F472697

General Info

Members Datasets Scaffolds Average Seq Length
652 486 1304 192

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0230648|Ga0466964_0230648_110_688
Length 186
Sequence MVGRGYAIFDTAIGRCGIIWSSTGVVAVQLPEAREIDTRRRIFQAHPEAREQQPPLNTELAIEGIVGLLHGSDPDFSDVSLDAGGISAFNRRVYEYTCTILRGETRTYHEIAQALGASAAAIAKNPYMLIVPCHRVLEAGNYAGRISPYGGVISKRRLLSLEGANPVASKTLFEVLLPVAPPRAPT

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
51 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
52 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
124 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
126 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
268 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
269 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
276 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
285 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
286 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
289 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
292 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
296 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
297 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
298 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
299 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
300 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
303 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
304 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
305 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
306 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
307 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
308 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
309 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
310 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
311 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
312 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
313 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
314 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
315 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
316 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
317 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
318 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
319 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
320 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
321 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
322 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
323 2791355199
324 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
325 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
326 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
327 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
328 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
329 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
330 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
331 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
332 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
333 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
334 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
335 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
336 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
337 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
338 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
339 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
340 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
341 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
342 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
343 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
344 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
345 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
346 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
347 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
348 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
349 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
350 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
351 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
352 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
353 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
354 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
355 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
356 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
357 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
358 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
359 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
360 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
361 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
362 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
363 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
364 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
365 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
366 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
367 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
368 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
369 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
370 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
371 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
372 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
373 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
374 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
375 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
376 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
377 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
378 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
379 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
380 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
381 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
382 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
383 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
384 2904699407
385 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
386 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
387 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
388 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
389 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
390 2922368715
391 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
392 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
393 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
394 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
395 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
396 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
397 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
398 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
399 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
400 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
401 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
402 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
403 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
404 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
