0495635_0001988 | 3300046663 | Bacteria | 13902 |
| 286 | Ga0495635_0018225 | 3300046663 | Bacteria | 4901 |
| 287 | Ga0495588_0100757 | 3300046674 | Bacteria | 1518 |
| 288 | Ga0495657_0017362 | 3300046675 | Bacteria | 5226 |
| 289 | Ga0495599_0041186 | 3300046678 | Bacteria | 2901 |
| 290 | Ga0495623_0106486 | 3300046679 | Bacteria | 1703 |
| 291 | Ga0495646_0026395 | 3300046680 | Bacteria | 3648 |
| 292 | Ga0495658_0518551 | 3300046683 | Bacteria | 763 |
| 293 | Ga0495669_0109322 | 3300046684 | Bacteria | 1290 |
| 294 | Ga0495613_0241957 | 3300046689 | Bacteria | 1261 |
| 295 | Ga0495624_0170330 | 3300046690 | Bacteria | 1328 |
| 296 | Ga0495671_0070841 | 3300046692 | Bacteria | 1713 |
| 297 | Ga0495671_0148262 | 3300046692 | Bacteria | 1142 |
| 298 | Ga0495671_0231291 | 3300046692 | Bacteria | 894 |
| 299 | Ga0495649_0091849 | 3300046694 | Bacteria | 1617 |
| 300 | Ga0495600_0001145 | 3300046809 | Bacteria | 14497 |
| 301 | Ga0495660_0098537 | 3300046810 | Bacteria | 1508 |
| 302 | Ga0495660_0110295 | 3300046810 | Bacteria | 1405 |
| 303 | Ga0495581_0137863 | 3300047315 | Bacteria | 1422 |
| 304 | Ga0495604_0022471 | 3300047317 | Bacteria | 5036 |
| 305 | Ga0495604_0029345 | 3300047317 | Bacteria | 4375 |
| 306 | Ga0495604_0408763 | 3300047317 | Bacteria | 893 |
| 307 | Ga0495674_0042610 | 3300047319 | Bacteria | 4047 |
| 308 | Ga0495676_0259534 | 3300047321 | Bacteria | 1182 |
| 309 | Ga0495680_0009328 | 3300047322 | Bacteria | 8839 |
| 310 | Ga0495687_006948 | 3300047443 | Bacteria | 6806 |
| 311 | Ga0495675_0027465 | 3300047444 | Bacteria | 3626 |
| 312 | Ga0495673_0043853 | 3300047469 | Bacteria | 1999 |
| 313 | Ga0495686_0024882 | 3300047472 | Bacteria | 3929 |
| 314 | Ga0495593_0071414 | 3300047673 | Bacteria | 1803 |
| 315 | Ga0495602_0028430 | 3300048088 | Bacteria | 5350 |
| 316 | Ga0495602_0151389 | 3300048088 | Bacteria | 1823 |
| 317 | Ga0495614_0187920 | 3300048089 | Bacteria | 931 |
| 318 | Ga0495626_0266408 | 3300048091 | Bacteria | 684 |
| 319 | Ga0496100_0059143 | 3300048903 | Bacteria | 2517 |
| 320 | Ga0496101_0001519 | 3300048904 | Bacteria | 13894 |
| 321 | Ga0496101_0094810 | 3300048904 | Bacteria | 2225 |
| 322 | Ga0496101_0304376 | 3300048904 | Bacteria | 1249 |
| 323 | Ga0496102_0427070 | 3300048905 | Bacteria | 1244 |
| 324 | Ga0496103_0019895 | 3300048906 | Bacteria | 4031 |
| 325 | Ga0496104_0024654 | 3300048907 | Bacteria | 5534 |
| 326 | Ga0496104_0071829 | 3300048907 | Bacteria | 3290 |
| 327 | Ga0496104_0102941 | 3300048907 | Bacteria | 2735 |
| 328 | Ga0496104_0291670 | 3300048907 | Bacteria | 1544 |
| 329 | Ga0496105_0009241 | 3300048908 | Bacteria | 7699 |
| 330 | Ga0496105_0257413 | 3300048908 | Bacteria | 1412 |
| 331 | Ga0496105_0335743 | 3300048908 | Bacteria | 1209 |
| 332 | Ga0496105_0609759 | 3300048908 | Bacteria | 846 |
| 333 | Ga0496106_0000545 | 3300048909 | Bacteria | 26754 |
| 334 | Ga0496106_0158634 | 3300048909 | Bacteria | 1788 |
| 335 | Ga0496106_0502751 | 3300048909 | Bacteria | 974 |
| 336 | Ga0496106_0589859 | 3300048909 | Bacteria | 890 |
| 337 | Ga0496107_0150201 | 3300048910 | Bacteria | 1723 |
| 338 | Ga0496108_0010875 | 3300048911 | Bacteria | 7388 |
| 339 | Ga0496108_1017281 | 3300048911 | Bacteria | 707 |
| 340 | Ga0496109_0456884 | 3300048912 | Bacteria | 1206 |
| 341 | Ga0496109_0501768 | 3300048912 | Bacteria | 1145 |
| 342 | Ga0496110_0071333 | 3300048913 | Bacteria | 3080 |
| 343 | Ga0496110_0171737 | 3300048913 | Bacteria | 1967 |
| 344 | Ga0496110_0205414 | 3300048913 | Bacteria | 1790 |
| 345 | Ga0496110_1034604 | 3300048913 | Bacteria | 729 |
| 346 | Ga0496111_0391097 | 3300048914 | Bacteria | 1028 |
| 347 | Ga0496112_0088979 | 3300048915 | Bacteria | 3055 |
| 348 | Ga0496112_0090981 | 3300048915 | Bacteria | 3020 |
| 349 | Ga0496112_0353313 | 3300048915 | Bacteria | 1412 |
| 350 | Ga0496113_0088941 | 3300048916 | Bacteria | 2376 |
| 351 | Ga0496113_0194605 | 3300048916 | Bacteria | 1610 |
| 352 | Ga0496113_0316158 | 3300048916 | Bacteria | 1251 |
| 353 | Ga0496113_0513931 | 3300048916 | Bacteria | 961 |
| 354 | Ga0496114_0079333 | 3300048917 | Bacteria | 2771 |
| 355 | Ga0496114_0602441 | 3300048917 | Bacteria | 969 |
| 356 | Ga0496115_0210180 | 3300048918 | Bacteria | 1607 |
| 357 | Ga0496115_0784811 | 3300048918 | Bacteria | 742 |
| 358 | Ga0496116_0123308 | 3300048919 | Bacteria | 1494 |
| 359 | Ga0496117_0017937 | 3300048920 | Bacteria | 5893 |
| 360 | Ga0496118_0004149 | 3300048921 | Bacteria | 17505 |
| 361 | Ga0496118_0049821 | 3300048921 | Bacteria | 3221 |
| 362 | Ga0496118_0264042 | 3300048921 | Bacteria | 969 |
| 363 | Ga0496118_0274510 | 3300048921 | Bacteria | 942 |
| 364 | Ga0496119_0007759 | 3300048922 | Bacteria | 9571 |
| 365 | Ga0496119_0023177 | 3300048922 | Bacteria | 4416 |
| 366 | Ga0496119_0260778 | 3300048922 | Bacteria | 870 |
| 367 | Ga0496120_0009651 | 3300048923 | Bacteria | 6815 |
| 368 | Ga0496120_0030191 | 3300048923 | Bacteria | 3299 |
| 369 | Ga0496120_0278227 | 3300048923 | Bacteria | 775 |
| 370 | Ga0496121_0000261 | 3300048924 | Bacteria | 110085 |
| 371 | Ga0496121_0004585 | 3300048924 | Bacteria | 18424 |
| 372 | Ga0496121_0120510 | 3300048924 | Bacteria | 1982 |
| 373 | Ga0496121_0142685 | 3300048924 | Bacteria | 1774 |
| 374 | Ga0496121_0233871 | 3300048924 | Bacteria | 1285 |
| 375 | Ga0496122_0143658 | 3300048925 | Bacteria | 1488 |
