F472659

General Info

Members Datasets Scaffolds Average Seq Length
652 368 1304 70

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10005313|Ga0070666_1000531311
Length 84
Sequence MGRKRPQYKPQTDKEKGIEVEGVVLENLPNARFRIKLDEGDIEILAHVSGKMRMNYIRILPGDRVRAEMSPYDLTRGRIVYRYK

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
171 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
172 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
201 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
232 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
233 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
290 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
291 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
292 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
293 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
313 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
314 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
315 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
316 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
317 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
318 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
319 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
320 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
321 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
322 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
323 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
324 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
325 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
326 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
327 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
334 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
335 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
336 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
337 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
338 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 4.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 3.99
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10005313 3300005335 Bacteria 7893
2 bgg_mtDRAFT_1052403 3300000305 Bacteria 1052
3 JGI24736J21556_1007549 3300001904 Bacteria 1825
4 JGI24746J21847_1067537 3300001977 Unclassified 517
5 JGI24742J22300_10084749 3300002244 Bacteria 602
6 rootH2_10116081 3300003320 Bacteria 2757
7 JGI25407J50210_10059979 3300003373 Bacteria 957
8 JGI25407J50210_10153175 3300003373 Bacteria 568
9 Ga0007429J51699_1069582 3300003579 Bacteria 528
10 Ga0058863_11402763 3300004799 Bacteria 826
11 Ga0058860_12157441 3300004801 Bacteria 502
12 Ga0065712_10644291 3300005290 Bacteria 570
13 Ga0070683_100496416 3300005329 Bacteria 1166
14 Ga0070690_100140937 3300005330 Bacteria 1636
15 Ga0070670_100271006 3300005331 Bacteria 1481
16 Ga0068869_101414079 3300005334 Bacteria 616
17 Ga0068869_101890544 3300005334 Bacteria 535
18 Ga0070666_10397173 3300005335 Bacteria 991
19 Ga0070666_11111243 3300005335 Bacteria 588
20 Ga0070682_100649155 3300005337 Bacteria 840
21 Ga0068868_100118877 3300005338 Bacteria 2154
22 Ga0068868_100306319 3300005338 Bacteria 1350
23 Ga0068868_100310411 3300005338 Bacteria 1342
24 Ga0068868_101676088 3300005338 Bacteria 599
25 Ga0070660_100001553 3300005339 Bacteria 15769
26 Ga0070689_100021396 3300005340 Bacteria 4815
27 Ga0070689_100290071 3300005340 Bacteria 1359
28 Ga0070689_100501623 3300005340 Bacteria 1040
29 Ga0070689_101518580 3300005340 Bacteria 607
30 Ga0070689_101581959 3300005340 Bacteria 595
31 Ga0070691_10410696 3300005341 Bacteria 765
32 Ga0070687_100070909 3300005343 Bacteria 1871
33 Ga0070687_100182552 3300005343 Bacteria 1258
34 Ga0070661_100934457 3300005344 Bacteria 717
35 Ga0070661_101401684 3300005344 Bacteria 588
36 Ga0070668_100517121 3300005347 Bacteria 1035
37 Ga0070668_100518504 3300005347 Bacteria 1034
38 Ga0070668_101868813 3300005347 Bacteria 553
39 Ga0070669_100305467 3300005353 Bacteria 1281
40 Ga0070675_100582466 3300005354 Bacteria 1014
41 Ga0070671_100643580 3300005355 Bacteria 918
42 Ga0070671_100805456 3300005355 Bacteria 818
43 Ga0070674_100016454 3300005356 Bacteria 4636
44 Ga0070674_100125926 3300005356 Bacteria 1903
45 Ga0070674_102089203 3300005356 Bacteria 517
46 Ga0070673_100385167 3300005364 Bacteria 1251
47 Ga0070673_101963978 3300005364 Unclassified 555
48 Ga0070667_100052445 3300005367 Bacteria 3442
49 Ga0070667_100282870 3300005367 Bacteria 1490
50 Ga0070667_101077454 3300005367 Bacteria 751
51 Ga0070714_102405882 3300005435 Bacteria 512
52 Ga0070710_10098746 3300005437 Bacteria 1735
53 Ga0070710_10553549 3300005437 Bacteria 795
54 Ga0070701_10927633 3300005438 Bacteria 603
55 Ga0070711_100391752 3300005439 Bacteria 1126
56 Ga0070705_100162368 3300005440 Bacteria 1495
57 Ga0070705_100875005 3300005440 Bacteria 721
58 Ga0070705_101005936 3300005440 Bacteria 677
59 Ga0070700_100271378 3300005441 Bacteria 1226
60 Ga0070694_100447918 3300005444 Bacteria 1019
61 Ga0070678_101060729 3300005456 Bacteria 747
62 Ga0070678_101137786 3300005456 Bacteria 722
63 Ga0070678_101617400 3300005456 Bacteria 608
64 Ga0070662_100797406 3300005457 Bacteria 803
65 Ga0068867_100002530 3300005459 Bacteria 12866
66 Ga0068867_100515787 3300005459 Bacteria 1030
67 Ga0070706_101800815 3300005467 Bacteria 557
68 Ga0070707_101178471 3300005468 Bacteria 732
69 Ga0070679_101106355 3300005530 Bacteria 737
70 Ga0070679_102010913 3300005530 Bacteria 527
71 Ga0070697_101063917 3300005536 Bacteria 720
72 Ga0070672_100077749 3300005543 Bacteria 2654
73 Ga0070686_100054427 3300005544 Bacteria 2560
74 Ga0070686_100716190 3300005544 Bacteria 800
75 Ga0070686_100802666 3300005544 Bacteria 759
76 Ga0070695_100558028 3300005545 Bacteria 894
77 Ga0070696_100788763 3300005546 Bacteria 781
78 Ga0070693_100876925 3300005547 Bacteria 671
79 Ga0070665_100129462 3300005548 Bacteria 2526
80 Ga0070665_100977831 3300005548 Bacteria 859
81 Ga0070665_101681409 3300005548 Bacteria 642
82 Ga0070665_102196551 3300005548 Bacteria 556
83 Ga0070704_101067589 3300005549 Bacteria 732
84 Ga0068855_101692480 3300005563 Bacteria 645
85 Ga0068854_100147012 3300005578 Bacteria 1814
86 Ga0070702_100840292 3300005615 Bacteria 714
87 Ga0070702_101416389 3300005615 Bacteria 569