405 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
406 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
407 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
408 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
409 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
410 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
411 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
412 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
413 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
414 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
415 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
416 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
417 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
418 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
419 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
420 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
421 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
422 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
423 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
424 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
425 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
426 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
427 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
428 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
429 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
430 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
431 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
432 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
433 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
434 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
435 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
436 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
437 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
438 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
439 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
440 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
441 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
442 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
443 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
444 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
445 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
446 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
447 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
448 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
449 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
450 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
451 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
452 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
453 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
454 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
455 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
456 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
457 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
458 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
459 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
460 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
461 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
462 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
463 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
464 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
465 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
466 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
467 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
468 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
469 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
470 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
471 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
472 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
473 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
474 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
475 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
476 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
477 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
478 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
479 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
480 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
481 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
482 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
483 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
484 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
485 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
486 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.11
Metatranscriptomes 0
Isolates 27.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.25
Nodule 22.24
Rhizoplane 6.44
Rhizosphere 38.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0230648 3300044706 Bacteria 903
2 JGI24739J22299_10061109 3300001989 Bacteria 1190
3 JGI25153J46596_10000657 3300003215 Bacteria 21147
4 JGI25153J46596_10008218 3300003215 Bacteria 5019
5 JGI25160J50197_1000486 3300003354 Bacteria 23951
6 JGI25160J50197_1011041 3300003354 Bacteria 3228
7 JGI25404J52841_10010788 3300003659 Bacteria 1966
8 Ga0055529_1011245 3300003763 Bacteria 1152
9 Ga0055526_1041721 3300003771 Bacteria 1140
10 Ga0055531_10007130 3300003794 Bacteria 6168
11 Ga0055543_1001606 3300004625 Bacteria 8671
12 Ga0065165_1001966 3300005262 Bacteria 19466
13 Ga0065165_1002218 3300005262 Bacteria 17339
14 Ga0065165_1003663 3300005262 Bacteria 10488
15 Ga0070658_10084641 3300005327 Bacteria 2607
16 Ga0068869_100227527 3300005334 Bacteria 1481
17 Ga0070661_100111451 3300005344 Bacteria 2043
18 Ga0070668_100218819 3300005347 Bacteria 1570
19 Ga0070668_100555756 3300005347 Bacteria 999
20 Ga0070668_100585566 3300005347 Bacteria 974
21 Ga0070671_100004121 3300005355 Bacteria 11476
22 Ga0070667_100026636 3300005367 Bacteria 4809
23 Ga0070709_10004180 3300005434 Bacteria 7779
24 Ga0070713_100113086 3300005436 Bacteria 2370
25 Ga0070713_100734824 3300005436 Bacteria 944
26 Ga0070710_10009184 3300005437 Bacteria 4832
27 Ga0070711_100014471 3300005439 Bacteria 4971
28 Ga0070705_100368918 3300005440 Bacteria 1053
29 Ga0070663_100038020 3300005455 Bacteria 3354
30 Ga0070663_100362178 3300005455 Bacteria 1176
31 Ga0070663_100386023 3300005455 Bacteria 1142
32 Ga0068867_100434591 3300005459 Bacteria 1115
33 Ga0068853_100851321 3300005539 Bacteria 875
34 Ga0070693_100496524 3300005547 Bacteria 865
35 Ga0070665_100017815 3300005548 Bacteria 7130
36 Ga0070665_100022309 3300005548 Bacteria 6370
37 Ga0070665_100728661 3300005548 Bacteria 1005
38 Ga0068855_100672005 3300005563 Bacteria 1111
39 Ga0068854_100090384 3300005578 Bacteria 2277
40 Ga0068854_100127219 3300005578 Bacteria 1942
41 Ga0068856_100048537 3300005614 Bacteria 4184
42 Ga0068856_100052457 3300005614 Bacteria 4021
43 Ga0068856_100693422 3300005614 Bacteria 1039
44 Ga0070702_100776896 3300005615 Bacteria 738
45 Ga0068852_100371243 3300005616 Bacteria 1402