| 376 | Ga0496122_0300528 | 3300048925 | Bacteria | 866 |
| 377 | Ga0496124_0001094 | 3300048927 | Bacteria | 42597 |
| 378 | Ga0496124_0035884 | 3300048927 | Bacteria | 4333 |
| 379 | Ga0496124_0438729 | 3300048927 | Bacteria | 894 |
| 380 | Ga0496125_0028406 | 3300048928 | Bacteria | 5053 |
| 381 | Ga0496125_0101626 | 3300048928 | Bacteria | 2115 |
| 382 | Ga0496125_0222084 | 3300048928 | Bacteria | 1216 |
| 383 | Ga0496125_0419732 | 3300048928 | Bacteria | 776 |
| 384 | Ga0496126_0004026 | 3300048929 | Bacteria | 17896 |
| 385 | Ga0496126_0154307 | 3300048929 | Bacteria | 1966 |
| 386 | Ga0496126_0283224 | 3300048929 | Bacteria | 1372 |
| 387 | Ga0496126_0459231 | 3300048929 | Bacteria | 1024 |
| 388 | Ga0496126_0737352 | 3300048929 | Bacteria | 762 |
| 389 | Ga0495682_0146456 | 3300049460 | Bacteria | 843 |
| 390 | nmdc:mga03683_284201_c1 | 3300050489 | Bacteria | 773 |
| 391 | nmdc:mga03683_63010_c1 | 3300050489 | Bacteria | 1571 |
| 392 | nmdc:mga03n38_393712_c1 | 3300050490 | Bacteria | 761 |
| 393 | nmdc:mga03n38_9437_c1 | 3300050490 | Bacteria | 3551 |
| 394 | nmdc:mga00v17_179111_c1 | 3300050491 | Bacteria | 1367 |
| 395 | nmdc:mga0yw44_201102_c1 | 3300050492 | Bacteria | 1316 |
| 396 | nmdc:mga0yw44_44090_c1 | 3300050492 | Bacteria | 2667 |
| 397 | nmdc:mga0yw44_64847_c1 | 3300050492 | Bacteria | 2249 |
| 398 | nmdc:mga0yw44_66436_c1 | 3300050492 | Bacteria | 2225 |
| 399 | nmdc:mga0yw44_8432_c1 | 3300050492 | Bacteria | 5135 |
| 400 | nmdc:mga0k408_276159_c1 | 3300050493 | Bacteria | 1003 |
| 401 | nmdc:mga06z11_6622_c2 | 3300050494 | Bacteria | 3605 |
| 402 | nmdc:mga04h51_9256_c1 | 3300050495 | Bacteria | 2663 |
| 403 | nmdc:mga07m45_116596_c1 | 3300050496 | Bacteria | 1541 |
| 404 | nmdc:mga07m45_16366_c1 | 3300050496 | Bacteria | 3971 |
| 405 | nmdc:mga0rr50_981987_c1 | 3300050513 | Bacteria | 720 |
| 406 | nmdc:mga0sz30_206739_c1 | 3300050516 | Bacteria | 872 |
| 407 | nmdc:mga0sz30_48517_c1 | 3300050516 | Bacteria | 1797 |
| 408 | Ga0495601_0234686 | 3300053077 | Bacteria | 1198 |
| 409 | Ga0495601_0536162 | 3300053077 | Bacteria | 754 |
| 410 | Ga0500610_0170005 | 3300053079 | Bacteria | 1077 |
| 411 | Ga0500610_0290346 | 3300053079 | Bacteria | 728 |
| 412 | Ga0495655_0037757 | 3300053083 | Bacteria | 1215 |
| 413 | Ga0500578_0319789 | 3300053086 | Bacteria | 915 |
| 414 | Ga0500643_000091 | 3300053087 | Bacteria | 93825 |
| 415 | Ga0500647_0034570 | 3300053091 | Bacteria | 2413 |
| 416 | Ga0500647_0203675 | 3300053091 | Bacteria | 896 |
| 417 | Ga0500651_0022862 | 3300053093 | Bacteria | 3909 |
| 418 | Ga0500651_0127184 | 3300053093 | Bacteria | 1543 |
| 419 | Ga0500566_0000565 | 3300053094 | Bacteria | 20802 |
| 420 | Ga0500566_0075053 | 3300053094 | Bacteria | 1892 |
| 421 | Ga0500640_090846 | 3300053095 | Bacteria | 1279 |
| 422 | Ga0500641_0032316 | 3300053096 | Bacteria | 2070 |
| 423 | Ga0500648_119203 | 3300053097 | Bacteria | 1447 |
| 424 | Ga0500650_0201557 | 3300053098 | Bacteria | 906 |
| 425 | Ga0500555_005028 | 3300053103 | Bacteria | 3751 |
| 426 | Ga0500556_0236085 | 3300053104 | Bacteria | 720 |
| 427 | Ga0500557_000028 | 3300053105 | Bacteria | 78414 |
| 428 | Ga0500562_041566 | 3300053108 | Bacteria | 1222 |
| 429 | Ga0500569_012994 | 3300053109 | Bacteria | 2027 |
| 430 | Ga0500572_008141 | 3300053111 | Bacteria | 2443 |
| 431 | Ga0500594_0051869 | 3300053118 | Bacteria | 1158 |
| 432 | Ga0500594_0084302 | 3300053118 | Bacteria | 955 |
| 433 | Ga0500595_001045 | 3300053119 | Bacteria | 15421 |
| 434 | Ga0500595_012288 | 3300053119 | Bacteria | 3317 |
| 435 | Ga0500595_016234 | 3300053119 | Bacteria | 2778 |
| 436 | Ga0500595_079016 | 3300053119 | Bacteria | 965 |
| 437 | Ga0500642_0000189 | 3300053130 | Bacteria | 25159 |
| 438 | Ga0500642_0002517 | 3300053130 | Bacteria | 5395 |
| 439 | Ga0500642_0022875 | 3300053130 | Bacteria | 2501 |
| 440 | Ga0500655_063340 | 3300053133 | Bacteria | 747 |
| 441 | Ga0500658_0224538 | 3300053134 | Bacteria | 861 |
| 442 | Ga0500559_0001773 | 3300053136 | Bacteria | 11840 |
| 443 | Ga0500559_0083692 | 3300053136 | Bacteria | 1453 |
| 444 | Ga0500559_0413380 | 3300053136 | Bacteria | 626 |
| 445 | Ga0500568_0045356 | 3300053139 | Bacteria | 1750 |
| 446 | Ga0500573_0094932 | 3300053140 | Bacteria | 1681 |
| 447 | Ga0500588_0115296 | 3300053146 | Bacteria | 942 |
| 448 | Ga0500590_124709 | 3300053148 | Bacteria | 1201 |
| 449 | Ga0500616_0268741 | 3300053153 | Bacteria | 721 |
| 450 | Ga0500619_055087 | 3300053154 | Bacteria | 1296 |
| 451 | Ga0500620_010308 | 3300053155 | Bacteria | 2453 |
| 452 | Ga0500622_0138093 | 3300053156 | Bacteria | 1165 |
| 453 | Ga0500622_0226451 | 3300053156 | Bacteria | 835 |
| 454 | Ga0500624_031299 | 3300053157 | Bacteria | 916 |
| 455 | Ga0500639_073533 | 3300053163 | Bacteria | 1736 |
| 456 | Ga0500636_0000246 | 3300053177 | Bacteria | 29834 |
| 457 | Ga0500636_0081311 | 3300053177 | Bacteria | 1866 |
| 458 | Ga0500637_0077321 | 3300053178 | Bacteria | 1920 |
| 459 | Ga0500637_0081529 | 3300053178 | Bacteria | 1868 |
| 460 | Ga0500649_059375 | 3300053722 | Bacteria | 1597 |
| 461 | Ga0500625_010179 | 3300053729 | Bacteria | 4218 |
| 462 | Ga0500552_013201 | 3300053733 | Bacteria | 1069 |
| 463 | Ga0500596_004897 | 3300053735 | Bacteria | 2412 |
| 464 | Ga0500596_013622 | 3300053735 | Bacteria | 1227 |
| 465 | Ga0500599_003473 | 3300053736 | Bacteria | 1922 |