88 Ga0068852_100557502 3300005616 Bacteria 1147
89 Ga0068859_100163205 3300005617 Bacteria 2307
90 Ga0068859_101402468 3300005617 Bacteria 770
91 Ga0068859_103132466 3300005617 Bacteria 504
92 Ga0068864_100466181 3300005618 Bacteria 1210
93 Ga0068864_100588372 3300005618 Bacteria 1079
94 Ga0068861_100300548 3300005719 Bacteria 1390
95 Ga0068870_10438218 3300005840 Bacteria 859
96 Ga0068870_10934375 3300005840 Bacteria 615
97 Ga0068863_100626179 3300005841 Bacteria 1066
98 Ga0068863_102128419 3300005841 Bacteria 571
99 Ga0068858_100115807 3300005842 Bacteria 2505
100 Ga0068858_100313173 3300005842 Bacteria 1499
101 Ga0068858_100369244 3300005842 Bacteria 1376
102 Ga0068858_101496022 3300005842 Bacteria 666
103 Ga0068860_100021615 3300005843 Bacteria 6230
104 Ga0068860_100033975 3300005843 Bacteria 4892
105 Ga0068860_100782294 3300005843 Bacteria 967
106 Ga0068860_102603369 3300005843 Bacteria 525
107 Ga0068862_100009288 3300005844 Bacteria 8138
108 Ga0068862_100128476 3300005844 Bacteria 2240
109 Ga0068862_100813633 3300005844 Bacteria 913
110 Ga0068862_101613511 3300005844 Bacteria 656
111 Ga0081538_10020098 3300005981 Bacteria 4932
112 Ga0081538_10022736 3300005981 Bacteria 4532
113 Ga0081538_10082674 3300005981 Bacteria 1701
114 Ga0081539_10072530 3300005985 Bacteria 1840
115 Ga0081539_10429642 3300005985 Bacteria 548
116 Ga0075364_10348061 3300006051 Bacteria 1010
117 Ga0070716_100535885 3300006173 Bacteria 870
118 Ga0070716_101376257 3300006173 Bacteria 573
119 Ga0070712_100075701 3300006175 Bacteria 2421
120 Ga0075369_10035804 3300006186 Bacteria 2111
121 Ga0075366_10532434 3300006195 Bacteria 727
122 Ga0097621_100513655 3300006237 Bacteria 1087
123 Ga0075370_10225357 3300006353 Bacteria 1108
124 Ga0068871_100033556 3300006358 Bacteria 4066
125 Ga0068871_100503212 3300006358 Bacteria 1092
126 Ga0068871_101324509 3300006358 Bacteria 678
127 Ga0075433_11019618 3300006852 Bacteria 721
128 Ga0075434_100569999 3300006871 Bacteria 1152
129 Ga0075434_101939679 3300006871 Bacteria 595
130 Ga0068865_100035387 3300006881 Bacteria 3357
131 Ga0068865_100092690 3300006881 Bacteria 2195
132 Ga0068865_100565540 3300006881 Bacteria 957
133 Ga0097620_100163209 3300006931 Bacteria 2307
134 Ga0097620_101402428 3300006931 Bacteria 770
135 Ga0097620_103133303 3300006931 Bacteria 504
136 Ga0075435_100076334 3300007076 Bacteria 2745
137 Ga0075435_100546858 3300007076 Bacteria 1002
138 Ga0105250_10206438 3300009092 Bacteria 830
139 Ga0105250_10223973 3300009092 Bacteria 798
140 Ga0105240_10200290 3300009093 Bacteria 2340
141 Ga0105240_12170434 3300009093 Bacteria 576
142 Ga0111539_10206788 3300009094 Bacteria 2288
143 Ga0111539_10448342 3300009094 Bacteria 1503
144 Ga0111539_10493398 3300009094 Bacteria 1426
145 Ga0111539_10691078 3300009094 Bacteria 1188
146 Ga0111539_10786274 3300009094 Bacteria 1108
147 Ga0105245_10082473 3300009098 Bacteria 2941
148 Ga0105245_10673540 3300009098 Bacteria 1066
149 Ga0105245_10712368 3300009098 Bacteria 1037
150 Ga0105245_11885849 3300009098 Unclassified 651
151 Ga0105245_13206765 3300009098 Bacteria 507
152 Ga0105247_10191118 3300009101 Bacteria 1371
153 Ga0105247_10718569 3300009101 Bacteria 754
154 Ga0114129_10031111 3300009147 Bacteria 7549
155 Ga0105243_10062864 3300009148 Bacteria 2973
156 Ga0105243_10311217 3300009148 Bacteria 1431
157 Ga0105243_10333269 3300009148 Bacteria 1387
158 Ga0105243_11058430 3300009148 Bacteria 817
159 Ga0105243_12553938 3300009148 Bacteria 550
160 Ga0105241_11195579 3300009174 Bacteria 720
161 Ga0105241_11601316 3300009174 Bacteria 630
162 Ga0105242_10012654 3300009176 Bacteria 6497
163 Ga0105242_10048621 3300009176 Bacteria 3448
164 Ga0105242_10227333 3300009176 Bacteria 1670
165 Ga0105242_10289121 3300009176 Bacteria 1492
166 Ga0105242_10352803 3300009176 Bacteria 1359
167 Ga0105242_12501345 3300009176 Bacteria 565
168 Ga0105248_10798576 3300009177 Bacteria 1065
169 Ga0105248_11085017 3300009177 Bacteria 905
170 Ga0105248_11572517 3300009177 Bacteria 745
171 Ga0105237_11600637 3300009545 Bacteria 658
172 Ga0105237_11899649 3300009545 Bacteria 603
173 Ga0105238_10067902 3300009551 Bacteria 3566
174 Ga0105238_11115885 3300009551 Bacteria 812
175 Ga0105249_10037678 3300009553 Bacteria 4388
176 Ga0105249_12124357 3300009553 Bacteria 634
177 Ga0099796_10398167 3300010159 Bacteria 603
178 Ga0105239_10343886 3300010375 Bacteria 1684
179 Ga0105246_10161171 3300011119 Bacteria 1709
180 Ga0105246_10408250 3300011119 Bacteria 1130
181 Ga0105246_11008660 3300011119 Bacteria 754
182 Ga0105246_11857874 3300011119 Bacteria 577
183 Ga0157370_10973621 3300013104 Bacteria 769
184 Ga0157370_11194333 3300013104 Bacteria 686
185 Ga0157369_10523225 3300013105 Bacteria 1227
186 Ga0157369_12156469 3300013105 Bacteria 565
187 Ga0157369_12410973 3300013105 Bacteria 533
188 Ga0157374_10556033 3300013296 Bacteria 1155
189 Ga0157374_10984640 3300013296 Bacteria 862
190 Ga0157374_11076256 3300013296 Bacteria 824
191 Ga0157374_12051666 3300013296 Bacteria 598
192 Ga0157374_12340115 3300013296 Bacteria 561
193 Ga0157378_10731323 3300013297 Bacteria 1011
194 Ga0157378_11103676 3300013297 Bacteria 830
195 Ga0157378_12106881 3300013297 Bacteria 615
196 Ga0163162_10359063 3300013306 Bacteria 1590
197 Ga0163162_10774452 3300013306 Bacteria 1078
198 Ga0163162_13087731 3300013306 Bacteria 535
199 Ga0163162_13422070 3300013306 Bacteria 506
200 Ga0157375_10105922 3300013308 Bacteria 2903
201 Ga0157375_10362501 3300013308 Bacteria 1616
202 Ga0157375_11042910 3300013308 Bacteria 956
203 Ga0157375_11784762 3300013308 Bacteria 729
204 Ga0157375_12967768 3300013308 Bacteria 566
205 Ga0163163_10735633 3300014325 Bacteria 1050
206 Ga0163163_12036037 3300014325 Bacteria 634
207 Ga0163163_12230515 3300014325 Bacteria 607
208 Ga0157380_10252404 3300014326 Bacteria 1597
209 Ga0157380_10763458 3300014326 Bacteria 980
210 Ga0157380_11208815 3300014326 Bacteria 800
211 Ga0157380_11762084 3300014326 Bacteria 678
212 Ga0157380_13146174 3300014326 Bacteria 527
213 Ga0157377_10463674 3300014745 Bacteria 877
214 Ga0157379_10032947 3300014968 Bacteria 4620
215 Ga0157379_10403569 3300014968 Bacteria 1257
216 Ga0157376_10290930 3300014969 Bacteria 1542
217 Ga0163161_10116827 3300017792 Bacteria 2000