46 Ga0068861_100276824 3300005719 Bacteria 1443
47 Ga0068863_100191464 3300005841 Bacteria 1966
48 Ga0068860_100000629 3300005843 Bacteria 41623
49 Ga0068860_100447230 3300005843 Bacteria 1284
50 Ga0068860_100798628 3300005843 Bacteria 957
51 Ga0081455_10004380 3300005937 Bacteria 15903
52 Ga0081455_10050729 3300005937 Bacteria 3565
53 Ga0081455_10558131 3300005937 Bacteria 756
54 Ga0081540_1000663 3300005983 Bacteria 32432
55 Ga0081540_1004994 3300005983 Bacteria 9970
56 Ga0081540_1007119 3300005983 Bacteria 8028
57 Ga0081540_1013959 3300005983 Bacteria 5184
58 Ga0081540_1071851 3300005983 Bacteria 1597
59 Ga0081540_1107190 3300005983 Bacteria 1190
60 Ga0081539_10000902 3300005985 Bacteria 56412
61 Ga0081539_10175551 3300005985 Bacteria 1009
62 Ga0070717_10069825 3300006028 Bacteria 2926
63 Ga0070717_10131974 3300006028 Bacteria 2149
64 Ga0075365_10026761 3300006038 Bacteria 3665
65 Ga0075365_10050580 3300006038 Bacteria 2741
66 Ga0075365_10094603 3300006038 Bacteria 2040
67 Ga0075365_10110631 3300006038 Bacteria 1887
68 Ga0075368_10010204 3300006042 Bacteria 3392
69 Ga0075368_10085351 3300006042 Bacteria 1288
70 Ga0075363_100021973 3300006048 Bacteria 3221
71 Ga0075364_10017052 3300006051 Bacteria 4529
72 Ga0070716_100086700 3300006173 Bacteria 1884
73 Ga0070716_100264992 3300006173 Bacteria 1178
74 Ga0070712_100043114 3300006175 Bacteria 3105
75 Ga0070712_100470241 3300006175 Bacteria 1050
76 Ga0075362_10065181 3300006177 Bacteria 1654
77 Ga0075367_10103597 3300006178 Bacteria 1741
78 Ga0075366_10021518 3300006195 Bacteria 3749
79 Ga0075366_10026379 3300006195 Bacteria 3403
80 Ga0097621_100788621 3300006237 Bacteria 880
81 Ga0075370_10027768 3300006353 Bacteria 3143
82 Ga0075370_10035051 3300006353 Bacteria 2815
83 Ga0099825_1032747 3300006941 Bacteria 2079
84 Ga0099824_1008958 3300006942 Bacteria 12537
85 Ga0099822_1044570 3300006943 Bacteria 2184
86 Ga0075435_100095471 3300007076 Bacteria 2459
87 Ga0099794_10035878 3300007265 Bacteria 2341
88 Ga0099794_10083057 3300007265 Bacteria 1582
89 Ga0099795_10062898 3300007788 Bacteria 1382
90 Ga0105240_10002869 3300009093 Bacteria 27260
91 Ga0105240_10564534 3300009093 Bacteria 1257
92 Ga0105245_10065023 3300009098 Bacteria 3298
93 Ga0105245_10067476 3300009098 Bacteria 3240
94 Ga0105247_10016547 3300009101 Bacteria 4421
95 Ga0105247_10134514 3300009101 Bacteria 1614
96 Ga0105247_10331234 3300009101 Bacteria 1065
97 Ga0105237_10050966 3300009545 Bacteria 4159
98 Ga0105237_10374174 3300009545 Bacteria 1429
99 Ga0105238_10474298 3300009551 Bacteria 1250
100 Ga0105238_10979855 3300009551 Bacteria 866
101 Ga0099796_10026446 3300010159 Bacteria 1843
102 Ga0099796_10037369 3300010159 Bacteria 1623
103 Ga0105239_10045796 3300010375 Bacteria 4793
104 Ga0105239_10144971 3300010375 Bacteria 2648
105 Ga0105239_10154204 3300010375 Bacteria 2565
106 Ga0105239_10324211 3300010375 Bacteria 1737
107 Ga0105239_11271064 3300010375 Bacteria 849
108 Ga0105246_10173968 3300011119 Bacteria 1651
109 Ga0157370_10315636 3300013104 Bacteria 1442
110 Ga0157374_10525156 3300013296 Bacteria 1190
111 Ga0157378_10149421 3300013297 Bacteria 2176
112 Ga0163162_10092320 3300013306 Bacteria 3111
113 Ga0157372_10653081 3300013307 Bacteria 1225
114 Ga0157375_10463026 3300013308 Bacteria 1433
115 Ga0163163_10408481 3300014325 Bacteria 1416
116 Ga0182008_10205307 3300014497 Bacteria 1004
117 Ga0157379_10107462 3300014968 Bacteria 2505
118 Ga0157376_10638863 3300014969 Bacteria 1063
119 Ga0182006_1124811 3300015261 Bacteria 891
120 Ga0163161_10515133 3300017792 Bacteria 976
121 Ga0214544_1000003 3300021320 Bacteria 643752
122 Ga0214542_1000003 3300021321 Bacteria 435700
123 Ga0214545_1000004 3300021324 Bacteria 453352
124 Ga0214543_1000007 3300021327 Bacteria 414744
125 Ga0213873_10006963 3300021358 Bacteria 2246
126 Ga0213876_10001113 3300021384 Bacteria 17196
127 Ga0209563_102406 3300025230 Bacteria 4246
128 Ga0209677_105081 3300025253 Bacteria 3554
129 Ga0209148_1000904 3300025254 Bacteria 20182
130 Ga0209233_1002498 3300025261 Bacteria 6743
131 Ga0209455_1014906 3300025272 Bacteria 1734
132 Ga0209564_1002641 3300025295 Bacteria 13692
133 Ga0209564_1046056 3300025295 Bacteria 1115
134 Ga0209758_1000015 3300025297 Bacteria 851943
135 Ga0209758_1000389 3300025297 Bacteria 75919
136 Ga0209758_1000716 3300025297 Bacteria 48984
137 Ga0209758_1001131 3300025297 Bacteria 34274
138 Ga0209758_1042364 3300025297 Bacteria 1689
139 Ga0209256_1005691 3300025299 Bacteria 7003
140 Ga0207426_1000380 3300025302 Bacteria 76046
141 Ga0207426_1000832 3300025302 Bacteria 32765
142 Ga0207426_1015195 3300025302 Bacteria 2798
143 Ga0207426_1063987 3300025302 Bacteria 1047
144 Ga0209257_1001378 3300025304 Bacteria 29161
145 Ga0209257_1036344 3300025304 Bacteria 1514
146 Ga0207697_10203874 3300025315 Bacteria 870
147 Ga0207656_10186644 3300025321 Bacteria 997
148 Ga0207692_10006034 3300025898 Bacteria 4898
149 Ga0207710_10215574 3300025900 Bacteria 952
150 Ga0207688_10129808 3300025901 Bacteria 1477
151 Ga0207647_10005598 3300025904 Bacteria 9180
152 Ga0207699_10422839 3300025906 Bacteria 952
153 Ga0207699_10565457 3300025906 Bacteria 826
154 Ga0207654_10104411 3300025911 Bacteria 1752
155 Ga0207695_10000065 3300025913 Bacteria 336949
156 Ga0207671_10002455 3300025914 Bacteria 19836
157 Ga0207671_10035782 3300025914 Bacteria 3682
158 Ga0207671_10079524 3300025914 Bacteria 2457
159 Ga0207693_10044808 3300025915 Bacteria 3476
160 Ga0207657_10082129 3300025919 Bacteria 2705
161 Ga0207649_10114842 3300025920 Bacteria 1805
162 Ga0207681_10461574 3300025923 Bacteria 1035
163 Ga0207694_10451721 3300025924 Bacteria 1073
164 Ga0207694_10451864 3300025924 Bacteria 1073
165 Ga0207664_10015510 3300025929 Bacteria 5533
166 Ga0207644_10100932 3300025931 Bacteria 2168
167 Ga0207706_10143394 3300025933 Bacteria 2102
168 Ga0207665_10040737 3300025939 Bacteria 3101
169 Ga0207665_10244568 3300025939 Bacteria 1323
170 Ga0207711_10623192 3300025941 Bacteria 1006
171 Ga0207679_10826353 3300025945 Bacteria 845
172 Ga0207667_10539826 3300025949 Bacteria 1180
173 Ga0207668_10151617 3300025972 Bacteria 1795
174 Ga0207668_10557387 3300025972 Bacteria 993
175 Ga0207639_10716202 3300026041 Bacteria 929
176 Ga0207678_10170318 3300026067 Bacteria 1859
177 Ga0207678_10202236 3300026067 Bacteria 1699
178 Ga0207678_10243868 3300026067 Bacteria 1539
179 Ga0207678_10652403 3300026067 Bacteria 925
180 Ga0207702_10442942 3300026078 Bacteria 1259
181 Ga0207648_10154934 3300026089 Bacteria 2022
182 Ga0207676_10282909 3300026095 Bacteria 1507
183 Ga0207674_10461271 3300026116 Bacteria 1228
184 Ga0207683_10428525 3300026121 Bacteria 1219
185 Ga0207698_11054859 3300026142 Bacteria 824
186 Ga0209389_1000168 3300027296 Bacteria 52990
187 Ga0209389_1000180 3300027296 Bacteria 49331
188 Ga0209589_1000570 3300027357 Bacteria 52985
189 Ga0209489_101190 3300027361 Bacteria 52985
190 Ga0209489_101411 3300027361 Bacteria 49331
191 Ga0209700_101443 3300027363 Bacteria 49345
192 Ga0209813_10008452 3300027866 Bacteria 2602
193 Ga0268266_10026711 3300028379 Bacteria 4912
194 Ga0268266_10596114 3300028379 Bacteria 1061
195 Ga0268264_10000049 3300028381 Bacteria 329992