| 466 | Ga0500601_000069 | 3300053737 | Bacteria | 21313 |
| 467 | Ga0501084_0854206 | 3300054114 | Bacteria | 766 |
| 468 | Ga0500661_025636 | 3300055283 | Bacteria | 1043 |
| 469 | 2507504746 | 2507262055 | Bacteria | 8048963 |
| 470 | 2508546098 | 2508501009 | Bacteria | 7784016 |
| 471 | 2508695032 | 2508501042 | Bacteria | 8719808 |
| 472 | 2511397008 | 2511231028 | Bacteria | 8046582 |
| 473 | 2513626676 | 2513237092 | Bacteria | 8341956 |
| 474 | 2513641811 | 2513237094 | Bacteria | 8789602 |
| 475 | 2513648068 | 2513237095 | Bacteria | 8976980 |
| 476 | 2513715594 | 2513237104 | Bacteria | 10034502 |
| 477 | 2513875715 | 2513237139 | Bacteria | 8737671 |
| 478 | 2514016381 | 2513237161 | Bacteria | 8871253 |
| 479 | 2515625965 | 2515154112 | Bacteria | 8294334 |
| 480 | 2517106965 | 2517093001 | Bacteria | 9002274 |
| 481 | 2524435637 | 2524023205 | Bacteria | 8918781 |
| 482 | 2528850290 | 2528768022 | Bacteria | 10457665 |
| 483 | 2617352946 | 2617270735 | Bacteria | 9163226 |
| 484 | 2617374234 | 2617270741 | Bacteria | 8201522 |
| 485 | 2671119389 | 2667528175 | Bacteria | 7532676 |
| 486 | 2745079904 | 2744054633 | Bacteria | 8678936 |
| 487 | 2793063206 | 2791355196 | Bacteria | 7323613 |
| 488 | 2793073473 | 2791355197 | Bacteria | 8420563 |
| 489 | 2793083723 | |||
| 490 | 2805919391 | 2802429603 | Bacteria | 8777136 |
| 491 | 2818237173 | 2816332527 | Bacteria | 8933356 |
| 492 | 2824608676 | 2824600985 | Bacteria | 8488197 |
| 493 | 2824612753 | 2824609381 | Bacteria | 8672835 |
| 494 | 2824626364 | 2824617872 | Bacteria | 8814715 |
| 495 | 2824632491 | 2824626560 | Bacteria | 8813858 |
| 496 | 2824643643 | 2824635225 | Bacteria | 8785348 |
| 497 | 2824652529 | 2824644064 | Bacteria | 8743947 |
| 498 | 2824659004 | 2824653114 | Bacteria | 8493680 |
| 499 | 2824663557 | 2824661429 | Bacteria | 9877870 |
| 500 | 2824677889 | 2824671348 | Bacteria | 8369588 |
| 501 | 2824687171 | 2824679649 | Bacteria | 8248951 |
| 502 | 2824694609 | 2824687955 | Bacteria | 8360029 |
| 503 | 2824702775 | 2824696289 | Bacteria | 8335049 |
| 504 | 2824713205 | 2824704595 | Bacteria | 9667483 |
| 505 | 2824723307 | 2824714736 | Bacteria | 8717648 |
| 506 | 2824732466 | 2824723954 | Bacteria | 8758240 |
| 507 | 2824736939 | 2824732956 | Bacteria | 7810675 |
| 508 | 2824748231 | 2824746037 | Bacteria | 7911610 |
| 509 | 2824760630 | 2824753945 | Bacteria | 9787441 |
| 510 | 2824772021 | 2824763712 | Bacteria | 9792355 |
| 511 | 2824779868 | 2824773399 | Bacteria | 8360218 |
| 512 | 2838129445 | 2838122688 | Bacteria | 8803140 |
| 513 | 2841944346 | 2841941048 | Bacteria | 8688029 |
| 514 | 2841954477 | 2841949485 | Bacteria | 8680857 |
| 515 | 2841965993 | 2841957949 | Bacteria | 8652217 |
| 516 | 2841969123 | 2841966195 | Bacteria | 8673214 |
| 517 | 2841979897 | 2841974524 | Bacteria | 8931498 |
| 518 | 2841990922 | 2841983080 | Bacteria | 8395090 |
| 519 | 2842043995 | 2842038055 | Bacteria | 8002051 |
| 520 | 2842052016 | 2842045827 | Bacteria | 8006841 |
| 521 | 2844321723 | 2844315083 | Bacteria | 8138177 |
| 522 | 2847939689 | 2847930680 | Bacteria | 9342022 |
| 523 | 2847941642 | 2847939898 | Bacteria | 8606328 |
| 524 | 2849082565 | 2849076700 | Bacteria | 7039503 |
| 525 | 2857511461 | 2857509624 | Bacteria | 7472071 |
| 526 | 2874594297 | 2874590934 | Bacteria | 8299676 |
| 527 | 2874615555 | 2874612657 | Bacteria | 8252029 |
| 528 | 2874624322 | 2874620515 | Bacteria | 8290088 |
| 529 | 2874634083 | 2874628541 | Bacteria | 8630250 |
| 530 | 2874647723 | 2874645413 | Bacteria | 8214782 |
| 531 | 2876770072 | 2876761206 | Bacteria | 10111113 |
| 532 | 2876772605 | 2876771140 | Bacteria | 8287509 |
| 533 | 2876819866 | 2876818435 | Bacteria | 8274608 |
| 534 | 2879076372 | 2879074833 | Bacteria | 8279565 |
| 535 | 2879090508 | 2879083081 | Bacteria | 8587928 |
| 536 | 2879101848 | 2879099564 | Bacteria | 10442239 |
| 537 | 2879130673 | 2879127579 | Bacteria | 8294491 |
| 538 | 2879143145 | 2879142872 | Bacteria | 8267021 |
| 539 | 2881364988 | 2881364244 | Bacteria | 7710352 |
| 540 | 2881673621 | 2881665667 | Bacteria | 8175609 |
| 541 | 2885368106 | 2885366525 | Bacteria | 8326213 |
| 542 | 2885380001 | 2885374607 | Bacteria | 8927485 |
| 543 | 2888380076 | 2888378607 | Bacteria | 9652610 |
| 544 | 2888391135 | 2888388044 | Bacteria | 7304136 |
| 545 | 2888420880 | 2888419890 | Bacteria | 7857137 |
| 546 | 2889034954 | 2889033259 | Bacteria | 9099371 |
| 547 | 2903727731 | 2903727486 | Bacteria | 8281579 |
| 548 | 2903755935 | 2903748898 | Bacteria | 9972761 |
| 549 | 2904672339 | 2904666416 | Bacteria | 8226587 |
| 550 | 2904710056 | |||
| 551 | 2904717925 | 2904711408 | Bacteria | 9771557 |
| 552 | 2906602783 | 2906602504 | Bacteria | 8295279 |
| 553 | 2906632412 | 2906626472 | Bacteria | 8826946 |
| 554 | 2908746677 | 2908739725 | Bacteria | 8628932 |
| 555 | 2908776709 | 2908775508 | Bacteria | 8092255 |
| 556 | 2922378458 | |||
| 557 | 2922400254 | 2922393267 | Bacteria | 8285685 |
| 558 | 2929622441 | 2929615660 | Bacteria | 9193770 |
| 559 | 2929631342 | 2929624759 | Bacteria | 9339455 |
| 560 | 2932786241 | 2932784394 | Bacteria | 9704911 |
| 561 | 2932794783 | 2932794094 | Bacteria | 7915132 |
| 562 | 2932805407 | 2932801729 | Bacteria | 7987968 |
| 563 | 2932812685 | 2932809354 | Bacteria | 9135765 |