218 Ga0163161_11385843 3300017792 Bacteria 614
219 Ga0163161_12053015 3300017792 Unclassified 508
220 Ga0206356_10722364 3300020070 Bacteria 685
221 Ga0206349_1322283 3300020075 Bacteria 3864
222 Ga0206349_1769697 3300020075 Unclassified 555
223 Ga0206355_1648489 3300020076 Bacteria 638
224 Ga0206351_10978857 3300020077 Bacteria 582
225 Ga0206352_10123243 3300020078 Bacteria 720
226 Ga0206352_10183140 3300020078 Bacteria 613
227 Ga0206354_10262825 3300020081 Bacteria 740
228 Ga0206354_11712338 3300020081 Bacteria 755
229 Ga0206353_11040041 3300020082 Bacteria 549
230 Ga0213872_10187769 3300021361 Bacteria 890
231 Ga0207666_1020430 3300025271 Bacteria 972
232 Ga0207697_10101666 3300025315 Bacteria 1225
233 Ga0207692_10366006 3300025898 Bacteria 892
234 Ga0207642_10002029 3300025899 Bacteria 6246
235 Ga0207710_10136098 3300025900 Bacteria 1183
236 Ga0207680_10001542 3300025903 Bacteria 10846
237 Ga0207680_10879858 3300025903 Bacteria 642
238 Ga0207645_10327457 3300025907 Bacteria 1023
239 Ga0207643_10031249 3300025908 Bacteria 2967
240 Ga0207705_11497917 3300025909 Bacteria 511
241 Ga0207707_10472544 3300025912 Bacteria 1071
242 Ga0207695_10164548 3300025913 Bacteria 2147
243 Ga0207695_11579154 3300025913 Bacteria 537
244 Ga0207693_10058810 3300025915 Bacteria 3011
245 Ga0207662_10015067 3300025918 Bacteria 4345
246 Ga0207662_10978211 3300025918 Bacteria 600
247 Ga0207657_10009140 3300025919 Bacteria 10000
248 Ga0207652_11139461 3300025921 Bacteria 681
249 Ga0207646_11541571 3300025922 Bacteria 575
250 Ga0207681_10033390 3300025923 Bacteria 3374
251 Ga0207694_10144238 3300025924 Bacteria 1916
252 Ga0207694_10769368 3300025924 Bacteria 813
253 Ga0207650_10108942 3300025925 Bacteria 2142
254 Ga0207650_11330154 3300025925 Bacteria 611
255 Ga0207650_11541751 3300025925 Bacteria 564
256 Ga0207659_10278143 3300025926 Bacteria 1368
257 Ga0207659_10914498 3300025926 Bacteria 754
258 Ga0207687_10170724 3300025927 Bacteria 1677
259 Ga0207687_10416595 3300025927 Bacteria 1108
260 Ga0207644_10228588 3300025931 Bacteria 1477
261 Ga0207644_11823813 3300025931 Bacteria 509
262 Ga0207690_10362984 3300025932 Bacteria 1148
263 Ga0207690_10617594 3300025932 Bacteria 886
264 Ga0207686_10011426 3300025934 Bacteria 4862
265 Ga0207686_10269590 3300025934 Bacteria 1252
266 Ga0207686_10471253 3300025934 Bacteria 969
267 Ga0207686_10498984 3300025934 Bacteria 944
268 Ga0207709_10071910 3300025935 Bacteria 2198
269 Ga0207709_10074978 3300025935 Bacteria 2161
270 Ga0207709_10406749 3300025935 Bacteria 1042
271 Ga0207670_10187553 3300025936 Bacteria 1562
272 Ga0207670_10293256 3300025936 Bacteria 1271
273 Ga0207670_11387742 3300025936 Bacteria 596
274 Ga0207669_10057949 3300025937 Bacteria 2361
275 Ga0207704_10004160 3300025938 Bacteria 6599
276 Ga0207704_10393555 3300025938 Bacteria 1091
277 Ga0207704_11153449 3300025938 Bacteria 660
278 Ga0207665_10281190 3300025939 Bacteria 1238
279 Ga0207665_10515760 3300025939 Bacteria 925
280 Ga0207665_10557083 3300025939 Bacteria 891
281 Ga0207691_10121532 3300025940 Bacteria 2314
282 Ga0207689_10433162 3300025942 Bacteria 1098
283 Ga0207661_10913313 3300025944 Bacteria 809
284 Ga0207667_11182307 3300025949 Bacteria 745
285 Ga0207651_10840541 3300025960 Bacteria 815
286 Ga0207712_10019857 3300025961 Bacteria 4392
287 Ga0207712_10111926 3300025961 Bacteria 2049
288 Ga0207668_10250251 3300025972 Bacteria 1439
289 Ga0207668_10314621 3300025972 Bacteria 1297
290 Ga0207640_10254812 3300025981 Bacteria 1364
291 Ga0207640_11251896 3300025981 Bacteria 661
292 Ga0207658_10057969 3300025986 Bacteria 2880
293 Ga0207658_10514718 3300025986 Bacteria 1067
294 Ga0207658_10517925 3300025986 Bacteria 1064
295 Ga0207658_11137935 3300025986 Bacteria 713
296 Ga0207658_11203174 3300025986 Bacteria 693
297 Ga0207677_10054605 3300026023 Bacteria 2727
298 Ga0207677_10585281 3300026023 Bacteria 977
299 Ga0207677_10809783 3300026023 Bacteria 839
300 Ga0207677_11102911 3300026023 Bacteria 723
301 Ga0207677_11130746 3300026023 Bacteria 715
302 Ga0207703_10127047 3300026035 Bacteria 2197
303 Ga0207703_10966257 3300026035 Bacteria 817
304 Ga0207639_10346105 3300026041 Bacteria 1326
305 Ga0207708_10013401 3300026075 Bacteria 6127
306 Ga0207708_10081745 3300026075 Bacteria 2483
307 Ga0207708_10206927 3300026075 Bacteria 1567
308 Ga0207641_12242808 3300026088 Bacteria 546
309 Ga0207648_10432110 3300026089 Bacteria 1197
310 Ga0207648_11455853 3300026089 Bacteria 644
311 Ga0207648_11545046 3300026089 Bacteria 624
312 Ga0207676_10392828 3300026095 Bacteria 1294
313 Ga0207675_100089987 3300026118 Bacteria 2885
314 Ga0207675_101960581 3300026118 Bacteria 604
315 Ga0207683_10196443 3300026121 Bacteria 1833
316 Ga0207683_10800700 3300026121 Bacteria 875
317 Ga0207683_11831842 3300026121 Bacteria 556
318 Ga0209813_10024614 3300027866 Bacteria 1724
319 Ga0207428_10987283 3300027907 Bacteria 592
320 Ga0268266_10413379 3300028379 Bacteria 1277
321 Ga0268265_10133068 3300028380 Bacteria 2070
322 Ga0268265_10195463 3300028380 Bacteria 1750
323 Ga0268265_10831923 3300028380 Bacteria 902
324 Ga0268265_11458068 3300028380 Bacteria 687
325 Ga0268264_10069696 3300028381 Bacteria 2975
326 Ga0268264_10073731 3300028381 Bacteria 2898
327 Ga0268264_10409275 3300028381 Bacteria 1305
328 Ga0268264_10617353 3300028381 Bacteria 1070
329 Ga0268264_10998697 3300028381 Bacteria 843
330 Ga0265319_1047161 3300028563 Bacteria 1435
331 Ga0265334_10086231 3300028573 Bacteria 1151
332 Ga0265334_10142738 3300028573 Bacteria 847
333 Ga0265334_10268859 3300028573 Bacteria 586
334 Ga0265318_10010316 3300028577 Bacteria 4073
335 Ga0265318_10204325 3300028577 Bacteria 722
336 Ga0265318_10216941 3300028577 Bacteria 699
337 Ga0265318_10352121 3300028577 Unclassified 537
338 Ga0265338_10000149 3300028800 Bacteria 127027
339 Ga0265338_10267468 3300028800 Bacteria 1254
340 Ga0314311_1151127 3300030733 Bacteria 666
341 Ga0316183_1051683 3300030742 Bacteria 618
342 Ga0316181_1169834 3300030744 Bacteria 801
343 Ga0265332_10007273 3300031238 Bacteria 5008
344 Ga0265328_10298685 3300031239 Bacteria 622
345 Ga0265320_10032179 3300031240 Bacteria 2688
346 Ga0265320_10515925 3300031240 Bacteria 528
347 Ga0265325_10005182 3300031241 Bacteria 8099
348 Ga0265329_10159113 3300031242 Bacteria 734
349 Ga0265329_10195905 3300031242 Bacteria 664