196 Ga0268264_10584991 3300028381 Bacteria 1099
197 Ga0265332_10004766 3300031238 Bacteria 6323
198 Ga0307509_10015871 3300031507 Bacteria 8751
199 Ga0307509_10196584 3300031507 Bacteria 1859
200 Ga0307516_10324669 3300031730 Bacteria 1209
201 Ga0307516_10375323 3300031730 Bacteria 1084
202 Ga0307510_10003428 3300033180 Bacteria 18490
203 Ga0307510_10231821 3300033180 Bacteria 1348
204 Ga0373923_0328128 3300035111 Bacteria 728
205 Ga0373943_0204990 3300035170 Bacteria 1093
206 Ga0373935_0051160 3300035692 Bacteria 2623
207 Ga0373927_0070829 3300035695 Bacteria 2256
208 Ga0373927_0131819 3300035695 Bacteria 1633
209 Ga0373947_0360184 3300035725 Bacteria 977
210 Ga0373937_0047523 3300036401 Bacteria 3927
211 Ga0373925_0260509 3300037068 Bacteria 1393
212 Ga0373925_0322514 3300037068 Bacteria 1250
213 Ga0395899_0019135 3300037312 Bacteria 5204
214 Ga0395900_0000937 3300037418 Bacteria 38218
215 Ga0395898_0005127 3300037466 Bacteria 14184
216 Ga0395905_0003588 3300037471 Bacteria 16513
217 Ga0395901_0006000 3300038443 Bacteria 12306
218 Ga0436365_0133064 3300039437 Bacteria 19710
219 Ga0436365_1032974 3300039437 Bacteria 2023
220 Ga0436360_0419422 3300039438 Bacteria 2289
221 Ga0436361_0326411 3300039447 Bacteria 4688
222 Ga0436363_0595544 3300039450 Bacteria 2881
223 Ga0436363_1633359 3300039450 Bacteria 1098
224 Ga0436362_0549978 3300039453 Bacteria 2914
225 Ga0451791_1361674 3300041451 Bacteria 867
226 Ga0451800_0306270 3300041459 Bacteria 825
227 Ga0451833_0295131 3300041491 Bacteria 1337
228 Ga0451843_0212572 3300041509 Bacteria 1402
229 Ga0466972_0000171 3300044658 Bacteria 50915
230 Ga0466972_0025991 3300044658 Bacteria 2899
231 Ga0466972_0108509 3300044658 Bacteria 1312
232 Ga0466965_0055440 3300044683 Bacteria 1973
233 Ga0466966_0000287 3300044684 Bacteria 33106
234 Ga0466961_0000126 3300044693 Bacteria 51032
235 Ga0466961_0105953 3300044693 Bacteria 1770
236 Ga0466963_0097828 3300044694 Bacteria 2005
237 Ga0466968_0208542 3300044735 Bacteria 917
238 Ga0466970_0015519 3300044765 Bacteria 3919
239 Ga0466959_0020395 3300045049 Bacteria 4882
240 Ga0466967_0733372 3300045976 Bacteria 979
241 Ga0495592_0024033 3300046454 Bacteria 4635
242 Ga0495592_0364976 3300046454 Bacteria 922
243 Ga0495603_0168766 3300046455 Bacteria 1268
244 Ga0495629_0010820 3300046459 Bacteria 6636
245 Ga0495638_0095236 3300046460 Bacteria 1788
246 Ga0495641_0148770 3300046461 Bacteria 1046
247 Ga0495651_0031577 3300046462 Bacteria 4130
248 Ga0495651_0041817 3300046462 Bacteria 3560
249 Ga0495653_0066422 3300046463 Bacteria 2713
250 Ga0495605_0135676 3300046474 Bacteria 1107
251 Ga0495605_0151406 3300046474 Bacteria 1035
252 Ga0495639_0067292 3300046475 Bacteria 1650
253 Ga0495664_0036240 3300046477 Bacteria 2907
254 Ga0495585_0130992 3300046492 Bacteria 1320
255 Ga0495594_0277634 3300046499 Bacteria 955
256 Ga0495607_0247209 3300046501 Bacteria 860
257 Ga0495606_0049462 3300046507 Bacteria 2756
258 Ga0495606_0068647 3300046507 Bacteria 2242
259 Ga0495606_0207221 3300046507 Bacteria 1113
260 Ga0495606_0474323 3300046507 Bacteria 636
261 Ga0495608_0314315 3300046511 Bacteria 968
262 Ga0495610_0160537 3300046512 Bacteria 951
263 Ga0495616_0010409 3300046513 Bacteria 5384
264 Ga0495620_0102345 3300046515 Bacteria 1141
265 Ga0495620_0109483 3300046515 Bacteria 1096
266 Ga0495620_0134591 3300046515 Bacteria 969
267 Ga0495628_0010621 3300046516 Bacteria 7810
268 Ga0495630_0253406 3300046517 Bacteria 1345
269 Ga0495632_0076674 3300046519 Bacteria 1599
270 Ga0495643_0010141 3300046522 Bacteria 5810
271 Ga0495648_0003301 3300046524 Bacteria 14240
272 Ga0495648_0117813 3300046524 Bacteria 1433
273 Ga0495652_0005571 3300046529 Bacteria 11837
274 Ga0495652_0137668 3300046529 Bacteria 1924
275 Ga0495587_0236605 3300046536 Bacteria 1028
276 Ga0495609_0170711 3300046538 Bacteria 919
277 Ga0495645_0482064 3300046543 Bacteria 778
278 Ga0495622_0005984 3300046557 Bacteria 5651
279 Ga0495622_0016782 3300046557 Bacteria 3410
280 Ga0495667_0157052 3300046559 Bacteria 1463
281 Ga0495668_0365471 3300046616 Bacteria 792
282 Ga0495625_0073571 3300046660 Bacteria 2395
283 Ga0495625_0221949 3300046660 Bacteria 1238
284 Ga0495625_0301860 3300046660 Bacteria 1024
285 Ga0495635_0001988 3300046663 Bacteria 13902
286 Ga0495635_0018225 3300046663 Bacteria 4901
287 Ga0495588_0100757 3300046674 Bacteria 1518
288 Ga0495657_0017362 3300046675 Bacteria 5226
289 Ga0495599_0041186 3300046678 Bacteria 2901
290 Ga0495623_0106486 3300046679 Bacteria 1703
291 Ga0495646_0026395 3300046680 Bacteria 3648
292 Ga0495658_0518551 3300046683 Bacteria 763
293 Ga0495669_0109322 3300046684 Bacteria 1290
294 Ga0495613_0241957 3300046689 Bacteria 1261
295 Ga0495624_0170330 3300046690 Bacteria 1328
296 Ga0495671_0070841 3300046692 Bacteria 1713
297 Ga0495671_0148262 3300046692 Bacteria 1142
298 Ga0495671_0231291 3300046692 Bacteria 894
299 Ga0495649_0091849 3300046694 Bacteria 1617
300 Ga0495600_0001145 3300046809 Bacteria 14497
301 Ga0495660_0098537 3300046810 Bacteria 1508
302 Ga0495660_0110295 3300046810 Bacteria 1405
303 Ga0495581_0137863 3300047315 Bacteria 1422
304 Ga0495604_0022471 3300047317 Bacteria 5036
305 Ga0495604_0029345 3300047317 Bacteria 4375
306 Ga0495604_0408763 3300047317 Bacteria 893
307 Ga0495674_0042610 3300047319 Bacteria 4047
308 Ga0495676_0259534 3300047321 Bacteria 1182
309 Ga0495680_0009328 3300047322 Bacteria 8839
310 Ga0495687_006948 3300047443 Bacteria 6806
311 Ga0495675_0027465 3300047444 Bacteria 3626
312 Ga0495673_0043853 3300047469 Bacteria 1999
313 Ga0495686_0024882 3300047472 Bacteria 3929
314 Ga0495593_0071414 3300047673 Bacteria 1803
315 Ga0495602_0028430 3300048088 Bacteria 5350
316 Ga0495602_0151389 3300048088 Bacteria 1823
317 Ga0495614_0187920 3300048089 Bacteria 931
318 Ga0495626_0266408 3300048091 Bacteria 684
319 Ga0496100_0059143 3300048903 Bacteria 2517
320 Ga0496101_0001519 3300048904 Bacteria 13894
321 Ga0496101_0094810 3300048904 Bacteria 2225
322 Ga0496101_0304376 3300048904 Bacteria 1249
323 Ga0496102_0427070 3300048905 Bacteria 1244
324 Ga0496103_0019895 3300048906 Bacteria 4031
325 Ga0496104_0024654 3300048907 Bacteria 5534
326 Ga0496104_0071829 3300048907 Bacteria 3290
327 Ga0496104_0102941 3300048907 Bacteria 2735
328 Ga0496104_0291670 3300048907 Bacteria 1544
329 Ga0496105_0009241 3300048908 Bacteria 7699
330 Ga0496105_0257413 3300048908 Bacteria 1412
331 Ga0496105_0335743 3300048908 Bacteria 1209
332 Ga0496105_0609759 3300048908 Bacteria 846
333 Ga0496106_0000545 3300048909 Bacteria 26754
334 Ga0496106_0158634 3300048909 Bacteria 1788
335 Ga0496106_0502751 3300048909 Bacteria 974
336 Ga0496106_0589859 3300048909 Bacteria 890
337 Ga0496107_0150201 3300048910 Bacteria 1723
338 Ga0496108_0010875 3300048911 Bacteria 7388
339 Ga0496108_1017281 3300048911 Bacteria 707
340 Ga0496109_0456884 3300048912 Bacteria 1206
341 Ga0496109_0501768 3300048912 Bacteria 1145
342 Ga0496110_0071333 3300048913 Bacteria 3080
343 Ga0496110_0171737 3300048913 Bacteria 1967
344 Ga0496110_0205414 3300048913 Bacteria 1790
345 Ga0496110_1034604 3300048913 Bacteria 729
346 Ga0496111_0391097 3300048914 Bacteria 1028
347 Ga0496112_0088979 3300048915 Bacteria 3055