| 564 | 2932823047 | 2932818245 | Bacteria | 9955613 |
| 565 | 2932829479 | 2932828146 | Bacteria | 9745859 |
| 566 | 2933584479 | 2933577622 | Bacteria | 9116884 |
| 567 | 2935615056 | 2935608549 | Bacteria | 8203142 |
| 568 | 2935617997 | 2935616580 | Bacteria | 9032984 |
| 569 | 2935641605 | 2935638405 | Bacteria | 10015038 |
| 570 | 2935651592 | 2935648319 | Bacteria | 8801166 |
| 571 | 2935659640 | 2935656913 | Bacteria | 8965014 |
| 572 | 2935669337 | 2935665750 | Bacteria | 9571747 |
| 573 | 2935678067 | 2935675223 | Bacteria | 9928132 |
| 574 | 2935693614 | 2935684952 | Bacteria | 9590419 |
| 575 | 2935701696 | 2935694250 | Bacteria | 9291695 |
| 576 | 2935707160 | 2935703347 | Bacteria | 10242284 |
| 577 | 2935717003 | 2935713505 | Bacteria | 9608509 |
| 578 | 2935730163 | 2935722832 | Bacteria | 9608746 |
| 579 | 2935738417 | 2935732158 | Bacteria | 9706831 |
| 580 | 2935750205 | 2935741537 | Bacteria | 9707219 |
| 581 | 2935759799 | 2935750917 | Bacteria | 9590372 |
| 582 | 2935764550 | 2935760218 | Bacteria | 9817913 |
| 583 | 2935772872 | 2935769743 | Bacteria | 7878163 |
| 584 | 2935777989 | 2935777560 | Bacteria | 8077691 |
| 585 | 2935787219 | 2935785616 | Bacteria | 7962367 |
| 586 | 2935795993 | 2935793552 | Bacteria | 8012592 |
| 587 | 2935804459 | 2935801545 | Bacteria | 9301974 |
| 588 | 2935817320 | 2935810662 | Bacteria | 9401221 |
| 589 | 2935825906 | 2935819856 | Bacteria | 8261050 |
| 590 | 2935831336 | 2935827899 | Bacteria | 10038562 |
| 591 | 2935841945 | 2935837841 | Bacteria | 9454360 |
| 592 | 2935851525 | 2935847175 | Bacteria | 8228321 |
| 593 | 2935856504 | 2935855204 | Bacteria | 9035059 |
| 594 | 2935870954 | 2935864058 | Bacteria | 9784707 |
| 595 | 2935874470 | 2935873716 | Bacteria | 9632195 |
| 596 | 2935887511 | 2935883170 | Bacteria | 7964738 |
| 597 | 2935910454 | 2935908558 | Bacteria | 8568796 |
| 598 | 2935918252 | 2935916978 | Bacteria | 9113783 |
| 599 | 2935927635 | 2935926038 | Bacteria | 8601059 |
| 600 | 2935936493 | 2935934488 | Bacteria | 8602579 |
| 601 | 2935943954 | 2935942939 | Bacteria | 8599779 |
| 602 | 2935952391 | 2935951376 | Bacteria | 8602333 |
| 603 | 2935964248 | 2935959822 | Bacteria | 7869783 |
| 604 | 2935969231 | 2935967501 | Bacteria | 8603075 |
| 605 | 2935978008 | 2935975950 | Bacteria | 8347125 |
| 606 | 2935984692 | 2935984226 | Bacteria | 8302647 |
| 607 | 2935993931 | 2935992306 | Bacteria | 9802711 |
| 608 | 2936005058 | 2936002035 | Bacteria | 9362176 |
| 609 | 2936014056 | 2936011229 | Bacteria | 8801034 |
| 610 | 2936023035 | 2936019824 | Bacteria | 8804134 |
| 611 | 2936031171 | 2936028420 | Bacteria | 8965941 |
| 612 | 2936044117 | 2936037263 | Bacteria | 9446081 |
| 613 | 2936049293 | 2936046547 | Bacteria | 8903709 |
| 614 | 2936055862 | 2936055302 | Bacteria | 8785755 |
| 615 | 2940565747 | 2940556831 | Bacteria | 9590747 |
| 616 | 2941532256 | 2941531003 | Bacteria | 7653939 |
| 617 | 2941544018 | 2941538514 | Bacteria | 9402094 |
| 618 | 3005475696 | 3005474847 | Bacteria | 9259049 |
| 619 | 3005490985 | 3005483717 | Bacteria | 7877331 |
| 620 | 3005509649 | 3005506211 | Bacteria | 6943378 |
| 621 | 3005594254 | 3005587118 | Bacteria | 7794411 |
| 622 | 3005602072 | 3005594810 | Bacteria | 8716512 |
| 623 | 3005717826 | 3005710791 | Bacteria | 7622528 |
| 624 | 3005724858 | 3005718088 | Bacteria | 8283608 |
| 625 | 8006930754 | 8006926726 | Bacteria | 6749210 |
| 626 | 8016518754 | 8016511872 | Bacteria | 9921665 |
| 627 | 8016526707 | 8016522445 | Bacteria | 8156687 |
| 628 | 8016531791 | 8016530956 | Bacteria | 8155261 |
| 629 | 8016557076 | 8016548790 | Bacteria | 8155074 |
| 630 | 8016582642 | 8016575299 | Bacteria | 8154085 |
| 631 | 8016585826 | 8016583857 | Bacteria | 10421953 |
| 632 | 8016603063 | 8016595262 | Bacteria | 8149947 |
| 633 | 8016605965 | 8016603502 | Bacteria | 8731218 |
| 634 | 8016617850 | 8016613128 | Bacteria | 8794220 |
| 635 | 8016623721 | 8016622563 | Bacteria | 7999408 |
| 636 | 8016636190 | 8016630954 | Bacteria | 9217207 |
| 637 | 8017057923 | 8017057580 | Bacteria | 10023680 |
| 638 | 8019539913 | 8019538911 | Bacteria | 7872763 |
| 639 | 8019550740 | 8019547302 | Bacteria | 7996444 |
| 640 | 8019577801 | 8019576017 | Bacteria | 10049540 |
| 641 | 8019595902 | 8019586578 | Bacteria | 10212056 |
| 642 | 8019605853 | 8019597564 | Bacteria | 10041141 |
| 643 | 8019612680 | 8019608314 | Bacteria | 10042931 |
| 644 | 8019622439 | 8019619141 | Bacteria | 9218857 |
| 645 | 8019639942 | 8019638758 | Bacteria | 9062356 |
| 646 | 8019651966 | 8019648815 | Bacteria | 10014479 |
| 647 | 8019667499 | 8019659431 | Bacteria | 8577854 |
| 648 | 8019677271 | 8019668869 | Bacteria | 8791617 |
| 649 | 8019678711 | 8019678201 | Bacteria | 8863603 |
| 650 | 8019696805 | 8019687851 | Bacteria | 8712826 |
| 651 | 8055750892 | 8055742211 | Bacteria | 9226248 |
| 652 | 8056975576 | 8056967851 | Bacteria | 9038162 |
| 653 | Ga0466964_0230648 | |||
| 654 | JGI24739J22299_10061109 | |||
| 655 | JGI25153J46596_10000657 | |||
| 656 | JGI25153J46596_10008218 | |||
| 657 | JGI25160J50197_1000486 | |||
| 658 | JGI25160J50197_1011041 | |||
| 659 | JGI25404J52841_10010788 | |||
| 660 | Ga0055529_1011245 | |||
| 661 | Ga0055526_1041721 | |||
| 662 | Ga0055531_10007130 | |||
| 663 | Ga0055543_1001606 | |||
| 664 | Ga0065165_1001966 | |||
| 665 | Ga0065165_1002218 | |||