350 Ga0265340_10128027 3300031247 Bacteria 1166
351 Ga0265340_10457723 3300031247 Bacteria 562
352 Ga0265339_10009201 3300031249 Bacteria 6231
353 Ga0265339_10089782 3300031249 Bacteria 1612
354 Ga0265331_10002189 3300031250 Bacteria 13411
355 Ga0265331_10089053 3300031250 Bacteria 1427
356 Ga0265327_10198442 3300031251 Bacteria 910
357 Ga0265316_10005991 3300031344 Bacteria 11698
358 Ga0265316_10081752 3300031344 Bacteria 2476
359 Ga0265316_10175775 3300031344 Bacteria 1596
360 Ga0307408_100310055 3300031548 Bacteria 1325
361 Ga0265313_10003941 3300031595 Bacteria 11679
362 Ga0265314_10031471 3300031711 Bacteria 3916
363 Ga0265314_10113052 3300031711 Bacteria 1722
364 Ga0265314_10561220 3300031711 Bacteria 593
365 Ga0265342_10003312 3300031712 Bacteria 13303
366 Ga0265342_10278380 3300031712 Bacteria 886
367 Ga0316576_10090764 3300031727 Bacteria 2276
368 Ga0316576_10275574 3300031727 Bacteria 1260
369 Ga0316576_10571964 3300031727 Bacteria 827
370 Ga0316576_10732474 3300031727 Bacteria 715
371 Ga0316578_10244818 3300031728 Bacteria 1076
372 Ga0307405_10364308 3300031731 Bacteria 1120
373 Ga0307413_10052889 3300031824 Bacteria 2456
374 Ga0307413_10326126 3300031824 Bacteria 1175
375 Ga0307410_10054263 3300031852 Bacteria 2716
376 Ga0307410_10175784 3300031852 Bacteria 1617
377 Ga0307410_10609815 3300031852 Bacteria 911
378 Ga0326468_10088266 3300031889 Bacteria 549
379 Ga0307406_10791831 3300031901 Bacteria 799
380 Ga0307406_11198320 3300031901 Bacteria 659
381 Ga0307406_12128610 3300031901 Bacteria 503
382 Ga0307407_10329599 3300031903 Bacteria 1074
383 Ga0307409_100092397 3300031995 Bacteria 2483
384 Ga0307409_100336532 3300031995 Bacteria 1418
385 Ga0307409_100547726 3300031995 Bacteria 1135
386 Ga0307409_101195668 3300031995 Bacteria 783
387 Ga0307409_102899124 3300031995 Bacteria 507
388 Ga0307416_100076811 3300032002 Bacteria 2801
389 Ga0307416_100236774 3300032002 Bacteria 1765
390 Ga0307416_100343119 3300032002 Bacteria 1507
391 Ga0307416_101086092 3300032002 Bacteria 904
392 Ga0307416_101597224 3300032002 Bacteria 757
393 Ga0307416_102063181 3300032002 Bacteria 672
394 Ga0307416_103227806 3300032002 Bacteria 546
395 Ga0307416_103246371 3300032002 Bacteria 544
396 Ga0307414_10054992 3300032004 Bacteria 2785
397 Ga0307414_10095671 3300032004 Bacteria 2220
398 Ga0307414_10179851 3300032004 Bacteria 1700
399 Ga0307414_10693317 3300032004 Bacteria 921
400 Ga0307414_10722699 3300032004 Bacteria 903
401 Ga0307411_10096077 3300032005 Bacteria 2082
402 Ga0307411_10175852 3300032005 Bacteria 1620
403 Ga0307411_10442147 3300032005 Bacteria 1085
404 Ga0307415_100174324 3300032126 Bacteria 1680
405 Ga0307415_100425461 3300032126 Bacteria 1141
406 Ga0307415_100483993 3300032126 Bacteria 1078
407 Ga0307415_100610177 3300032126 Bacteria 972
408 Ga0316583_10002317 3300032133 Bacteria 6567
409 Ga0316583_10123659 3300032133 Bacteria 902
410 Ga0316593_10004176 3300032168 Bacteria 3677
411 Ga0316592_1079161 3300033524 Unclassified 747
412 Ga0373926_0022817 3300035083 Bacteria 2172
413 Ga0373944_0107504 3300035089 Bacteria 949
414 Ga0373936_0190634 3300035113 Bacteria 902
415 Ga0373953_0225792 3300035117 Bacteria 812
416 Ga0373957_0305792 3300035120 Bacteria 675
417 Ga0373943_0059022 3300035170 Bacteria 1911
418 Ga0373946_0111300 3300035171 Bacteria 1240
419 Ga0373955_0280793 3300035172 Bacteria 1002
420 Ga0373955_0815803 3300035172 Bacteria 574
421 Ga0373942_0155243 3300035207 Bacteria 737
422 Ga0316574_0032055 3300035398 Bacteria 3192
423 Ga0316574_0254953 3300035398 Bacteria 1121
424 Ga0316574_0338947 3300035398 Bacteria 953
425 Ga0316574_0608402 3300035398 Bacteria 675
426 Ga0316574_0814478 3300035398 Bacteria 568
427 Ga0373935_0275973 3300035692 Bacteria 1182
428 Ga0373927_0461278 3300035695 Bacteria 839
429 Ga0373933_0302728 3300035724 Bacteria 1035
430 Ga0373933_0482502 3300035724 Bacteria 812
431 Ga0373947_0345173 3300035725 Bacteria 998
432 Ga0373947_0765919 3300035725 Bacteria 659
433 Ga0373937_0117033 3300036401 Bacteria 2482
434 Ga0373937_0382862 3300036401 Bacteria 1334
435 Ga0316582_0180409 3300036647 Unclassified 1436
436 Ga0316584_0005236 3300036712 Bacteria 8675
437 Ga0316584_0083522 3300036712 Bacteria 2392
438 Ga0373925_0070485 3300037068 Bacteria 2642
439 Ga0373925_1333517 3300037068 Bacteria 588
440 Ga0395905_0432530 3300037471 Bacteria 1213
441 Ga0400489_53335 3300039093 Bacteria 1092
442 Ga0400489_72484 3300039093 Bacteria 1220
443 Ga0436365_0661327 3300039437 Bacteria 618
444 Ga0436365_1436184 3300039437 Bacteria 5972
445 Ga0436361_0174152 3300039447 Bacteria 11450
446 Ga0439461_0168841 3300041410 Bacteria 574
447 Ga0439466_0071834 3300041411 Bacteria 1101
448 Ga0451789_0713496 3300041443 Bacteria 506
449 Ga0451797_0999249 3300041453 Bacteria 700
450 Ga0451795_0393529 3300041456 Bacteria 560
451 Ga0451800_0838792 3300041459 Bacteria 505
452 Ga0451852_32698 3300041508 Bacteria 616
453 Ga0451855_1349458 3300041511 Bacteria 1331
454 Ga0439454_050027 3300042011 Bacteria 704
455 Ga0450923_171515 3300042125 Bacteria 532
456 Ga0439435_0211602 3300042436 Bacteria 643
457 Ga0439464_0303234 3300042439 Bacteria 522
458 Ga0451577_0023321 3300042876 Bacteria 5645
459 Ga0451577_0087975 3300042876 Bacteria 2771
460 Ga0451577_0377176 3300042876 Bacteria 1287
461 Ga0451577_0422623 3300042876 Bacteria 1210
462 Ga0451577_0497149 3300042876 Bacteria 1107
463 Ga0466972_0002629 3300044658 Bacteria 8898
464 Ga0466965_0001564 3300044683 Bacteria 9313
465 Ga0453684_0042224 3300044712 Bacteria 6151
466 Ga0453684_0114335 3300044712 Bacteria 3272
467 Ga0453684_0154899 3300044712 Bacteria 2718
468 Ga0453684_0165118 3300044712 Bacteria 2615
469 Ga0453684_0220011 3300044712 Bacteria 2200
470 Ga0453684_0234607 3300044712 Bacteria 2116
471 Ga0453684_0310833 3300044712 Bacteria 1788
472 Ga0453684_1317422 3300044712 Bacteria 753
473 Ga0453684_1923855 3300044712 Unclassified 598
474 Ga0466968_0002295 3300044735 Bacteria 6986
475 Ga0466960_0002825 3300044901 Bacteria 6581
476 Ga0466960_0565556 3300044901 Bacteria 672
477 Ga0466960_0629581 3300044901 Bacteria 639
478 Ga0451576_0004083 3300045051 Bacteria 19291
479 Ga0495592_0090371 3300046454 Bacteria 2197
480 Ga0495592_0427862 3300046454 Bacteria 834