348 Ga0496112_0090981 3300048915 Bacteria 3020
349 Ga0496112_0353313 3300048915 Bacteria 1412
350 Ga0496113_0088941 3300048916 Bacteria 2376
351 Ga0496113_0194605 3300048916 Bacteria 1610
352 Ga0496113_0316158 3300048916 Bacteria 1251
353 Ga0496113_0513931 3300048916 Bacteria 961
354 Ga0496114_0079333 3300048917 Bacteria 2771
355 Ga0496114_0602441 3300048917 Bacteria 969
356 Ga0496115_0210180 3300048918 Bacteria 1607
357 Ga0496115_0784811 3300048918 Bacteria 742
358 Ga0496116_0123308 3300048919 Bacteria 1494
359 Ga0496117_0017937 3300048920 Bacteria 5893
360 Ga0496118_0004149 3300048921 Bacteria 17505
361 Ga0496118_0049821 3300048921 Bacteria 3221
362 Ga0496118_0264042 3300048921 Bacteria 969
363 Ga0496118_0274510 3300048921 Bacteria 942
364 Ga0496119_0007759 3300048922 Bacteria 9571
365 Ga0496119_0023177 3300048922 Bacteria 4416
366 Ga0496119_0260778 3300048922 Bacteria 870
367 Ga0496120_0009651 3300048923 Bacteria 6815
368 Ga0496120_0030191 3300048923 Bacteria 3299
369 Ga0496120_0278227 3300048923 Bacteria 775
370 Ga0496121_0000261 3300048924 Bacteria 110085
371 Ga0496121_0004585 3300048924 Bacteria 18424
372 Ga0496121_0120510 3300048924 Bacteria 1982
373 Ga0496121_0142685 3300048924 Bacteria 1774
374 Ga0496121_0233871 3300048924 Bacteria 1285
375 Ga0496122_0143658 3300048925 Bacteria 1488
376 Ga0496122_0300528 3300048925 Bacteria 866
377 Ga0496124_0001094 3300048927 Bacteria 42597
378 Ga0496124_0035884 3300048927 Bacteria 4333
379 Ga0496124_0438729 3300048927 Bacteria 894
380 Ga0496125_0028406 3300048928 Bacteria 5053
381 Ga0496125_0101626 3300048928 Bacteria 2115
382 Ga0496125_0222084 3300048928 Bacteria 1216
383 Ga0496125_0419732 3300048928 Bacteria 776
384 Ga0496126_0004026 3300048929 Bacteria 17896
385 Ga0496126_0154307 3300048929 Bacteria 1966
386 Ga0496126_0283224 3300048929 Bacteria 1372
387 Ga0496126_0459231 3300048929 Bacteria 1024
388 Ga0496126_0737352 3300048929 Bacteria 762
389 Ga0495682_0146456 3300049460 Bacteria 843
390 nmdc:mga03683_284201_c1 3300050489 Bacteria 773
391 nmdc:mga03683_63010_c1 3300050489 Bacteria 1571
392 nmdc:mga03n38_393712_c1 3300050490 Bacteria 761
393 nmdc:mga03n38_9437_c1 3300050490 Bacteria 3551
394 nmdc:mga00v17_179111_c1 3300050491 Bacteria 1367
395 nmdc:mga0yw44_201102_c1 3300050492 Bacteria 1316
396 nmdc:mga0yw44_44090_c1 3300050492 Bacteria 2667
397 nmdc:mga0yw44_64847_c1 3300050492 Bacteria 2249
398 nmdc:mga0yw44_66436_c1 3300050492 Bacteria 2225
399 nmdc:mga0yw44_8432_c1 3300050492 Bacteria 5135
400 nmdc:mga0k408_276159_c1 3300050493 Bacteria 1003
401 nmdc:mga06z11_6622_c2 3300050494 Bacteria 3605
402 nmdc:mga04h51_9256_c1 3300050495 Bacteria 2663
403 nmdc:mga07m45_116596_c1 3300050496 Bacteria 1541
404 nmdc:mga07m45_16366_c1 3300050496 Bacteria 3971
405 nmdc:mga0rr50_981987_c1 3300050513 Bacteria 720
406 nmdc:mga0sz30_206739_c1 3300050516 Bacteria 872
407 nmdc:mga0sz30_48517_c1 3300050516 Bacteria 1797
408 Ga0495601_0234686 3300053077 Bacteria 1198
409 Ga0495601_0536162 3300053077 Bacteria 754
410 Ga0500610_0170005 3300053079 Bacteria 1077
411 Ga0500610_0290346 3300053079 Bacteria 728
412 Ga0495655_0037757 3300053083 Bacteria 1215
413 Ga0500578_0319789 3300053086 Bacteria 915
414 Ga0500643_000091 3300053087 Bacteria 93825
415 Ga0500647_0034570 3300053091 Bacteria 2413
416 Ga0500647_0203675 3300053091 Bacteria 896
417 Ga0500651_0022862 3300053093 Bacteria 3909
418 Ga0500651_0127184 3300053093 Bacteria 1543
419 Ga0500566_0000565 3300053094 Bacteria 20802
420 Ga0500566_0075053 3300053094 Bacteria 1892
421 Ga0500640_090846 3300053095 Bacteria 1279
422 Ga0500641_0032316 3300053096 Bacteria 2070
423 Ga0500648_119203 3300053097 Bacteria 1447
424 Ga0500650_0201557 3300053098 Bacteria 906
425 Ga0500555_005028 3300053103 Bacteria 3751
426 Ga0500556_0236085 3300053104 Bacteria 720
427 Ga0500557_000028 3300053105 Bacteria 78414
428 Ga0500562_041566 3300053108 Bacteria 1222
429 Ga0500569_012994 3300053109 Bacteria 2027
430 Ga0500572_008141 3300053111 Bacteria 2443
431 Ga0500594_0051869 3300053118 Bacteria 1158
432 Ga0500594_0084302 3300053118 Bacteria 955
433 Ga0500595_001045 3300053119 Bacteria 15421
434 Ga0500595_012288 3300053119 Bacteria 3317
435 Ga0500595_016234 3300053119 Bacteria 2778
436 Ga0500595_079016 3300053119 Bacteria 965
437 Ga0500642_0000189 3300053130 Bacteria 25159
438 Ga0500642_0002517 3300053130 Bacteria 5395
439 Ga0500642_0022875 3300053130 Bacteria 2501
440 Ga0500655_063340 3300053133 Bacteria 747
441 Ga0500658_0224538 3300053134 Bacteria 861
442 Ga0500559_0001773 3300053136 Bacteria 11840
443 Ga0500559_0083692 3300053136 Bacteria 1453
444 Ga0500559_0413380 3300053136 Bacteria 626
445 Ga0500568_0045356 3300053139 Bacteria 1750
446 Ga0500573_0094932 3300053140 Bacteria 1681
447 Ga0500588_0115296 3300053146 Bacteria 942
448 Ga0500590_124709 3300053148 Bacteria 1201
449 Ga0500616_0268741 3300053153 Bacteria 721
450 Ga0500619_055087 3300053154 Bacteria 1296
451 Ga0500620_010308 3300053155 Bacteria 2453
452 Ga0500622_0138093 3300053156 Bacteria 1165
453 Ga0500622_0226451 3300053156 Bacteria 835
454 Ga0500624_031299 3300053157 Bacteria 916
455 Ga0500639_073533 3300053163 Bacteria 1736
456 Ga0500636_0000246 3300053177 Bacteria 29834
457 Ga0500636_0081311 3300053177 Bacteria 1866
458 Ga0500637_0077321 3300053178 Bacteria 1920
459 Ga0500637_0081529 3300053178 Bacteria 1868
460 Ga0500649_059375 3300053722 Bacteria 1597
461 Ga0500625_010179 3300053729 Bacteria 4218
462 Ga0500552_013201 3300053733 Bacteria 1069
463 Ga0500596_004897 3300053735 Bacteria 2412
464 Ga0500596_013622 3300053735 Bacteria 1227
465 Ga0500599_003473 3300053736 Bacteria 1922
466 Ga0500601_000069 3300053737 Bacteria 21313
467 Ga0501084_0854206 3300054114 Bacteria 766
468 Ga0500661_025636 3300055283 Bacteria 1043
469 2507504746 2507262055 Bacteria 8048963
470 2508546098 2508501009 Bacteria 7784016
471 2508695032 2508501042 Bacteria 8719808
472 2511397008 2511231028 Bacteria 8046582
473 2513626676 2513237092 Bacteria 8341956
474 2513641811 2513237094 Bacteria 8789602
475 2513648068 2513237095 Bacteria 8976980
476 2513715594 2513237104 Bacteria 10034502
477 2513875715 2513237139 Bacteria 8737671
478 2514016381 2513237161 Bacteria 8871253
479 2515625965 2515154112 Bacteria 8294334
480 2517106965 2517093001 Bacteria 9002274
481 2524435637 2524023205 Bacteria 8918781
482 2528850290 2528768022 Bacteria 10457665
483 2617352946 2617270735 Bacteria 9163226
484 2617374234 2617270741 Bacteria 8201522
485 2671119389 2667528175 Bacteria 7532676
486 2745079904 2744054633 Bacteria 8678936
487 2793063206 2791355196 Bacteria 7323613
488 2793073473 2791355197 Bacteria 8420563
489 2793083723
490 2805919391 2802429603 Bacteria 8777136
491 2818237173 2816332527 Bacteria 8933356
492 2824608676 2824600985 Bacteria 8488197
493 2824612753 2824609381 Bacteria 8672835
494 2824626364 2824617872 Bacteria 8814715
495 2824632491 2824626560 Bacteria 8813858
496 2824643643 2824635225 Bacteria 8785348
497 2824652529 2824644064 Bacteria 8743947
498 2824659004 2824653114 Bacteria 8493680
499 2824663557 2824661429 Bacteria 9877870
500 2824677889 2824671348 Bacteria 8369588
501 2824687171 2824679649 Bacteria 8248951
