F472656

General Info

Members Datasets Scaffolds Average Seq Length
652 316 1304 274

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100030927|Ga0070670_1000309272
Length 312
Sequence VTAGTGNRELGTDAARSALRAARSPRSQPPAFGGHPPVPRSRRFRAILLYVALILGALLALFPLFWMVSASLMPTGEASTYPPRVLPSRVTFEHYGALFTRLNLGRYLLNSALISLVVTVLSLAVNSMAGYAFAKLRFRGRDGLFRVLAAGLVLPVQVAMLPLFLLMKQLGLINSYGGVIIPGLASIFGIFLIRQYAQSIPDDMLDAARIDGASEMRIYRSVVLPGIVPILATLAIWTFLATWNDFMWPLIVLSDESHYTLPVALANLVGEHVQDTELMMAGSVLTTLPVLLVFLFLQRYYIQGVMAGSVKG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
223 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
224 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
291 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
292 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
293 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
294 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
295 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
296 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
301 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 2919513703 Luteimonas sp. 3794 Isolate Unclassified
316 2919675420 Luteimonas terrae 4099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.92
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 0.77
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100030927 3300005331 Bacteria 4611
2 JGI24735J21928_10032065 3300002067 Bacteria 1556
3 rootL2_10023374 3300003322 Bacteria 1226
4 Ga0065704_10111997 3300005289 Bacteria 1944
5 Ga0065712_10076995 3300005290 Bacteria 3559
6 Ga0070658_10001438 3300005327 Bacteria 20307
7 Ga0070658_10186538 3300005327 Bacteria 1747
8 Ga0070658_10594164 3300005327 Bacteria 959
9 Ga0070676_10049470 3300005328 Bacteria 2461
10 Ga0070676_10099121 3300005328 Bacteria 1797
11 Ga0070676_10148236 3300005328 Bacteria 1499
12 Ga0070683_100004030 3300005329 Bacteria 12024
13 Ga0070683_100024127 3300005329 Bacteria 5444
14 Ga0070683_100344377 3300005329 Bacteria 1419
15 Ga0070683_100429428 3300005329 Bacteria 1260
16 Ga0070683_100433666 3300005329 Bacteria 1254
17 Ga0070690_100070809 3300005330 Bacteria 2265
18 Ga0070690_100073316 3300005330 Bacteria 2227
19 Ga0070690_100119164 3300005330 Bacteria 1770
20 Ga0070690_100304291 3300005330 Bacteria 1144
21 Ga0070680_100003745 3300005336 Bacteria 11365
22 Ga0070680_100006609 3300005336 Bacteria 8816
23 Ga0070680_100044155 3300005336 Bacteria 3621
24 Ga0070680_100077306 3300005336 Bacteria 2742
25 Ga0070680_100304050 3300005336 Bacteria 1353
26 Ga0070680_100325463 3300005336 Bacteria 1305
27 Ga0070680_100492183 3300005336 Bacteria 1049
28 Ga0070682_100007445 3300005337 Bacteria 6174
29 Ga0070682_100013680 3300005337 Bacteria 4676
30 Ga0070682_100043886 3300005337 Bacteria 2766
31 Ga0068868_100143841 3300005338 Bacteria 1960
32 Ga0068868_100286942 3300005338 Bacteria 1394
33 Ga0070660_100002035 3300005339 Bacteria 13951
34 Ga0070691_10142890 3300005341 Bacteria 1221
35 Ga0070687_100139536 3300005343 Bacteria 1410
36 Ga0070687_100190804 3300005343 Bacteria 1235
37 Ga0070661_100170839 3300005344 Bacteria 1651
38 Ga0070661_100207330 3300005344 Bacteria 1499
39 Ga0070692_10027025 3300005345 Bacteria 2841
40 Ga0070668_100001189 3300005347 Bacteria 18442
41 Ga0070668_100190803 3300005347 Bacteria 1678
42 Ga0070668_100249407 3300005347 Bacteria 1473
43 Ga0070668_100506395 3300005347 Bacteria 1046
44 Ga0070669_100009120 3300005353 Bacteria 7071
45 Ga0070669_100123472 3300005353 Bacteria 1979
46 Ga0070669_100151101 3300005353 Bacteria 1798
47 Ga0070675_100020429 3300005354 Bacteria 5285
48 Ga0070675_100145752 3300005354 Bacteria 2027
49 Ga0070671_100175530 3300005355 Bacteria 1813
50 Ga0070688_100115797 3300005365 Bacteria 1789
51 Ga0070688_100277467 3300005365 Bacteria 1203
52 Ga0070659_100040326 3300005366 Bacteria 3648