481 Ga0495603_0789624 3300046455 Bacteria 542
482 Ga0495629_0555901 3300046459 Bacteria 770
483 Ga0495653_0620248 3300046463 Bacteria 663
484 Ga0495639_0540697 3300046475 Bacteria 597
485 Ga0495662_0637846 3300046476 Bacteria 520
486 Ga0495618_0405347 3300046514 Bacteria 833
487 Ga0495628_0799132 3300046516 Bacteria 660
488 Ga0495630_1450420 3300046517 Bacteria 515
489 Ga0495666_0065896 3300046526 Bacteria 1727
490 Ga0495654_0153870 3300046530 Bacteria 1015
491 Ga0495665_0599923 3300046531 Bacteria 550
492 Ga0495640_0187405 3300046533 Bacteria 1316
493 Ga0495587_0360147 3300046536 Bacteria 810
494 Ga0495667_0582086 3300046559 Bacteria 698
495 Ga0495634_0217770 3300046642 Bacteria 1180
496 Ga0495634_0463394 3300046642 Bacteria 746
497 Ga0495635_0297114 3300046663 Bacteria 1083
498 Ga0495659_0516749 3300046664 Bacteria 524
499 Ga0495588_0387467 3300046674 Bacteria 734
500 Ga0495657_0132814 3300046675 Bacteria 1558
501 Ga0495647_0160776 3300046681 Bacteria 968
502 Ga0495670_0150352 3300046691 Bacteria 1221
503 Ga0495600_0216909 3300046809 Bacteria 1225
504 Ga0495581_0087832 3300047315 Bacteria 1803
505 Ga0495581_0272377 3300047315 Bacteria 990
506 Ga0495604_0536407 3300047317 Bacteria 756
507 Ga0495674_0118237 3300047319 Bacteria 2241
508 Ga0495674_1128271 3300047319 Bacteria 596
509 Ga0495676_0065217 3300047321 Bacteria 2828
510 Ga0495680_0195885 3300047322 Bacteria 1452
511 Ga0495684_0043770 3300047471 Bacteria 3428
512 Ga0495684_0097665 3300047471 Bacteria 2222
513 Ga0495593_0233207 3300047673 Bacteria 923
514 Ga0496100_0008037 3300048903 Bacteria 5863
515 Ga0496101_0009815 3300048904 Bacteria 6305
516 Ga0496102_0030776 3300048905 Bacteria 4806
517 Ga0496102_1029719 3300048905 Bacteria 744
518 Ga0496103_0004577 3300048906 Bacteria 8379
519 Ga0496104_0002622 3300048907 Bacteria 15487
520 Ga0496105_0013979 3300048908 Bacteria 6384
521 Ga0496106_0005196 3300048909 Bacteria 9639
522 Ga0496107_0021521 3300048910 Bacteria 4557
523 Ga0496108_0199038 3300048911 Bacteria 1738
524 Ga0496108_0300557 3300048911 Bacteria 1398
525 Ga0496109_0184417 3300048912 Bacteria 1961
526 Ga0496109_0295562 3300048912 Bacteria 1527
527 Ga0496109_0512416 3300048912 Bacteria 1132
528 Ga0496109_1428939 3300048912 Bacteria 627
529 Ga0496110_0011428 3300048913 Bacteria 7267
530 Ga0496110_0235446 3300048913 Bacteria 1666
531 Ga0496110_0404758 3300048913 Bacteria 1244
532 Ga0496111_0025168 3300048914 Bacteria 4198
533 Ga0496113_0247172 3300048916 Bacteria 1424
534 Ga0496114_0017734 3300048917 Bacteria 5752
535 Ga0496115_0861815 3300048918 Bacteria 701
536 Ga0501291_006552 3300049514 Bacteria 1555
537 Ga0501296_067034 3300049519 Bacteria 551
538 Ga0501298_076347 3300049521 Bacteria 730
539 Ga0501299_121217 3300049522 Bacteria 630
540 Ga0501299_162741 3300049522 Bacteria 571
541 Ga0501300_049646 3300049523 Bacteria 646
542 Ga0501032_0104341 3300049569 Bacteria 1878
543 Ga0501033_0204816 3300049570 Bacteria 1408
544 Ga0501034_0000132 3300049571 Bacteria 138635
545 Ga0501034_0000350 3300049571 Bacteria 79674
546 Ga0501034_0061723 3300049571 Bacteria 3764
547 Ga0501036_0052734 3300049572 Bacteria 3445
548 Ga0501036_1423133 3300049572 Bacteria 562
549 Ga0501037_0004785 3300049573 Bacteria 9844
550 Ga0501038_0000517 3300049574 Bacteria 33879
551 Ga0501039_1218104 3300049575 Bacteria 582
552 Ga0501039_1552565 3300049575 Bacteria 509
553 Ga0501042_0103279 3300049578 Bacteria 2051
554 Ga0501043_0000829 3300049579 Bacteria 27458
555 Ga0501043_0044494 3300049579 Bacteria 3491
556 Ga0501043_0313350 3300049579 Bacteria 1197
557 Ga0501043_0693887 3300049579 Bacteria 744
558 Ga0501046_0000117 3300049580 Bacteria 84016
559 Ga0501047_0071175 3300049581 Bacteria 3347
560 Ga0501047_0125038 3300049581 Bacteria 2453
561 Ga0501048_0007265 3300049582 Bacteria 8401
562 Ga0501068_0078878 3300049584 Bacteria 2019
563 Ga0501070_0599865 3300049586 Bacteria 878
564 Ga0501072_1151371 3300049588 Bacteria 603
565 Ga0501073_0200303 3300049589 Bacteria 1381
566 Ga0501073_1032879 3300049589 Bacteria 565
567 Ga0501076_1492831 3300049592 Bacteria 555
568 Ga0501077_0247318 3300049593 Bacteria 1134
569 Ga0501202_244932 3300049652 Bacteria 502
570 Ga0501207_085038 3300049654 Bacteria 614
571 Ga0501209_098274 3300049656 Bacteria 856
572 Ga0501216_147338 3300049660 Bacteria 557
573 Ga0501217_072740 3300049661 Bacteria 938
574 Ga0501217_093696 3300049661 Bacteria 846
575 Ga0501227_062021 3300049665 Bacteria 960
576 Ga0501228_051363 3300049666 Bacteria 563
577 Ga0501230_077189 3300049667 Bacteria 693
578 Ga0501233_186163 3300049668 Bacteria 597
579 Ga0501236_037195 3300049670 Bacteria 794
580 Ga0501252_031033 3300049682 Bacteria 740
581 Ga0501253_171065 3300049683 Bacteria 560
582 Ga0501255_020266 3300049684 Bacteria 855
583 Ga0501257_100061 3300049686 Bacteria 761
584 Ga0501261_099957 3300049690 Bacteria 550
585 Ga0501261_134772 3300049690 Bacteria 501
586 Ga0501221_008057 3300049704 Bacteria 1824
587 Ga0501225_0034562 3300049705 Bacteria 1392
588 Ga0501225_0060125 3300049705 Bacteria 1068
589 Ga0501225_0081522 3300049705 Bacteria 929
590 Ga0501234_017129 3300049707 Bacteria 1145
591 Ga0501080_0079507 3300049742 Bacteria 3049
592 Ga0501080_0289109 3300049742 Bacteria 1489
593 Ga0501080_0508675 3300049742 Unclassified 1076
594 Ga0501081_0475114 3300049743 Bacteria 930
595 Ga0501083_0000071 3300049744 Bacteria 67336
596 Ga0501083_0646614 3300049744 Bacteria 688
597 Ga0501266_055484 3300049763 Bacteria 622
598 Ga0501268_135719 3300049765 Bacteria 557
599 Ga0501271_016872 3300049768 Bacteria 825
600 Ga0501278_012727 3300049774 Bacteria 697
601 Ga0501280_080559 3300049776 Bacteria 598
602 Ga0501283_015243 3300049779 Bacteria 1182
603 Ga0501035_0032751 3300049822 Bacteria 4727
604 Ga0501044_0048908 3300049823 Bacteria 4365
605 Ga0501044_0130431 3300049823 Bacteria 2508
606 Ga0501044_0151842 3300049823 Bacteria 2298
607 Ga0501044_1304166 3300049823 Bacteria 592
608 Ga0501045_0323324 3300049824 Unclassified 1148
609 Ga0501045_1004370 3300049824 Bacteria 612
610 Ga0501212_001657 3300049851 Bacteria 2549
611 Ga0501212_023242 3300049851 Bacteria 970
612 Ga0501212_037357 3300049851 Bacteria 796
613 nmdc:mga03683_107483_c1 3300050489 Bacteria 1231
614 nmdc:mga00v17_25860_c1 3300050491 Bacteria 3415
615 nmdc:mga0k408_209546_c1 3300050493 Bacteria 1164