502 2824694609 2824687955 Bacteria 8360029
503 2824702775 2824696289 Bacteria 8335049
504 2824713205 2824704595 Bacteria 9667483
505 2824723307 2824714736 Bacteria 8717648
506 2824732466 2824723954 Bacteria 8758240
507 2824736939 2824732956 Bacteria 7810675
508 2824748231 2824746037 Bacteria 7911610
509 2824760630 2824753945 Bacteria 9787441
510 2824772021 2824763712 Bacteria 9792355
511 2824779868 2824773399 Bacteria 8360218
512 2838129445 2838122688 Bacteria 8803140
513 2841944346 2841941048 Bacteria 8688029
514 2841954477 2841949485 Bacteria 8680857
515 2841965993 2841957949 Bacteria 8652217
516 2841969123 2841966195 Bacteria 8673214
517 2841979897 2841974524 Bacteria 8931498
518 2841990922 2841983080 Bacteria 8395090
519 2842043995 2842038055 Bacteria 8002051
520 2842052016 2842045827 Bacteria 8006841
521 2844321723 2844315083 Bacteria 8138177
522 2847939689 2847930680 Bacteria 9342022
523 2847941642 2847939898 Bacteria 8606328
524 2849082565 2849076700 Bacteria 7039503
525 2857511461 2857509624 Bacteria 7472071
526 2874594297 2874590934 Bacteria 8299676
527 2874615555 2874612657 Bacteria 8252029
528 2874624322 2874620515 Bacteria 8290088
529 2874634083 2874628541 Bacteria 8630250
530 2874647723 2874645413 Bacteria 8214782
531 2876770072 2876761206 Bacteria 10111113
532 2876772605 2876771140 Bacteria 8287509
533 2876819866 2876818435 Bacteria 8274608
534 2879076372 2879074833 Bacteria 8279565
535 2879090508 2879083081 Bacteria 8587928
536 2879101848 2879099564 Bacteria 10442239
537 2879130673 2879127579 Bacteria 8294491
538 2879143145 2879142872 Bacteria 8267021
539 2881364988 2881364244 Bacteria 7710352
540 2881673621 2881665667 Bacteria 8175609
541 2885368106 2885366525 Bacteria 8326213
542 2885380001 2885374607 Bacteria 8927485
543 2888380076 2888378607 Bacteria 9652610
544 2888391135 2888388044 Bacteria 7304136
545 2888420880 2888419890 Bacteria 7857137
546 2889034954 2889033259 Bacteria 9099371
547 2903727731 2903727486 Bacteria 8281579
548 2903755935 2903748898 Bacteria 9972761
549 2904672339 2904666416 Bacteria 8226587
550 2904710056
551 2904717925 2904711408 Bacteria 9771557
552 2906602783 2906602504 Bacteria 8295279
553 2906632412 2906626472 Bacteria 8826946
554 2908746677 2908739725 Bacteria 8628932
555 2908776709 2908775508 Bacteria 8092255
556 2922378458
557 2922400254 2922393267 Bacteria 8285685
558 2929622441 2929615660 Bacteria 9193770
559 2929631342 2929624759 Bacteria 9339455
560 2932786241 2932784394 Bacteria 9704911
561 2932794783 2932794094 Bacteria 7915132
562 2932805407 2932801729 Bacteria 7987968
563 2932812685 2932809354 Bacteria 9135765
564 2932823047 2932818245 Bacteria 9955613
565 2932829479 2932828146 Bacteria 9745859
566 2933584479 2933577622 Bacteria 9116884
567 2935615056 2935608549 Bacteria 8203142
568 2935617997 2935616580 Bacteria 9032984
569 2935641605 2935638405 Bacteria 10015038
570 2935651592 2935648319 Bacteria 8801166
571 2935659640 2935656913 Bacteria 8965014
572 2935669337 2935665750 Bacteria 9571747
573 2935678067 2935675223 Bacteria 9928132
574 2935693614 2935684952 Bacteria 9590419
575 2935701696 2935694250 Bacteria 9291695
576 2935707160 2935703347 Bacteria 10242284
577 2935717003 2935713505 Bacteria 9608509
578 2935730163 2935722832 Bacteria 9608746
579 2935738417 2935732158 Bacteria 9706831
580 2935750205 2935741537 Bacteria 9707219
581 2935759799 2935750917 Bacteria 9590372
582 2935764550 2935760218 Bacteria 9817913
583 2935772872 2935769743 Bacteria 7878163
584 2935777989 2935777560 Bacteria 8077691
585 2935787219 2935785616 Bacteria 7962367
586 2935795993 2935793552 Bacteria 8012592
587 2935804459 2935801545 Bacteria 9301974
588 2935817320 2935810662 Bacteria 9401221
589 2935825906 2935819856 Bacteria 8261050
590 2935831336 2935827899 Bacteria 10038562
591 2935841945 2935837841 Bacteria 9454360
592 2935851525 2935847175 Bacteria 8228321
593 2935856504 2935855204 Bacteria 9035059
594 2935870954 2935864058 Bacteria 9784707
595 2935874470 2935873716 Bacteria 9632195
596 2935887511 2935883170 Bacteria 7964738
597 2935910454 2935908558 Bacteria 8568796
598 2935918252 2935916978 Bacteria 9113783
599 2935927635 2935926038 Bacteria 8601059
600 2935936493 2935934488 Bacteria 8602579
601 2935943954 2935942939 Bacteria 8599779
602 2935952391 2935951376 Bacteria 8602333
603 2935964248 2935959822 Bacteria 7869783
604 2935969231 2935967501 Bacteria 8603075
605 2935978008 2935975950 Bacteria 8347125
606 2935984692 2935984226 Bacteria 8302647
607 2935993931 2935992306 Bacteria 9802711
608 2936005058 2936002035 Bacteria 9362176
609 2936014056 2936011229 Bacteria 8801034
610 2936023035 2936019824 Bacteria 8804134
611 2936031171 2936028420 Bacteria 8965941
612 2936044117 2936037263 Bacteria 9446081
613 2936049293 2936046547 Bacteria 8903709
614 2936055862 2936055302 Bacteria 8785755
615 2940565747 2940556831 Bacteria 9590747
616 2941532256 2941531003 Bacteria 7653939
617 2941544018 2941538514 Bacteria 9402094
618 3005475696 3005474847 Bacteria 9259049
619 3005490985 3005483717 Bacteria 7877331
620 3005509649 3005506211 Bacteria 6943378
621 3005594254 3005587118 Bacteria 7794411
622 3005602072 3005594810 Bacteria 8716512
623 3005717826 3005710791 Bacteria 7622528
624 3005724858 3005718088 Bacteria 8283608
625 8006930754 8006926726 Bacteria 6749210
626 8016518754 8016511872 Bacteria 9921665
627 8016526707 8016522445 Bacteria 8156687
628 8016531791 8016530956 Bacteria 8155261
629 8016557076 8016548790 Bacteria 8155074
630 8016582642 8016575299 Bacteria 8154085
631 8016585826 8016583857 Bacteria 10421953
632 8016603063 8016595262 Bacteria 8149947
633 8016605965 8016603502 Bacteria 8731218
634 8016617850 8016613128 Bacteria 8794220
635 8016623721 8016622563 Bacteria 7999408
636 8016636190 8016630954 Bacteria 9217207
637 8017057923 8017057580 Bacteria 10023680
638 8019539913 8019538911 Bacteria 7872763
639 8019550740 8019547302 Bacteria 7996444
640 8019577801 8019576017 Bacteria 10049540
641 8019595902 8019586578 Bacteria 10212056
642 8019605853 8019597564 Bacteria 10041141
643 8019612680 8019608314 Bacteria 10042931
644 8019622439 8019619141 Bacteria 9218857
645 8019639942 8019638758 Bacteria 9062356
646 8019651966 8019648815 Bacteria 10014479
647 8019667499 8019659431 Bacteria 8577854
648 8019677271 8019668869 Bacteria 8791617
649 8019678711 8019678201 Bacteria 8863603
650 8019696805 8019687851 Bacteria 8712826
651 8055750892 8055742211 Bacteria 9226248
652 8056975576 8056967851 Bacteria 9038162
653 Ga0466964_0230648
654 JGI24739J22299_10061109
655 JGI25153J46596_10000657
656 JGI25153J46596_10008218
657 JGI25160J50197_1000486
658 JGI25160J50197_1011041
659 JGI25404J52841_10010788
660 Ga0055529_1011245
661 Ga0055526_1041721
662 Ga0055531_10007130
663 Ga0055543_1001606
664 Ga0065165_1001966
665 Ga0065165_1002218
666 Ga0065165_1003663
667 Ga0070658_10084641
668 Ga0068869_100227527
669 Ga0070661_100111451
670 Ga0070668_100218819
671 Ga0070668_100555756
672 Ga0070668_100585566
673 Ga0070671_100004121
674 Ga0070667_100026636
675 Ga0070709_10004180
676 Ga0070713_100113086
677 Ga0070713_100734824
678 Ga0070710_10009184
679 Ga0070711_100014471
680 Ga0070705_100368918
681 Ga0070663_100038020