| 666 | Ga0065165_1003663 | |||
| 667 | Ga0070658_10084641 | |||
| 668 | Ga0068869_100227527 | |||
| 669 | Ga0070661_100111451 | |||
| 670 | Ga0070668_100218819 | |||
| 671 | Ga0070668_100555756 | |||
| 672 | Ga0070668_100585566 | |||
| 673 | Ga0070671_100004121 | |||
| 674 | Ga0070667_100026636 | |||
| 675 | Ga0070709_10004180 | |||
| 676 | Ga0070713_100113086 | |||
| 677 | Ga0070713_100734824 | |||
| 678 | Ga0070710_10009184 | |||
| 679 | Ga0070711_100014471 | |||
| 680 | Ga0070705_100368918 | |||
| 681 | Ga0070663_100038020 | |||
| 682 | Ga0070663_100362178 | |||
| 683 | Ga0070663_100386023 | |||
| 684 | Ga0068867_100434591 | |||
| 685 | Ga0068853_100851321 | |||
| 686 | Ga0070693_100496524 | |||
| 687 | Ga0070665_100017815 | |||
| 688 | Ga0070665_100022309 | |||
| 689 | Ga0070665_100728661 | |||
| 690 | Ga0068855_100672005 | |||
| 691 | Ga0068854_100090384 | |||
| 692 | Ga0068854_100127219 | |||
| 693 | Ga0068856_100048537 | |||
| 694 | Ga0068856_100052457 | |||
| 695 | Ga0068856_100693422 | |||
| 696 | Ga0070702_100776896 | |||
| 697 | Ga0068852_100371243 | |||
| 698 | Ga0068861_100276824 | |||
| 699 | Ga0068863_100191464 | |||
| 700 | Ga0068860_100000629 | |||
| 701 | Ga0068860_100447230 | |||
| 702 | Ga0068860_100798628 | |||
| 703 | Ga0081455_10004380 | |||
| 704 | Ga0081455_10050729 | |||
| 705 | Ga0081455_10558131 | |||
| 706 | Ga0081540_1000663 | |||
| 707 | Ga0081540_1004994 | |||
| 708 | Ga0081540_1007119 | |||
| 709 | Ga0081540_1013959 | |||
| 710 | Ga0081540_1071851 | |||
| 711 | Ga0081540_1107190 | |||
| 712 | Ga0081539_10000902 | |||
| 713 | Ga0081539_10175551 | |||
| 714 | Ga0070717_10069825 | |||
| 715 | Ga0070717_10131974 | |||
| 716 | Ga0075365_10026761 | |||
| 717 | Ga0075365_10050580 | |||
| 718 | Ga0075365_10094603 | |||
| 719 | Ga0075365_10110631 | |||
| 720 | Ga0075368_10010204 | |||
| 721 | Ga0075368_10085351 | |||
| 722 | Ga0075363_100021973 | |||
| 723 | Ga0075364_10017052 | |||
| 724 | Ga0070716_100086700 | |||
| 725 | Ga0070716_100264992 | |||
| 726 | Ga0070712_100043114 | |||
| 727 | Ga0070712_100470241 | |||
| 728 | Ga0075362_10065181 | |||
| 729 | Ga0075367_10103597 | |||
| 730 | Ga0075366_10021518 | |||
| 731 | Ga0075366_10026379 | |||
| 732 | Ga0097621_100788621 | |||
| 733 | Ga0075370_10027768 | |||
| 734 | Ga0075370_10035051 | |||
| 735 | Ga0099825_1032747 | |||
| 736 | Ga0099824_1008958 | |||
| 737 | Ga0099822_1044570 | |||
| 738 | Ga0075435_100095471 | |||
| 739 | Ga0099794_10035878 | |||
| 740 | Ga0099794_10083057 | |||
| 741 | Ga0099795_10062898 | |||
| 742 | Ga0105240_10002869 | |||
| 743 | Ga0105240_10564534 | |||
| 744 | Ga0105245_10065023 | |||
| 745 | Ga0105245_10067476 | |||
| 746 | Ga0105247_10016547 | |||
| 747 | Ga0105247_10134514 | |||
| 748 | Ga0105247_10331234 | |||
| 749 | Ga0105237_10050966 | |||
| 750 | Ga0105237_10374174 | |||
| 751 | Ga0105238_10474298 | |||
| 752 | Ga0105238_10979855 | |||
| 753 | Ga0099796_10026446 | |||
| 754 | Ga0099796_10037369 | |||
| 755 | Ga0105239_10045796 | |||
| 756 | Ga0105239_10144971 | |||
| 757 | Ga0105239_10154204 | |||
| 758 | Ga0105239_10324211 | |||
| 759 | Ga0105239_11271064 | |||
| 760 | Ga0105246_10173968 | |||
| 761 | Ga0157370_10315636 | |||
| 762 | Ga0157374_10525156 | |||
| 763 | Ga0157378_10149421 | |||
| 764 | Ga0163162_10092320 | |||
| 765 | Ga0157372_10653081 | |||
| 766 | Ga0157375_10463026 | |||
| 767 | Ga0163163_10408481 | |||
| 768 | Ga0182008_10205307 | |||
| 769 | Ga0157379_10107462 | |||
| 770 | Ga0157376_10638863 | |||
| 771 | Ga0182006_1124811 | |||
| 772 | Ga0163161_10515133 | |||
| 773 | Ga0214544_1000003 | |||
| 774 | Ga0214542_1000003 | |||
| 775 | Ga0214545_1000004 | |||
| 776 | Ga0214543_1000007 | |||
| 777 | Ga0213873_10006963 | |||
| 778 | Ga0213876_10001113 | |||
| 779 | Ga0209563_102406 | |||
| 780 | Ga0209677_105081 | |||
| 781 | Ga0209148_1000904 | |||
| 782 | Ga0209233_1002498 | |||
| 783 | Ga0209455_1014906 | |||
| 784 | Ga0209564_1002641 | |||
| 785 | Ga0209564_1046056 | |||
| 786 | Ga0209758_1000015 | |||
| 787 | Ga0209758_1000389 | |||
| 788 | Ga0209758_1000716 | |||
| 789 | Ga0209758_1001131 | |||
| 790 | Ga0209758_1042364 | |||
| 791 | Ga0209256_1005691 | |||
| 792 | Ga0207426_1000380 | |||
| 793 | Ga0207426_1000832 | |||
| 794 | Ga0207426_1015195 | |||
| 795 | Ga0207426_1063987 | |||
| 796 | Ga0209257_1001378 | |||
| 797 | Ga0209257_1036344 | |||
| 798 | Ga0207697_10203874 | |||
| 799 | Ga0207656_10186644 | |||
| 800 | Ga0207692_10006034 | |||
| 801 | Ga0207710_10215574 | |||
| 802 | Ga0207688_10129808 | |||
| 803 | Ga0207647_10005598 | |||
| 804 | Ga0207699_10422839 | |||
| 805 | Ga0207699_10565457 | |||
| 806 | Ga0207654_10104411 | |||
| 807 | Ga0207695_10000065 | |||
| 808 | Ga0207671_10002455 | |||
| 809 | Ga0207671_10035782 | |||
| 810 | Ga0207671_10079524 | |||
| 811 | Ga0207693_10044808 | |||
| 812 | Ga0207657_10082129 | |||
| 813 | Ga0207649_10114842 | |||
| 814 | Ga0207681_10461574 | |||
| 815 | Ga0207694_10451721 | |||
| 816 | Ga0207694_10451864 | |||
| 817 | Ga0207664_10015510 | |||
| 818 | Ga0207644_10100932 | |||
| 819 | Ga0207706_10143394 | |||
| 820 | Ga0207665_10040737 | |||
| 821 | Ga0207665_10244568 | |||
| 822 | Ga0207711_10623192 | |||
| 823 | Ga0207679_10826353 | |||
| 824 | Ga0207667_10539826 | |||
| 825 | Ga0207668_10151617 | |||
| 826 | Ga0207668_10557387 | |||
| 827 | Ga0207639_10716202 | |||