616 nmdc:mga06z11_577269_c1 3300050494 Bacteria 683
617 nmdc:mga04h51_88670_c1 3300050495 Bacteria 1110
618 nmdc:mga08y16_518055_c1 3300050511 Bacteria 1210
619 nmdc:mga08y16_55546_c1 3300050511 Bacteria 4137
620 nmdc:mga08y16_632490_c1 3300050511 Bacteria 1076
621 nmdc:mga0n895_1051373_c1 3300050512 Bacteria 793
622 nmdc:mga0n895_2034788_c1 3300050512 Bacteria 532
623 nmdc:mga0rr50_478204_c1 3300050513 Bacteria 1058
624 nmdc:mga0rr50_90141_c1 3300050513 Bacteria 2385
625 Ga0495601_0009906 3300053077 Bacteria 5645
626 Ga0495601_0184569 3300053077 Bacteria 1363
627 Ga0495595_0049219 3300053084 Bacteria 1948
628 Ga0495595_0429953 3300053084 Bacteria 670
629 Ga0495619_0180039 3300053085 Bacteria 1462
630 Ga0495619_0252911 3300053085 Bacteria 1221
631 Ga0495619_0371738 3300053085 Bacteria 988
632 Ga0495619_0593498 3300053085 Bacteria 758
633 Ga0500628_031758 3300053129 Bacteria 1151
634 Ga0501084_0115527 3300054114 Bacteria 2256
635 Ga0501084_0625490 3300054114 Bacteria 909
636 Ga0501084_1022695 3300054114 Bacteria 694
637 Ga0590071_028038 3300059421 Bacteria 1337
638 Ga0590075_004314 3300059424 Bacteria 3366
639 Ga0590075_033582 3300059424 Bacteria 1303
640 Ga0590077_005878 3300059426 Bacteria 2515
641 Ga0590077_060932 3300059426 Bacteria 855
642 Ga0587093_113132 3300059478 Bacteria 501
643 Ga0587073_0027652 3300059492 Bacteria 1146
644 Ga0587077_023092 3300059493 Bacteria 1120
645 Ga0587085_129954 3300059506 Bacteria 562
646 Ga0587109_109743 3300059624 Bacteria 644
647 Ga0587109_142971 3300059624 Unclassified 585
648 Ga0587069_139637 3300059642 Bacteria 529
649 Ga0587075_075262 3300059644 Bacteria 635
650 Ga0587079_160289 3300059647 Bacteria 588
651 Ga0587111_0089825 3300060346 Bacteria 748
652 Ga0530510_0843944 3300061734 Bacteria 699
653 Ga0070666_10005313
654 bgg_mtDRAFT_1052403
655 JGI24736J21556_1007549
656 JGI24746J21847_1067537
657 JGI24742J22300_10084749
658 rootH2_10116081
659 JGI25407J50210_10059979
660 JGI25407J50210_10153175
661 Ga0007429J51699_1069582
662 Ga0058863_11402763
663 Ga0058860_12157441
664 Ga0065712_10644291
665 Ga0070683_100496416
666 Ga0070690_100140937
667 Ga0070670_100271006
668 Ga0068869_101414079
669 Ga0068869_101890544
670 Ga0070666_10397173
671 Ga0070666_11111243
672 Ga0070682_100649155
673 Ga0068868_100118877
674 Ga0068868_100306319
675 Ga0068868_100310411
676 Ga0068868_101676088
677 Ga0070660_100001553
678 Ga0070689_100021396
679 Ga0070689_100290071
680 Ga0070689_100501623
681 Ga0070689_101518580
682 Ga0070689_101581959
683 Ga0070691_10410696
684 Ga0070687_100070909
685 Ga0070687_100182552
686 Ga0070661_100934457
687 Ga0070661_101401684
688 Ga0070668_100517121
689 Ga0070668_100518504
690 Ga0070668_101868813
691 Ga0070669_100305467
692 Ga0070675_100582466
693 Ga0070671_100643580
694 Ga0070671_100805456
695 Ga0070674_100016454
696 Ga0070674_100125926
697 Ga0070674_102089203
698 Ga0070673_100385167
699 Ga0070673_101963978
700 Ga0070667_100052445
701 Ga0070667_100282870
702 Ga0070667_101077454
703 Ga0070714_102405882
704 Ga0070710_10098746
705 Ga0070710_10553549
706 Ga0070701_10927633
707 Ga0070711_100391752
708 Ga0070705_100162368
709 Ga0070705_100875005
710 Ga0070705_101005936
711 Ga0070700_100271378
712 Ga0070694_100447918
713 Ga0070678_101060729
714 Ga0070678_101137786
715 Ga0070678_101617400
716 Ga0070662_100797406
717 Ga0068867_100002530
718 Ga0068867_100515787
719 Ga0070706_101800815
720 Ga0070707_101178471
721 Ga0070679_101106355
722 Ga0070679_102010913
723 Ga0070697_101063917
724 Ga0070672_100077749
725 Ga0070686_100054427
726 Ga0070686_100716190
727 Ga0070686_100802666
728 Ga0070695_100558028
729 Ga0070696_100788763
730 Ga0070693_100876925
731 Ga0070665_100129462
732 Ga0070665_100977831
733 Ga0070665_101681409
734 Ga0070665_102196551
735 Ga0070704_101067589
736 Ga0068855_101692480
737 Ga0068854_100147012
738 Ga0070702_100840292
739 Ga0070702_101416389
740 Ga0068852_100557502
741 Ga0068859_100163205
742 Ga0068859_101402468
743 Ga0068859_103132466
744 Ga0068864_100466181
745 Ga0068864_100588372
746 Ga0068861_100300548
747 Ga0068870_10438218
748 Ga0068870_10934375
749 Ga0068863_100626179
750 Ga0068863_102128419
751 Ga0068858_100115807
752 Ga0068858_100313173
753 Ga0068858_100369244
754 Ga0068858_101496022
755 Ga0068860_100021615
756 Ga0068860_100033975
757 Ga0068860_100782294
758 Ga0068860_102603369
759 Ga0068862_100009288
760 Ga0068862_100128476
761 Ga0068862_100813633
762 Ga0068862_101613511
763 Ga0081538_10020098
764 Ga0081538_10022736
765 Ga0081538_10082674
766 Ga0081539_10072530
767 Ga0081539_10429642
768 Ga0075364_10348061
769 Ga0070716_100535885
770 Ga0070716_101376257
771 Ga0070712_100075701
772 Ga0075369_10035804
773 Ga0075366_10532434
774 Ga0097621_100513655
775 Ga0075370_10225357
776 Ga0068871_100033556
777 Ga0068871_100503212
778 Ga0068871_101324509
779 Ga0075433_11019618
780 Ga0075434_100569999
781 Ga0075434_101939679
782 Ga0068865_100035387
783 Ga0068865_100092690
784 Ga0068865_100565540
785 Ga0097620_100163209
786 Ga0097620_101402428
787 Ga0097620_103133303
788 Ga0075435_100076334
789 Ga0075435_100546858
790 Ga0105250_10206438
791 Ga0105250_10223973
792 Ga0105240_10200290
793 Ga0105240_12170434
794 Ga0111539_10206788
795 Ga0111539_10448342
796 Ga0111539_10493398
797 Ga0111539_10691078
798 Ga0111539_10786274
799 Ga0105245_10082473
800 Ga0105245_10673540
801 Ga0105245_10712368
802 Ga0105245_11885849
803 Ga0105245_13206765
804 Ga0105247_10191118
805 Ga0105247_10718569
806 Ga0114129_10031111
807 Ga0105243_10062864
808 Ga0105243_10311217
809 Ga0105243_10333269
810 Ga0105243_11058430
811 Ga0105243_12553938
812 Ga0105241_11195579
813 Ga0105241_11601316
814 Ga0105242_10012654
815 Ga0105242_10048621
816 Ga0105242_10227333
817 Ga0105242_10289121
818 Ga0105242_10352803
819 Ga0105242_12501345
820 Ga0105248_10798576
821 Ga0105248_11085017
822 Ga0105248_11572517
823 Ga0105237_11600637
824 Ga0105237_11899649
825 Ga0105238_10067902
826 Ga0105238_11115885
827 Ga0105249_10037678
828 Ga0105249_12124357
829 Ga0099796_10398167
830 Ga0105239_10343886
831 Ga0105246_10161171
832 Ga0105246_10408250
833 Ga0105246_11008660
834 Ga0105246_11857874
835 Ga0157370_10973621
836 Ga0157370_11194333
837 Ga0157369_10523225
838 Ga0157369_12156469
839 Ga0157369_12410973
840 Ga0157374_10556033