682 Ga0070663_100362178
683 Ga0070663_100386023
684 Ga0068867_100434591
685 Ga0068853_100851321
686 Ga0070693_100496524
687 Ga0070665_100017815
688 Ga0070665_100022309
689 Ga0070665_100728661
690 Ga0068855_100672005
691 Ga0068854_100090384
692 Ga0068854_100127219
693 Ga0068856_100048537
694 Ga0068856_100052457
695 Ga0068856_100693422
696 Ga0070702_100776896
697 Ga0068852_100371243
698 Ga0068861_100276824
699 Ga0068863_100191464
700 Ga0068860_100000629
701 Ga0068860_100447230
702 Ga0068860_100798628
703 Ga0081455_10004380
704 Ga0081455_10050729
705 Ga0081455_10558131
706 Ga0081540_1000663
707 Ga0081540_1004994
708 Ga0081540_1007119
709 Ga0081540_1013959
710 Ga0081540_1071851
711 Ga0081540_1107190
712 Ga0081539_10000902
713 Ga0081539_10175551
714 Ga0070717_10069825
715 Ga0070717_10131974
716 Ga0075365_10026761
717 Ga0075365_10050580
718 Ga0075365_10094603
719 Ga0075365_10110631
720 Ga0075368_10010204
721 Ga0075368_10085351
722 Ga0075363_100021973
723 Ga0075364_10017052
724 Ga0070716_100086700
725 Ga0070716_100264992
726 Ga0070712_100043114
727 Ga0070712_100470241
728 Ga0075362_10065181
729 Ga0075367_10103597
730 Ga0075366_10021518
731 Ga0075366_10026379
732 Ga0097621_100788621
733 Ga0075370_10027768
734 Ga0075370_10035051
735 Ga0099825_1032747
736 Ga0099824_1008958
737 Ga0099822_1044570
738 Ga0075435_100095471
739 Ga0099794_10035878
740 Ga0099794_10083057
741 Ga0099795_10062898
742 Ga0105240_10002869
743 Ga0105240_10564534
744 Ga0105245_10065023
745 Ga0105245_10067476
746 Ga0105247_10016547
747 Ga0105247_10134514
748 Ga0105247_10331234
749 Ga0105237_10050966
750 Ga0105237_10374174
751 Ga0105238_10474298
752 Ga0105238_10979855
753 Ga0099796_10026446
754 Ga0099796_10037369
755 Ga0105239_10045796
756 Ga0105239_10144971
757 Ga0105239_10154204
758 Ga0105239_10324211
759 Ga0105239_11271064
760 Ga0105246_10173968
761 Ga0157370_10315636
762 Ga0157374_10525156
763 Ga0157378_10149421
764 Ga0163162_10092320
765 Ga0157372_10653081
766 Ga0157375_10463026
767 Ga0163163_10408481
768 Ga0182008_10205307
769 Ga0157379_10107462
770 Ga0157376_10638863
771 Ga0182006_1124811
772 Ga0163161_10515133
773 Ga0214544_1000003
774 Ga0214542_1000003
775 Ga0214545_1000004
776 Ga0214543_1000007
777 Ga0213873_10006963
778 Ga0213876_10001113
779 Ga0209563_102406
780 Ga0209677_105081
781 Ga0209148_1000904
782 Ga0209233_1002498
783 Ga0209455_1014906
784 Ga0209564_1002641
785 Ga0209564_1046056
786 Ga0209758_1000015
787 Ga0209758_1000389
788 Ga0209758_1000716
789 Ga0209758_1001131
790 Ga0209758_1042364
791 Ga0209256_1005691
792 Ga0207426_1000380
793 Ga0207426_1000832
794 Ga0207426_1015195
795 Ga0207426_1063987
796 Ga0209257_1001378
797 Ga0209257_1036344
798 Ga0207697_10203874
799 Ga0207656_10186644
800 Ga0207692_10006034
801 Ga0207710_10215574
802 Ga0207688_10129808
803 Ga0207647_10005598
804 Ga0207699_10422839
805 Ga0207699_10565457
806 Ga0207654_10104411
807 Ga0207695_10000065
808 Ga0207671_10002455
809 Ga0207671_10035782
810 Ga0207671_10079524
811 Ga0207693_10044808
812 Ga0207657_10082129
813 Ga0207649_10114842
814 Ga0207681_10461574
815 Ga0207694_10451721
816 Ga0207694_10451864
817 Ga0207664_10015510
818 Ga0207644_10100932
819 Ga0207706_10143394
820 Ga0207665_10040737
821 Ga0207665_10244568
822 Ga0207711_10623192
823 Ga0207679_10826353
824 Ga0207667_10539826
825 Ga0207668_10151617
826 Ga0207668_10557387
827 Ga0207639_10716202
828 Ga0207678_10170318
829 Ga0207678_10202236
830 Ga0207678_10243868
831 Ga0207678_10652403
832 Ga0207702_10442942
833 Ga0207648_10154934
834 Ga0207676_10282909
835 Ga0207674_10461271
836 Ga0207683_10428525
837 Ga0207698_11054859
838 Ga0209389_1000168
839 Ga0209389_1000180
840 Ga0209589_1000570
841 Ga0209489_101190
842 Ga0209489_101411
843 Ga0209700_101443
844 Ga0209813_10008452
845 Ga0268266_10026711
846 Ga0268266_10596114
847 Ga0268264_10000049
848 Ga0268264_10584991
849 Ga0265332_10004766
850 Ga0307509_10015871
851 Ga0307509_10196584
852 Ga0307516_10324669
853 Ga0307516_10375323
854 Ga0307510_10003428
855 Ga0307510_10231821
856 Ga0373923_0328128
857 Ga0373943_0204990
858 Ga0373935_0051160
859 Ga0373927_0070829
860 Ga0373927_0131819
861 Ga0373947_0360184
862 Ga0373937_0047523
863 Ga0373925_0260509
864 Ga0373925_0322514
865 Ga0395899_0019135
866 Ga0395900_0000937
867 Ga0395898_0005127
868 Ga0395905_0003588
869 Ga0395901_0006000
870 Ga0436365_0133064
871 Ga0436365_1032974
872 Ga0436360_0419422
873 Ga0436361_0326411
874 Ga0436363_0595544
875 Ga0436363_1633359
876 Ga0436362_0549978
877 Ga0451791_1361674
878 Ga0451800_0306270
879 Ga0451833_0295131
880 Ga0451843_0212572
881 Ga0466972_0000171
882 Ga0466972_0025991
883 Ga0466972_0108509
884 Ga0466965_0055440
885 Ga0466966_0000287
886 Ga0466961_0000126
887 Ga0466961_0105953
888 Ga0466963_0097828
889 Ga0466968_0208542
890 Ga0466970_0015519
891 Ga0466959_0020395
892 Ga0466967_0733372
893 Ga0495592_0024033
894 Ga0495592_0364976
895 Ga0495603_0168766
896 Ga0495629_0010820
897 Ga0495638_0095236
898 Ga0495641_0148770
899 Ga0495651_0031577
900 Ga0495651_0041817
901 Ga0495653_0066422
902 Ga0495605_0135676
903 Ga0495605_0151406
904 Ga0495639_0067292
905 Ga0495664_0036240
906 Ga0495585_0130992
907 Ga0495594_0277634
908 Ga0495607_0247209
909 Ga0495606_0049462
910 Ga0495606_0068647
911 Ga0495606_0207221
912 Ga0495606_0474323
913 Ga0495608_0314315
914 Ga0495610_0160537
915 Ga0495616_0010409
916 Ga0495620_0102345
917 Ga0495620_0109483
918 Ga0495620_0134591
919 Ga0495628_0010621
920 Ga0495630_0253406
921 Ga0495632_0076674
922 Ga0495643_0010141
923 Ga0495648_0003301
924 Ga0495648_0117813
925 Ga0495652_0005571
926 Ga0495652_0137668
927 Ga0495587_0236605
928 Ga0495609_0170711
929 Ga0495645_0482064
930 Ga0495622_0005984
931 Ga0495622_0016782
932 Ga0495667_0157052
933 Ga0495668_0365471
934 Ga0495625_0073571
935 Ga0495625_0221949
936 Ga0495625_0301860
937 Ga0495635_0001988
938 Ga0495635_0018225
939 Ga0495588_0100757
940 Ga0495657_0017362
941 Ga0495599_0041186
942 Ga0495623_0106486
943 Ga0495646_0026395
944 Ga0495658_0518551
945 Ga0495669_0109322
946 Ga0495613_0241957
947 Ga0495624_0170330
948 Ga0495671_0070841
949 Ga0495671_0148262
950 Ga0495671_0231291
951 Ga0495649_0091849
952 Ga0495600_0001145
953 Ga0495660_0098537
954 Ga0495660_0110295
955 Ga0495581_0137863
956 Ga0495604_0022471
957 Ga0495604_0029345
958 Ga0495604_0408763
959 Ga0495674_0042610
960 Ga0495676_0259534
961 Ga0495680_0009328
962 Ga0495687_006948
963 Ga0495675_0027465
964 Ga0495673_0043853
965 Ga0495686_0024882
966 Ga0495593_0071414
967 Ga0495602_0028430
968 Ga0495602_0151389
969 Ga0495614_0187920
970 Ga0495626_0266408
971 Ga0496100_0059143
972 Ga0496101_0001519
973 Ga0496101_0094810
974 Ga0496101_0304376
975 Ga0496102_0427070
976 Ga0496103_0019895
977 Ga0496104_0024654
978 Ga0496104_0071829
979 Ga0496104_0102941
980 Ga0496104_0291670
981 Ga0496105_0009241
982 Ga0496105_0257413
983 Ga0496105_0335743
984 Ga0496105_0609759
985 Ga0496106_0000545
986 Ga0496106_0158634
987 Ga0496106_0502751
988 Ga0496106_0589859
989 Ga0496107_0150201
990 Ga0496108_0010875
991 Ga0496108_1017281
992 Ga0496109_0456884
993 Ga0496109_0501768
994 Ga0496110_0071333
995 Ga0496110_0171737
996 Ga0496110_0205414
997 Ga0496110_1034604
998 Ga0496111_0391097