| 828 | Ga0207678_10170318 | |||
| 829 | Ga0207678_10202236 | |||
| 830 | Ga0207678_10243868 | |||
| 831 | Ga0207678_10652403 | |||
| 832 | Ga0207702_10442942 | |||
| 833 | Ga0207648_10154934 | |||
| 834 | Ga0207676_10282909 | |||
| 835 | Ga0207674_10461271 | |||
| 836 | Ga0207683_10428525 | |||
| 837 | Ga0207698_11054859 | |||
| 838 | Ga0209389_1000168 | |||
| 839 | Ga0209389_1000180 | |||
| 840 | Ga0209589_1000570 | |||
| 841 | Ga0209489_101190 | |||
| 842 | Ga0209489_101411 | |||
| 843 | Ga0209700_101443 | |||
| 844 | Ga0209813_10008452 | |||
| 845 | Ga0268266_10026711 | |||
| 846 | Ga0268266_10596114 | |||
| 847 | Ga0268264_10000049 | |||
| 848 | Ga0268264_10584991 | |||
| 849 | Ga0265332_10004766 | |||
| 850 | Ga0307509_10015871 | |||
| 851 | Ga0307509_10196584 | |||
| 852 | Ga0307516_10324669 | |||
| 853 | Ga0307516_10375323 | |||
| 854 | Ga0307510_10003428 | |||
| 855 | Ga0307510_10231821 | |||
| 856 | Ga0373923_0328128 | |||
| 857 | Ga0373943_0204990 | |||
| 858 | Ga0373935_0051160 | |||
| 859 | Ga0373927_0070829 | |||
| 860 | Ga0373927_0131819 | |||
| 861 | Ga0373947_0360184 | |||
| 862 | Ga0373937_0047523 | |||
| 863 | Ga0373925_0260509 | |||
| 864 | Ga0373925_0322514 | |||
| 865 | Ga0395899_0019135 | |||
| 866 | Ga0395900_0000937 | |||
| 867 | Ga0395898_0005127 | |||
| 868 | Ga0395905_0003588 | |||
| 869 | Ga0395901_0006000 | |||
| 870 | Ga0436365_0133064 | |||
| 871 | Ga0436365_1032974 | |||
| 872 | Ga0436360_0419422 | |||
| 873 | Ga0436361_0326411 | |||
| 874 | Ga0436363_0595544 | |||
| 875 | Ga0436363_1633359 | |||
| 876 | Ga0436362_0549978 | |||
| 877 | Ga0451791_1361674 | |||
| 878 | Ga0451800_0306270 | |||
| 879 | Ga0451833_0295131 | |||
| 880 | Ga0451843_0212572 | |||
| 881 | Ga0466972_0000171 | |||
| 882 | Ga0466972_0025991 | |||
| 883 | Ga0466972_0108509 | |||
| 884 | Ga0466965_0055440 | |||
| 885 | Ga0466966_0000287 | |||
| 886 | Ga0466961_0000126 | |||
| 887 | Ga0466961_0105953 | |||
| 888 | Ga0466963_0097828 | |||
| 889 | Ga0466968_0208542 | |||
| 890 | Ga0466970_0015519 | |||
| 891 | Ga0466959_0020395 | |||
| 892 | Ga0466967_0733372 | |||
| 893 | Ga0495592_0024033 | |||
| 894 | Ga0495592_0364976 | |||
| 895 | Ga0495603_0168766 | |||
| 896 | Ga0495629_0010820 | |||
| 897 | Ga0495638_0095236 | |||
| 898 | Ga0495641_0148770 | |||
| 899 | Ga0495651_0031577 | |||
| 900 | Ga0495651_0041817 | |||
| 901 | Ga0495653_0066422 | |||
| 902 | Ga0495605_0135676 | |||
| 903 | Ga0495605_0151406 | |||
| 904 | Ga0495639_0067292 | |||
| 905 | Ga0495664_0036240 | |||
| 906 | Ga0495585_0130992 | |||
| 907 | Ga0495594_0277634 | |||
| 908 | Ga0495607_0247209 | |||
| 909 | Ga0495606_0049462 | |||
| 910 | Ga0495606_0068647 | |||
| 911 | Ga0495606_0207221 | |||
| 912 | Ga0495606_0474323 | |||
| 913 | Ga0495608_0314315 | |||
| 914 | Ga0495610_0160537 | |||
| 915 | Ga0495616_0010409 | |||
| 916 | Ga0495620_0102345 | |||
| 917 | Ga0495620_0109483 | |||
| 918 | Ga0495620_0134591 | |||
| 919 | Ga0495628_0010621 | |||
| 920 | Ga0495630_0253406 | |||
| 921 | Ga0495632_0076674 | |||
| 922 | Ga0495643_0010141 | |||
| 923 | Ga0495648_0003301 | |||
| 924 | Ga0495648_0117813 | |||
| 925 | Ga0495652_0005571 | |||
| 926 | Ga0495652_0137668 | |||
| 927 | Ga0495587_0236605 | |||
| 928 | Ga0495609_0170711 | |||
| 929 | Ga0495645_0482064 | |||
| 930 | Ga0495622_0005984 | |||
| 931 | Ga0495622_0016782 | |||
| 932 | Ga0495667_0157052 | |||
| 933 | Ga0495668_0365471 | |||
| 934 | Ga0495625_0073571 | |||
| 935 | Ga0495625_0221949 | |||
| 936 | Ga0495625_0301860 | |||
| 937 | Ga0495635_0001988 | |||
| 938 | Ga0495635_0018225 | |||
| 939 | Ga0495588_0100757 | |||
| 940 | Ga0495657_0017362 | |||
| 941 | Ga0495599_0041186 | |||
| 942 | Ga0495623_0106486 | |||
| 943 | Ga0495646_0026395 | |||
| 944 | Ga0495658_0518551 | |||
| 945 | Ga0495669_0109322 | |||
| 946 | Ga0495613_0241957 | |||
| 947 | Ga0495624_0170330 | |||
| 948 | Ga0495671_0070841 | |||
| 949 | Ga0495671_0148262 | |||
| 950 | Ga0495671_0231291 | |||
| 951 | Ga0495649_0091849 | |||
| 952 | Ga0495600_0001145 | |||
| 953 | Ga0495660_0098537 | |||
| 954 | Ga0495660_0110295 | |||
| 955 | Ga0495581_0137863 | |||
| 956 | Ga0495604_0022471 | |||
| 957 | Ga0495604_0029345 | |||
| 958 | Ga0495604_0408763 | |||
| 959 | Ga0495674_0042610 | |||
| 960 | Ga0495676_0259534 | |||
| 961 | Ga0495680_0009328 | |||
| 962 | Ga0495687_006948 | |||
| 963 | Ga0495675_0027465 | |||
| 964 | Ga0495673_0043853 | |||
| 965 | Ga0495686_0024882 | |||
| 966 | Ga0495593_0071414 | |||
| 967 | Ga0495602_0028430 | |||
| 968 | Ga0495602_0151389 | |||
| 969 | Ga0495614_0187920 | |||
| 970 | Ga0495626_0266408 | |||
| 971 | Ga0496100_0059143 | |||
| 972 | Ga0496101_0001519 | |||
| 973 | Ga0496101_0094810 | |||
| 974 | Ga0496101_0304376 | |||
| 975 | Ga0496102_0427070 | |||
| 976 | Ga0496103_0019895 | |||
| 977 | Ga0496104_0024654 | |||
| 978 | Ga0496104_0071829 | |||
| 979 | Ga0496104_0102941 | |||
| 980 | Ga0496104_0291670 | |||
| 981 | Ga0496105_0009241 | |||
| 982 | Ga0496105_0257413 | |||
| 983 | Ga0496105_0335743 | |||
| 984 | Ga0496105_0609759 | |||
| 985 | Ga0496106_0000545 | |||
| 986 | Ga0496106_0158634 | |||
| 987 | Ga0496106_0502751 | |||
| 988 | Ga0496106_0589859 | |||
| 989 | Ga0496107_0150201 | |||
| 990 | Ga0496108_0010875 | |||
| 991 | Ga0496108_1017281 | |||
| 992 | Ga0496109_0456884 | |||
| 993 | Ga0496109_0501768 | |||
| 994 | Ga0496110_0071333 | |||