841 Ga0157374_10984640
842 Ga0157374_11076256
843 Ga0157374_12051666
844 Ga0157374_12340115
845 Ga0157378_10731323
846 Ga0157378_11103676
847 Ga0157378_12106881
848 Ga0163162_10359063
849 Ga0163162_10774452
850 Ga0163162_13087731
851 Ga0163162_13422070
852 Ga0157375_10105922
853 Ga0157375_10362501
854 Ga0157375_11042910
855 Ga0157375_11784762
856 Ga0157375_12967768
857 Ga0163163_10735633
858 Ga0163163_12036037
859 Ga0163163_12230515
860 Ga0157380_10252404
861 Ga0157380_10763458
862 Ga0157380_11208815
863 Ga0157380_11762084
864 Ga0157380_13146174
865 Ga0157377_10463674
866 Ga0157379_10032947
867 Ga0157379_10403569
868 Ga0157376_10290930
869 Ga0163161_10116827
870 Ga0163161_11385843
871 Ga0163161_12053015
872 Ga0206356_10722364
873 Ga0206349_1322283
874 Ga0206349_1769697
875 Ga0206355_1648489
876 Ga0206351_10978857
877 Ga0206352_10123243
878 Ga0206352_10183140
879 Ga0206354_10262825
880 Ga0206354_11712338
881 Ga0206353_11040041
882 Ga0213872_10187769
883 Ga0207666_1020430
884 Ga0207697_10101666
885 Ga0207692_10366006
886 Ga0207642_10002029
887 Ga0207710_10136098
888 Ga0207680_10001542
889 Ga0207680_10879858
890 Ga0207645_10327457
891 Ga0207643_10031249
892 Ga0207705_11497917
893 Ga0207707_10472544
894 Ga0207695_10164548
895 Ga0207695_11579154
896 Ga0207693_10058810
897 Ga0207662_10015067
898 Ga0207662_10978211
899 Ga0207657_10009140
900 Ga0207652_11139461
901 Ga0207646_11541571
902 Ga0207681_10033390
903 Ga0207694_10144238
904 Ga0207694_10769368
905 Ga0207650_10108942
906 Ga0207650_11330154
907 Ga0207650_11541751
908 Ga0207659_10278143
909 Ga0207659_10914498
910 Ga0207687_10170724
911 Ga0207687_10416595
912 Ga0207644_10228588
913 Ga0207644_11823813
914 Ga0207690_10362984
915 Ga0207690_10617594
916 Ga0207686_10011426
917 Ga0207686_10269590
918 Ga0207686_10471253
919 Ga0207686_10498984
920 Ga0207709_10071910
921 Ga0207709_10074978
922 Ga0207709_10406749
923 Ga0207670_10187553
924 Ga0207670_10293256
925 Ga0207670_11387742
926 Ga0207669_10057949
927 Ga0207704_10004160
928 Ga0207704_10393555
929 Ga0207704_11153449
930 Ga0207665_10281190
931 Ga0207665_10515760
932 Ga0207665_10557083
933 Ga0207691_10121532
934 Ga0207689_10433162
935 Ga0207661_10913313
936 Ga0207667_11182307
937 Ga0207651_10840541
938 Ga0207712_10019857
939 Ga0207712_10111926
940 Ga0207668_10250251
941 Ga0207668_10314621
942 Ga0207640_10254812
943 Ga0207640_11251896
944 Ga0207658_10057969
945 Ga0207658_10514718
946 Ga0207658_10517925
947 Ga0207658_11137935
948 Ga0207658_11203174
949 Ga0207677_10054605
950 Ga0207677_10585281
951 Ga0207677_10809783
952 Ga0207677_11102911
953 Ga0207677_11130746
954 Ga0207703_10127047
955 Ga0207703_10966257
956 Ga0207639_10346105
957 Ga0207708_10013401
958 Ga0207708_10081745
959 Ga0207708_10206927
960 Ga0207641_12242808
961 Ga0207648_10432110
962 Ga0207648_11455853
963 Ga0207648_11545046
964 Ga0207676_10392828
965 Ga0207675_100089987
966 Ga0207675_101960581
967 Ga0207683_10196443
968 Ga0207683_10800700
969 Ga0207683_11831842
970 Ga0209813_10024614
971 Ga0207428_10987283
972 Ga0268266_10413379
973 Ga0268265_10133068
974 Ga0268265_10195463
975 Ga0268265_10831923
976 Ga0268265_11458068
977 Ga0268264_10069696
978 Ga0268264_10073731
979 Ga0268264_10409275
980 Ga0268264_10617353
981 Ga0268264_10998697
982 Ga0265319_1047161
983 Ga0265334_10086231
984 Ga0265334_10142738
985 Ga0265334_10268859
986 Ga0265318_10010316
987 Ga0265318_10204325
988 Ga0265318_10216941
989 Ga0265318_10352121
990 Ga0265338_10000149
991 Ga0265338_10267468
992 Ga0314311_1151127
993 Ga0316183_1051683
994 Ga0316181_1169834
995 Ga0265332_10007273
996 Ga0265328_10298685
997 Ga0265320_10032179
998 Ga0265320_10515925
999 Ga0265325_10005182
1000 Ga0265329_10159113
1001 Ga0265329_10195905
1002 Ga0265340_10128027
1003 Ga0265340_10457723
1004 Ga0265339_10009201
1005 Ga0265339_10089782
1006 Ga0265331_10002189
1007 Ga0265331_10089053
1008 Ga0265327_10198442
1009 Ga0265316_10005991
1010 Ga0265316_10081752
1011 Ga0265316_10175775
1012 Ga0307408_100310055
1013 Ga0265313_10003941
1014 Ga0265314_10031471
1015 Ga0265314_10113052
1016 Ga0265314_10561220
1017 Ga0265342_10003312
1018 Ga0265342_10278380
1019 Ga0316576_10090764
1020 Ga0316576_10275574
1021 Ga0316576_10571964
1022 Ga0316576_10732474
1023 Ga0316578_10244818
1024 Ga0307405_10364308
1025 Ga0307413_10052889
1026 Ga0307413_10326126
1027 Ga0307410_10054263
1028 Ga0307410_10175784
1029 Ga0307410_10609815
1030 Ga0326468_10088266
1031 Ga0307406_10791831
1032 Ga0307406_11198320
1033 Ga0307406_12128610
1034 Ga0307407_10329599
1035 Ga0307409_100092397
1036 Ga0307409_100336532
1037 Ga0307409_100547726
1038 Ga0307409_101195668
1039 Ga0307409_102899124
1040 Ga0307416_100076811
1041 Ga0307416_100236774
1042 Ga0307416_100343119
1043 Ga0307416_101086092
1044 Ga0307416_101597224
1045 Ga0307416_102063181
1046 Ga0307416_103227806
1047 Ga0307416_103246371
1048 Ga0307414_10054992
1049 Ga0307414_10095671
1050 Ga0307414_10179851
1051 Ga0307414_10693317
1052 Ga0307414_10722699
1053 Ga0307411_10096077
1054 Ga0307411_10175852
1055 Ga0307411_10442147
1056 Ga0307415_100174324
1057 Ga0307415_100425461
1058 Ga0307415_100483993
1059 Ga0307415_100610177
1060 Ga0316583_10002317
1061 Ga0316583_10123659
1062 Ga0316593_10004176
1063 Ga0316592_1079161
1064 Ga0373926_0022817
1065 Ga0373944_0107504
1066 Ga0373936_0190634
1067 Ga0373953_0225792
1068 Ga0373957_0305792
1069 Ga0373943_0059022
1070 Ga0373946_0111300
1071 Ga0373955_0280793
1072 Ga0373955_0815803
1073 Ga0373942_0155243
1074 Ga0316574_0032055
1075 Ga0316574_0254953
1076 Ga0316574_0338947
1077 Ga0316574_0608402
1078 Ga0316574_0814478
1079 Ga0373935_0275973
1080 Ga0373927_0461278
1081 Ga0373933_0302728
1082 Ga0373933_0482502
1083 Ga0373947_0345173
1084 Ga0373947_0765919
1085 Ga0373937_0117033
1086 Ga0373937_0382862
1087 Ga0316582_0180409
1088 Ga0316584_0005236
1089 Ga0316584_0083522
1090 Ga0373925_0070485
1091 Ga0373925_1333517
1092 Ga0395905_0432530
1093 Ga0400489_53335
1094 Ga0400489_72484
1095 Ga0436365_0661327
1096 Ga0436365_1436184
1097 Ga0436361_0174152
1098 Ga0439461_0168841
1099 Ga0439466_0071834
1100 Ga0451789_0713496
1101 Ga0451797_0999249
1102 Ga0451795_0393529
1103 Ga0451800_0838792
1104 Ga0451852_32698
1105 Ga0451855_1349458
1106 Ga0439454_050027
1107 Ga0450923_171515
1108 Ga0439435_0211602