999 Ga0496112_0088979
1000 Ga0496112_0090981
1001 Ga0496112_0353313
1002 Ga0496113_0088941
1003 Ga0496113_0194605
1004 Ga0496113_0316158
1005 Ga0496113_0513931
1006 Ga0496114_0079333
1007 Ga0496114_0602441
1008 Ga0496115_0210180
1009 Ga0496115_0784811
1010 Ga0496116_0123308
1011 Ga0496117_0017937
1012 Ga0496118_0004149
1013 Ga0496118_0049821
1014 Ga0496118_0264042
1015 Ga0496118_0274510
1016 Ga0496119_0007759
1017 Ga0496119_0023177
1018 Ga0496119_0260778
1019 Ga0496120_0009651
1020 Ga0496120_0030191
1021 Ga0496120_0278227
1022 Ga0496121_0000261
1023 Ga0496121_0004585
1024 Ga0496121_0120510
1025 Ga0496121_0142685
1026 Ga0496121_0233871
1027 Ga0496122_0143658
1028 Ga0496122_0300528
1029 Ga0496124_0001094
1030 Ga0496124_0035884
1031 Ga0496124_0438729
1032 Ga0496125_0028406
1033 Ga0496125_0101626
1034 Ga0496125_0222084
1035 Ga0496125_0419732
1036 Ga0496126_0004026
1037 Ga0496126_0154307
1038 Ga0496126_0283224
1039 Ga0496126_0459231
1040 Ga0496126_0737352
1041 Ga0495682_0146456
1042 nmdc:mga03683_284201_c1
1043 nmdc:mga03683_63010_c1
1044 nmdc:mga03n38_393712_c1
1045 nmdc:mga03n38_9437_c1
1046 nmdc:mga00v17_179111_c1
1047 nmdc:mga0yw44_201102_c1
1048 nmdc:mga0yw44_44090_c1
1049 nmdc:mga0yw44_64847_c1
1050 nmdc:mga0yw44_66436_c1
1051 nmdc:mga0yw44_8432_c1
1052 nmdc:mga0k408_276159_c1
1053 nmdc:mga06z11_6622_c2
1054 nmdc:mga04h51_9256_c1
1055 nmdc:mga07m45_116596_c1
1056 nmdc:mga07m45_16366_c1
1057 nmdc:mga0rr50_981987_c1
1058 nmdc:mga0sz30_206739_c1
1059 nmdc:mga0sz30_48517_c1
1060 Ga0495601_0234686
1061 Ga0495601_0536162
1062 Ga0500610_0170005
1063 Ga0500610_0290346
1064 Ga0495655_0037757
1065 Ga0500578_0319789
1066 Ga0500643_000091
1067 Ga0500647_0034570
1068 Ga0500647_0203675
1069 Ga0500651_0022862
1070 Ga0500651_0127184
1071 Ga0500566_0000565
1072 Ga0500566_0075053
1073 Ga0500640_090846
1074 Ga0500641_0032316
1075 Ga0500648_119203
1076 Ga0500650_0201557
1077 Ga0500555_005028
1078 Ga0500556_0236085
1079 Ga0500557_000028
1080 Ga0500562_041566
1081 Ga0500569_012994
1082 Ga0500572_008141
1083 Ga0500594_0051869
1084 Ga0500594_0084302
1085 Ga0500595_001045
1086 Ga0500595_012288
1087 Ga0500595_016234
1088 Ga0500595_079016
1089 Ga0500642_0000189
1090 Ga0500642_0002517
1091 Ga0500642_0022875
1092 Ga0500655_063340
1093 Ga0500658_0224538
1094 Ga0500559_0001773
1095 Ga0500559_0083692
1096 Ga0500559_0413380
1097 Ga0500568_0045356
1098 Ga0500573_0094932
1099 Ga0500588_0115296
1100 Ga0500590_124709
1101 Ga0500616_0268741
1102 Ga0500619_055087
1103 Ga0500620_010308
1104 Ga0500622_0138093
1105 Ga0500622_0226451
1106 Ga0500624_031299
1107 Ga0500639_073533
1108 Ga0500636_0000246
1109 Ga0500636_0081311
1110 Ga0500637_0077321
1111 Ga0500637_0081529
1112 Ga0500649_059375
1113 Ga0500625_010179
1114 Ga0500552_013201
1115 Ga0500596_004897
1116 Ga0500596_013622
1117 Ga0500599_003473
1118 Ga0500601_000069
1119 Ga0501084_0854206
1120 Ga0500661_025636
1121 2507504746
1122 2508546098
1123 2508695032
1124 2511397008
1125 2513626676
1126 2513641811
1127 2513648068
1128 2513715594
1129 2513875715
1130 2514016381
1131 2515625965
1132 2517106965
1133 2524435637
1134 2528850290
1135 2617352946
1136 2617374234
1137 2671119389
1138 2745079904
1139 2793063206
1140 2793073473
1141 2793083723
1142 2805919391
1143 2818237173
1144 2824608676
1145 2824612753
1146 2824626364
1147 2824632491
1148 2824643643
1149 2824652529
1150 2824659004
1151 2824663557
1152 2824677889
1153 2824687171
1154 2824694609
1155 2824702775
1156 2824713205
1157 2824723307
1158 2824732466
1159 2824736939
1160 2824748231
1161 2824760630
1162 2824772021
1163 2824779868
1164 2838129445
1165 2841944346
1166 2841954477
1167 2841965993
1168 2841969123
1169 2841979897
1170 2841990922
1171 2842043995
1172 2842052016
1173 2844321723
1174 2847939689
1175 2847941642
1176 2849082565
1177 2857511461
1178 2874594297
1179 2874615555
1180 2874624322
1181 2874634083
1182 2874647723
1183 2876770072
1184 2876772605
1185 2876819866
1186 2879076372
1187 2879090508
1188 2879101848
1189 2879130673
1190 2879143145
1191 2881364988
1192 2881673621
1193 2885368106
1194 2885380001
1195 2888380076
1196 2888391135
1197 2888420880
1198 2889034954
1199 2903727731
1200 2903755935
1201 2904672339
1202 2904710056
1203 2904717925
1204 2906602783
1205 2906632412
1206 2908746677
1207 2908776709
1208 2922378458
1209 2922400254
1210 2929622441
1211 2929631342
1212 2932786241
1213 2932794783
1214 2932805407
1215 2932812685
1216 2932823047
1217 2932829479
1218 2933584479
1219 2935615056
1220 2935617997
1221 2935641605
1222 2935651592
1223 2935659640
1224 2935669337
1225 2935678067
1226 2935693614
1227 2935701696
1228 2935707160
1229 2935717003
1230 2935730163
1231 2935738417
1232 2935750205
1233 2935759799
1234 2935764550
1235 2935772872
1236 2935777989
1237 2935787219
1238 2935795993
1239 2935804459
1240 2935817320
1241 2935825906
1242 2935831336
1243 2935841945
1244 2935851525
1245 2935856504
1246 2935870954
1247 2935874470
1248 2935887511
1249 2935910454
1250 2935918252
1251 2935927635
1252 2935936493
1253 2935943954
1254 2935952391
1255 2935964248
1256 2935969231
1257 2935978008
1258 2935984692
1259 2935993931
1260 2936005058
1261 2936014056
1262 2936023035
1263 2936031171
1264 2936044117
1265 2936049293
1266 2936055862
1267 2940565747
1268 2941532256
1269 2941544018
1270 3005475696
1271 3005490985
1272 3005509649
1273 3005594254
1274 3005602072
1275 3005717826
1276 3005724858
1277 8006930754
1278 8016518754
1279 8016526707
1280 8016531791
1281 8016557076
1282 8016582642
1283 8016585826
1284 8016603063
1285 8016605965
1286 8016617850
1287 8016623721
1288 8016636190
1289 8017057923
1290 8019539913
1291 8019550740
1292 8019577801
1293 8019595902
1294 8019605853
1295 8019612680
1296 8019622439
1297 8019639942
1298 8019651966
1299 8019667499
1300 8019677271
1301 8019678711
1302 8019696805
1303 8055750892
1304 8056975576

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

88

164

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8403 5 169
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8321 5 168
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.8258 2 171
4zyd-assembly2.cif.gz_A-3 crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna 0.8236 5 171
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.8213 2 171
ID Description Score Start End Superfamily
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9136 87 171 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.898 87 168 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8888 87 169 1.10.10.10
af_E9QIW2_242_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8826 86 128 1.10.10.10
af_P26187_90_179_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8781 87 169 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2R7NXB5-F1-model_v4 Cysteine methyltransferase 0.9481 2 150 GO:0003908
GO:0006281
GO:0032259
AF-A0A7Y4ZKF0-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9464 2 168 GO:0003908
GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032259
GO:0032993
GO:0043916
AF-A0A1S7M6I6-F1-model_v4 deleted 0.9439 3 170
AF-A0A6L3E3I1-F1-model_v4 deleted 0.9435 3 170
AF-A0A431RJJ5-F1-model_v4 deleted 0.938 1 134

Map