| 995 | Ga0496110_0171737 | |||
| 996 | Ga0496110_0205414 | |||
| 997 | Ga0496110_1034604 | |||
| 998 | Ga0496111_0391097 | |||
| 999 | Ga0496112_0088979 | |||
| 1000 | Ga0496112_0090981 | |||
| 1001 | Ga0496112_0353313 | |||
| 1002 | Ga0496113_0088941 | |||
| 1003 | Ga0496113_0194605 | |||
| 1004 | Ga0496113_0316158 | |||
| 1005 | Ga0496113_0513931 | |||
| 1006 | Ga0496114_0079333 | |||
| 1007 | Ga0496114_0602441 | |||
| 1008 | Ga0496115_0210180 | |||
| 1009 | Ga0496115_0784811 | |||
| 1010 | Ga0496116_0123308 | |||
| 1011 | Ga0496117_0017937 | |||
| 1012 | Ga0496118_0004149 | |||
| 1013 | Ga0496118_0049821 | |||
| 1014 | Ga0496118_0264042 | |||
| 1015 | Ga0496118_0274510 | |||
| 1016 | Ga0496119_0007759 | |||
| 1017 | Ga0496119_0023177 | |||
| 1018 | Ga0496119_0260778 | |||
| 1019 | Ga0496120_0009651 | |||
| 1020 | Ga0496120_0030191 | |||
| 1021 | Ga0496120_0278227 | |||
| 1022 | Ga0496121_0000261 | |||
| 1023 | Ga0496121_0004585 | |||
| 1024 | Ga0496121_0120510 | |||
| 1025 | Ga0496121_0142685 | |||
| 1026 | Ga0496121_0233871 | |||
| 1027 | Ga0496122_0143658 | |||
| 1028 | Ga0496122_0300528 | |||
| 1029 | Ga0496124_0001094 | |||
| 1030 | Ga0496124_0035884 | |||
| 1031 | Ga0496124_0438729 | |||
| 1032 | Ga0496125_0028406 | |||
| 1033 | Ga0496125_0101626 | |||
| 1034 | Ga0496125_0222084 | |||
| 1035 | Ga0496125_0419732 | |||
| 1036 | Ga0496126_0004026 | |||
| 1037 | Ga0496126_0154307 | |||
| 1038 | Ga0496126_0283224 | |||
| 1039 | Ga0496126_0459231 | |||
| 1040 | Ga0496126_0737352 | |||
| 1041 | Ga0495682_0146456 | |||
| 1042 | nmdc:mga03683_284201_c1 | |||
| 1043 | nmdc:mga03683_63010_c1 | |||
| 1044 | nmdc:mga03n38_393712_c1 | |||
| 1045 | nmdc:mga03n38_9437_c1 | |||
| 1046 | nmdc:mga00v17_179111_c1 | |||
| 1047 | nmdc:mga0yw44_201102_c1 | |||
| 1048 | nmdc:mga0yw44_44090_c1 | |||
| 1049 | nmdc:mga0yw44_64847_c1 | |||
| 1050 | nmdc:mga0yw44_66436_c1 | |||
| 1051 | nmdc:mga0yw44_8432_c1 | |||
| 1052 | nmdc:mga0k408_276159_c1 | |||
| 1053 | nmdc:mga06z11_6622_c2 | |||
| 1054 | nmdc:mga04h51_9256_c1 | |||
| 1055 | nmdc:mga07m45_116596_c1 | |||
| 1056 | nmdc:mga07m45_16366_c1 | |||
| 1057 | nmdc:mga0rr50_981987_c1 | |||
| 1058 | nmdc:mga0sz30_206739_c1 | |||
| 1059 | nmdc:mga0sz30_48517_c1 | |||
| 1060 | Ga0495601_0234686 | |||
| 1061 | Ga0495601_0536162 | |||
| 1062 | Ga0500610_0170005 | |||
| 1063 | Ga0500610_0290346 | |||
| 1064 | Ga0495655_0037757 | |||
| 1065 | Ga0500578_0319789 | |||
| 1066 | Ga0500643_000091 | |||
| 1067 | Ga0500647_0034570 | |||
| 1068 | Ga0500647_0203675 | |||
| 1069 | Ga0500651_0022862 | |||
| 1070 | Ga0500651_0127184 | |||
| 1071 | Ga0500566_0000565 | |||
| 1072 | Ga0500566_0075053 | |||
| 1073 | Ga0500640_090846 | |||
| 1074 | Ga0500641_0032316 | |||
| 1075 | Ga0500648_119203 | |||
| 1076 | Ga0500650_0201557 | |||
| 1077 | Ga0500555_005028 | |||
| 1078 | Ga0500556_0236085 | |||
| 1079 | Ga0500557_000028 | |||
| 1080 | Ga0500562_041566 | |||
| 1081 | Ga0500569_012994 | |||
| 1082 | Ga0500572_008141 | |||
| 1083 | Ga0500594_0051869 | |||
| 1084 | Ga0500594_0084302 | |||
| 1085 | Ga0500595_001045 | |||
| 1086 | Ga0500595_012288 | |||
| 1087 | Ga0500595_016234 | |||
| 1088 | Ga0500595_079016 | |||
| 1089 | Ga0500642_0000189 | |||
| 1090 | Ga0500642_0002517 | |||
| 1091 | Ga0500642_0022875 | |||
| 1092 | Ga0500655_063340 | |||
| 1093 | Ga0500658_0224538 | |||
| 1094 | Ga0500559_0001773 | |||
| 1095 | Ga0500559_0083692 | |||
| 1096 | Ga0500559_0413380 | |||
| 1097 | Ga0500568_0045356 | |||
| 1098 | Ga0500573_0094932 | |||
| 1099 | Ga0500588_0115296 | |||
| 1100 | Ga0500590_124709 | |||
| 1101 | Ga0500616_0268741 | |||
| 1102 | Ga0500619_055087 | |||
| 1103 | Ga0500620_010308 | |||
| 1104 | Ga0500622_0138093 | |||
| 1105 | Ga0500622_0226451 | |||
| 1106 | Ga0500624_031299 | |||
| 1107 | Ga0500639_073533 | |||
| 1108 | Ga0500636_0000246 | |||
| 1109 | Ga0500636_0081311 | |||
| 1110 | Ga0500637_0077321 | |||
| 1111 | Ga0500637_0081529 | |||
| 1112 | Ga0500649_059375 | |||
| 1113 | Ga0500625_010179 | |||
| 1114 | Ga0500552_013201 | |||
| 1115 | Ga0500596_004897 | |||
| 1116 | Ga0500596_013622 | |||
| 1117 | Ga0500599_003473 | |||
| 1118 | Ga0500601_000069 | |||
| 1119 | Ga0501084_0854206 | |||
| 1120 | Ga0500661_025636 | |||
| 1121 | 2507504746 | |||
| 1122 | 2508546098 | |||
| 1123 | 2508695032 | |||
| 1124 | 2511397008 | |||
| 1125 | 2513626676 | |||
| 1126 | 2513641811 | |||
| 1127 | 2513648068 | |||
| 1128 | 2513715594 | |||
| 1129 | 2513875715 | |||
| 1130 | 2514016381 | |||
| 1131 | 2515625965 | |||
| 1132 | 2517106965 | |||
| 1133 | 2524435637 | |||
| 1134 | 2528850290 | |||
| 1135 | 2617352946 | |||
| 1136 | 2617374234 | |||
| 1137 | 2671119389 | |||
| 1138 | 2745079904 | |||
| 1139 | 2793063206 | |||
| 1140 | 2793073473 | |||
| 1141 | 2793083723 | |||
| 1142 | 2805919391 | |||
| 1143 | 2818237173 | |||
| 1144 | 2824608676 | |||
| 1145 | 2824612753 | |||
| 1146 | 2824626364 | |||
| 1147 | 2824632491 | |||
| 1148 | 2824643643 | |||
| 1149 | 2824652529 | |||
| 1150 | 2824659004 | |||
| 1151 | 2824663557 | |||
| 1152 | 2824677889 | |||
| 1153 | 2824687171 | |||
| 1154 | 2824694609 | |||
| 1155 | 2824702775 | |||
| 1156 | 2824713205 | |||
| 1157 | 2824723307 | |||
| 1158 | 2824732466 | |||
| 1159 | 2824736939 | |||
| 1160 | 2824748231 | |||
| 1161 | 2824760630 | |||
| 1162 | 2824772021 | |||
| 1163 | 2824779868 | |||