1109 Ga0439464_0303234
1110 Ga0451577_0023321
1111 Ga0451577_0087975
1112 Ga0451577_0377176
1113 Ga0451577_0422623
1114 Ga0451577_0497149
1115 Ga0466972_0002629
1116 Ga0466965_0001564
1117 Ga0453684_0042224
1118 Ga0453684_0114335
1119 Ga0453684_0154899
1120 Ga0453684_0165118
1121 Ga0453684_0220011
1122 Ga0453684_0234607
1123 Ga0453684_0310833
1124 Ga0453684_1317422
1125 Ga0453684_1923855
1126 Ga0466968_0002295
1127 Ga0466960_0002825
1128 Ga0466960_0565556
1129 Ga0466960_0629581
1130 Ga0451576_0004083
1131 Ga0495592_0090371
1132 Ga0495592_0427862
1133 Ga0495603_0789624
1134 Ga0495629_0555901
1135 Ga0495653_0620248
1136 Ga0495639_0540697
1137 Ga0495662_0637846
1138 Ga0495618_0405347
1139 Ga0495628_0799132
1140 Ga0495630_1450420
1141 Ga0495666_0065896
1142 Ga0495654_0153870
1143 Ga0495665_0599923
1144 Ga0495640_0187405
1145 Ga0495587_0360147
1146 Ga0495667_0582086
1147 Ga0495634_0217770
1148 Ga0495634_0463394
1149 Ga0495635_0297114
1150 Ga0495659_0516749
1151 Ga0495588_0387467
1152 Ga0495657_0132814
1153 Ga0495647_0160776
1154 Ga0495670_0150352
1155 Ga0495600_0216909
1156 Ga0495581_0087832
1157 Ga0495581_0272377
1158 Ga0495604_0536407
1159 Ga0495674_0118237
1160 Ga0495674_1128271
1161 Ga0495676_0065217
1162 Ga0495680_0195885
1163 Ga0495684_0043770
1164 Ga0495684_0097665
1165 Ga0495593_0233207
1166 Ga0496100_0008037
1167 Ga0496101_0009815
1168 Ga0496102_0030776
1169 Ga0496102_1029719
1170 Ga0496103_0004577
1171 Ga0496104_0002622
1172 Ga0496105_0013979
1173 Ga0496106_0005196
1174 Ga0496107_0021521
1175 Ga0496108_0199038
1176 Ga0496108_0300557
1177 Ga0496109_0184417
1178 Ga0496109_0295562
1179 Ga0496109_0512416
1180 Ga0496109_1428939
1181 Ga0496110_0011428
1182 Ga0496110_0235446
1183 Ga0496110_0404758
1184 Ga0496111_0025168
1185 Ga0496113_0247172
1186 Ga0496114_0017734
1187 Ga0496115_0861815
1188 Ga0501291_006552
1189 Ga0501296_067034
1190 Ga0501298_076347
1191 Ga0501299_121217
1192 Ga0501299_162741
1193 Ga0501300_049646
1194 Ga0501032_0104341
1195 Ga0501033_0204816
1196 Ga0501034_0000132
1197 Ga0501034_0000350
1198 Ga0501034_0061723
1199 Ga0501036_0052734
1200 Ga0501036_1423133
1201 Ga0501037_0004785
1202 Ga0501038_0000517
1203 Ga0501039_1218104
1204 Ga0501039_1552565
1205 Ga0501042_0103279
1206 Ga0501043_0000829
1207 Ga0501043_0044494
1208 Ga0501043_0313350
1209 Ga0501043_0693887
1210 Ga0501046_0000117
1211 Ga0501047_0071175
1212 Ga0501047_0125038
1213 Ga0501048_0007265
1214 Ga0501068_0078878
1215 Ga0501070_0599865
1216 Ga0501072_1151371
1217 Ga0501073_0200303
1218 Ga0501073_1032879
1219 Ga0501076_1492831
1220 Ga0501077_0247318
1221 Ga0501202_244932
1222 Ga0501207_085038
1223 Ga0501209_098274
1224 Ga0501216_147338
1225 Ga0501217_072740
1226 Ga0501217_093696
1227 Ga0501227_062021
1228 Ga0501228_051363
1229 Ga0501230_077189
1230 Ga0501233_186163
1231 Ga0501236_037195
1232 Ga0501252_031033
1233 Ga0501253_171065
1234 Ga0501255_020266
1235 Ga0501257_100061
1236 Ga0501261_099957
1237 Ga0501261_134772
1238 Ga0501221_008057
1239 Ga0501225_0034562
1240 Ga0501225_0060125
1241 Ga0501225_0081522
1242 Ga0501234_017129
1243 Ga0501080_0079507
1244 Ga0501080_0289109
1245 Ga0501080_0508675
1246 Ga0501081_0475114
1247 Ga0501083_0000071
1248 Ga0501083_0646614
1249 Ga0501266_055484
1250 Ga0501268_135719
1251 Ga0501271_016872
1252 Ga0501278_012727
1253 Ga0501280_080559
1254 Ga0501283_015243
1255 Ga0501035_0032751
1256 Ga0501044_0048908
1257 Ga0501044_0130431
1258 Ga0501044_0151842
1259 Ga0501044_1304166
1260 Ga0501045_0323324
1261 Ga0501045_1004370
1262 Ga0501212_001657
1263 Ga0501212_023242
1264 Ga0501212_037357
1265 nmdc:mga03683_107483_c1
1266 nmdc:mga00v17_25860_c1
1267 nmdc:mga0k408_209546_c1
1268 nmdc:mga06z11_577269_c1
1269 nmdc:mga04h51_88670_c1
1270 nmdc:mga08y16_518055_c1
1271 nmdc:mga08y16_55546_c1
1272 nmdc:mga08y16_632490_c1
1273 nmdc:mga0n895_1051373_c1
1274 nmdc:mga0n895_2034788_c1
1275 nmdc:mga0rr50_478204_c1
1276 nmdc:mga0rr50_90141_c1
1277 Ga0495601_0009906
1278 Ga0495601_0184569
1279 Ga0495595_0049219
1280 Ga0495595_0429953
1281 Ga0495619_0180039
1282 Ga0495619_0252911
1283 Ga0495619_0371738
1284 Ga0495619_0593498
1285 Ga0500628_031758
1286 Ga0501084_0115527
1287 Ga0501084_0625490
1288 Ga0501084_1022695
1289 Ga0590071_028038
1290 Ga0590075_004314
1291 Ga0590075_033582
1292 Ga0590077_005878
1293 Ga0590077_060932
1294 Ga0587093_113132
1295 Ga0587073_0027652
1296 Ga0587077_023092
1297 Ga0587085_129954
1298 Ga0587109_109743
1299 Ga0587109_142971
1300 Ga0587069_139637
1301 Ga0587075_075262
1302 Ga0587079_160289
1303 Ga0587111_0089825
1304 Ga0530510_0843944

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01176

eIF-1a

Translation initiation factor 1A / IF-1

18

82

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i4o-assembly2.cif.gz_B crystal structure of translation initiation factor 1 from mycobacterium tuberculosis 0.9799 7 72
4ql5-assembly1.cif.gz_A crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4 0.9767 5 72
4ql5-assembly1.cif.gz_A crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4 0.9629 5 72
4bts-assembly1.cif.gz_C0 the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a 0.9518 8 72
3i4o-assembly2.cif.gz_B crystal structure of translation initiation factor 1 from mycobacterium tuberculosis 0.9516 7 72
ID Description Score Start End Superfamily
3i4oA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9831 7 72 2.40.50.140
af_P46618_9_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9702 3 72 2.40.50.140
af_I1JZH0_64_142_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9594 1 72 2.40.50.140
af_I1JZH0_64_142_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9465 1 72 2.40.50.140
3i4oA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.941 7 72 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2E8TAS2-F1-model_v4 deleted 1.004 3 72
AF-A0A3N5JZ32-F1-model_v4 Translation initiation factor IF-1 1.003 5 72 GO:0003723
GO:0003743
GO:0005829
GO:0043022
AF-A0A1G1Z651-F1-model_v4 Translation initiation factor IF-1 1.003 5 71 GO:0003723
GO:0003743
GO:0005829
GO:0043022
AF-A0A2N1TU61-F1-model_v4 Translation initiation factor IF-1 1.002 5 72 GO:0003723
GO:0003743
GO:0005829
GO:0043022
AF-H0UL81-F1-model_v4 Translation initiation factor IF-1 1.001 3 72 GO:0003743
GO:0005829
GO:0019843
GO:0043022

Map