| 1164 | 2838129445 | |||
| 1165 | 2841944346 | |||
| 1166 | 2841954477 | |||
| 1167 | 2841965993 | |||
| 1168 | 2841969123 | |||
| 1169 | 2841979897 | |||
| 1170 | 2841990922 | |||
| 1171 | 2842043995 | |||
| 1172 | 2842052016 | |||
| 1173 | 2844321723 | |||
| 1174 | 2847939689 | |||
| 1175 | 2847941642 | |||
| 1176 | 2849082565 | |||
| 1177 | 2857511461 | |||
| 1178 | 2874594297 | |||
| 1179 | 2874615555 | |||
| 1180 | 2874624322 | |||
| 1181 | 2874634083 | |||
| 1182 | 2874647723 | |||
| 1183 | 2876770072 | |||
| 1184 | 2876772605 | |||
| 1185 | 2876819866 | |||
| 1186 | 2879076372 | |||
| 1187 | 2879090508 | |||
| 1188 | 2879101848 | |||
| 1189 | 2879130673 | |||
| 1190 | 2879143145 | |||
| 1191 | 2881364988 | |||
| 1192 | 2881673621 | |||
| 1193 | 2885368106 | |||
| 1194 | 2885380001 | |||
| 1195 | 2888380076 | |||
| 1196 | 2888391135 | |||
| 1197 | 2888420880 | |||
| 1198 | 2889034954 | |||
| 1199 | 2903727731 | |||
| 1200 | 2903755935 | |||
| 1201 | 2904672339 | |||
| 1202 | 2904710056 | |||
| 1203 | 2904717925 | |||
| 1204 | 2906602783 | |||
| 1205 | 2906632412 | |||
| 1206 | 2908746677 | |||
| 1207 | 2908776709 | |||
| 1208 | 2922378458 | |||
| 1209 | 2922400254 | |||
| 1210 | 2929622441 | |||
| 1211 | 2929631342 | |||
| 1212 | 2932786241 | |||
| 1213 | 2932794783 | |||
| 1214 | 2932805407 | |||
| 1215 | 2932812685 | |||
| 1216 | 2932823047 | |||
| 1217 | 2932829479 | |||
| 1218 | 2933584479 | |||
| 1219 | 2935615056 | |||
| 1220 | 2935617997 | |||
| 1221 | 2935641605 | |||
| 1222 | 2935651592 | |||
| 1223 | 2935659640 | |||
| 1224 | 2935669337 | |||
| 1225 | 2935678067 | |||
| 1226 | 2935693614 | |||
| 1227 | 2935701696 | |||
| 1228 | 2935707160 | |||
| 1229 | 2935717003 | |||
| 1230 | 2935730163 | |||
| 1231 | 2935738417 | |||
| 1232 | 2935750205 | |||
| 1233 | 2935759799 | |||
| 1234 | 2935764550 | |||
| 1235 | 2935772872 | |||
| 1236 | 2935777989 | |||
| 1237 | 2935787219 | |||
| 1238 | 2935795993 | |||
| 1239 | 2935804459 | |||
| 1240 | 2935817320 | |||
| 1241 | 2935825906 | |||
| 1242 | 2935831336 | |||
| 1243 | 2935841945 | |||
| 1244 | 2935851525 | |||
| 1245 | 2935856504 | |||
| 1246 | 2935870954 | |||
| 1247 | 2935874470 | |||
| 1248 | 2935887511 | |||
| 1249 | 2935910454 | |||
| 1250 | 2935918252 | |||
| 1251 | 2935927635 | |||
| 1252 | 2935936493 | |||
| 1253 | 2935943954 | |||
| 1254 | 2935952391 | |||
| 1255 | 2935964248 | |||
| 1256 | 2935969231 | |||
| 1257 | 2935978008 | |||
| 1258 | 2935984692 | |||
| 1259 | 2935993931 | |||
| 1260 | 2936005058 | |||
| 1261 | 2936014056 | |||
| 1262 | 2936023035 | |||
| 1263 | 2936031171 | |||
| 1264 | 2936044117 | |||
| 1265 | 2936049293 | |||
| 1266 | 2936055862 | |||
| 1267 | 2940565747 | |||
| 1268 | 2941532256 | |||
| 1269 | 2941544018 | |||
| 1270 | 3005475696 | |||
| 1271 | 3005490985 | |||
| 1272 | 3005509649 | |||
| 1273 | 3005594254 | |||
| 1274 | 3005602072 | |||
| 1275 | 3005717826 | |||
| 1276 | 3005724858 | |||
| 1277 | 8006930754 | |||
| 1278 | 8016518754 | |||
| 1279 | 8016526707 | |||
| 1280 | 8016531791 | |||
| 1281 | 8016557076 | |||
| 1282 | 8016582642 | |||
| 1283 | 8016585826 | |||
| 1284 | 8016603063 | |||
| 1285 | 8016605965 | |||
| 1286 | 8016617850 | |||
| 1287 | 8016623721 | |||
| 1288 | 8016636190 | |||
| 1289 | 8017057923 | |||
| 1290 | 8019539913 | |||
| 1291 | 8019550740 | |||
| 1292 | 8019577801 | |||
| 1293 | 8019595902 | |||
| 1294 | 8019605853 | |||
| 1295 | 8019612680 | |||
| 1296 | 8019622439 | |||
| 1297 | 8019639942 | |||
| 1298 | 8019651966 | |||
| 1299 | 8019667499 | |||
| 1300 | 8019677271 | |||
| 1301 | 8019678711 | |||
| 1302 | 8019696805 | |||
| 1303 | 8055750892 | |||
| 1304 | 8056975576 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wx9-assembly1.cif.gz_C-4 | crystal structure of mycobacterium tuberculosis ogt in complex with dna | 0.8403 | 5 | 169 |
| 4wx9-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis ogt in complex with dna | 0.8321 | 5 | 168 |
| 1sfe-assembly1.cif.gz_A | ada o6-methylguanine-dna methyltransferase from escherichia coli | 0.8258 | 2 | 171 |
| 4zyd-assembly2.cif.gz_A-3 | crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna | 0.8236 | 5 | 171 |
| 1sfe-assembly1.cif.gz_A | ada o6-methylguanine-dna methyltransferase from escherichia coli | 0.8213 | 2 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DAC5_49_134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9136 | 87 | 171 | 1.10.10.10 |
| af_P26188_97_181_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.898 | 87 | 168 | 1.10.10.10 |
| af_O76339_109_192_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8888 | 87 | 169 | 1.10.10.10 |
| af_E9QIW2_242_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8826 | 86 | 128 | 1.10.10.10 |
| af_P26187_90_179_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8781 | 87 | 169 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7NXB5-F1-model_v4 | Cysteine methyltransferase | 0.9481 | 2 | 150 |
GO:0003908
GO:0006281 GO:0032259 |
| AF-A0A7Y4ZKF0-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9464 | 2 | 168 |
GO:0003908
GO:0005737 GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032259 GO:0032993 GO:0043916 |
| AF-A0A1S7M6I6-F1-model_v4 | deleted | 0.9439 | 3 | 170 |
|
| AF-A0A6L3E3I1-F1-model_v4 | deleted | 0.9435 | 3 | 170 |
|
| AF-A0A431RJJ5-F1-model_v4 | deleted | 0.938 | 1 | 134 |
|