53 Ga0070659_100580109 3300005366 Bacteria 962
54 Ga0070714_100091743 3300005435 Bacteria 2662
55 Ga0070713_100004184 3300005436 Bacteria 9628
56 Ga0070713_100008441 3300005436 Bacteria 7304
57 Ga0070701_10119098 3300005438 Bacteria 1485
58 Ga0070700_100055874 3300005441 Bacteria 2472
59 Ga0070694_100011761 3300005444 Bacteria 5426
60 Ga0070694_100104811 3300005444 Bacteria 2006
61 Ga0070708_100000224 3300005445 Bacteria 42021
62 Ga0070663_100092393 3300005455 Bacteria 2244
63 Ga0070678_100452904 3300005456 Bacteria 1124
64 Ga0070662_100024843 3300005457 Bacteria 4132
65 Ga0070662_100104971 3300005457 Bacteria 2144
66 Ga0070662_100169084 3300005457 Bacteria 1715
67 Ga0070681_10003651 3300005458 Bacteria 14442
68 Ga0070681_10013216 3300005458 Bacteria 8203
69 Ga0070681_10039490 3300005458 Bacteria 4731
70 Ga0070681_10174712 3300005458 Bacteria 2070
71 Ga0068867_100043132 3300005459 Bacteria 3302
72 Ga0068867_100046450 3300005459 Bacteria 3190
73 Ga0068867_100068117 3300005459 Bacteria 2655
74 Ga0068867_100102860 3300005459 Bacteria 2184
75 Ga0068867_100104887 3300005459 Bacteria 2164
76 Ga0070685_10006891 3300005466 Bacteria 5801
77 Ga0070685_10028905 3300005466 Bacteria 3076
78 Ga0070685_10077922 3300005466 Bacteria 1980
79 Ga0070706_100089204 3300005467 Bacteria 2859
80 Ga0070706_100122418 3300005467 Bacteria 2425
81 Ga0070706_100213222 3300005467 Bacteria 1803
82 Ga0070707_100000567 3300005468 Bacteria 37131
83 Ga0070707_100003023 3300005468 Bacteria 15953
84 Ga0070707_100092334 3300005468 Bacteria 2931
85 Ga0070707_100335036 3300005468 Bacteria 1470
86 Ga0070698_100052647 3300005471 Bacteria 4140
87 Ga0070698_100075334 3300005471 Bacteria 3378
88 Ga0070698_100137906 3300005471 Bacteria 2392
89 Ga0070699_100004540 3300005518 Bacteria 12286
90 Ga0070699_100017844 3300005518 Bacteria 6094
91 Ga0070699_100051424 3300005518 Bacteria 3567
92 Ga0070699_100275676 3300005518 Bacteria 1506
93 Ga0070699_100303346 3300005518 Bacteria 1433
94 Ga0070699_100416093 3300005518 Bacteria 1216
95 Ga0070679_100003478 3300005530 Bacteria 14423
96 Ga0070679_100020278 3300005530 Bacteria 6479
97 Ga0070679_100064362 3300005530 Bacteria 3655
98 Ga0070679_100080455 3300005530 Bacteria 3248
99 Ga0070679_100102269 3300005530 Bacteria 2851
100 Ga0070679_100149402 3300005530 Bacteria 2314
101 Ga0070679_100156771 3300005530 Bacteria 2251
102 Ga0070679_100160110 3300005530 Bacteria 2225
103 Ga0070684_100006771 3300005535 Bacteria 8886
104 Ga0070684_100021927 3300005535 Bacteria 5321
105 Ga0070684_100179456 3300005535 Bacteria 1925
106 Ga0070684_100376687 3300005535 Bacteria 1307
107 Ga0070697_100053565 3300005536 Bacteria 3279
108 Ga0070697_100059517 3300005536 Bacteria 3111
109 Ga0070697_100207181 3300005536 Bacteria 1668
110 Ga0068853_100099032 3300005539 Bacteria 2575
111 Ga0070672_100053192 3300005543 Bacteria 3165
112 Ga0070672_100067173 3300005543 Bacteria 2840
113 Ga0070695_100002750 3300005545 Bacteria 10205
114 Ga0070695_100028294 3300005545 Bacteria 3478
115 Ga0070695_100164527 3300005545 Bacteria 1560
116 Ga0070696_100034858 3300005546 Bacteria 3464
117 Ga0070696_100158509 3300005546 Bacteria 1666
118 Ga0070696_100159540 3300005546 Bacteria 1661
119 Ga0070665_100000365 3300005548 Bacteria 67635
120 Ga0070704_100000795 3300005549 Bacteria 15597
121 Ga0068855_100018134 3300005563 Bacteria 8458
122 Ga0068855_100047726 3300005563 Bacteria 5058
123 Ga0068855_100157583 3300005563 Bacteria 2579
124 Ga0070664_100031147 3300005564 Bacteria 4453
125 Ga0070664_100195163 3300005564 Bacteria 1805
126 Ga0068857_100012439 3300005577 Bacteria 7409
127 Ga0068857_100087846 3300005577 Bacteria 2781
128 Ga0068857_100235952 3300005577 Bacteria 1673
129 Ga0068854_100110615 3300005578 Bacteria 2072
130 Ga0068854_100244428 3300005578 Bacteria 1430
131 Ga0068854_100359151 3300005578 Bacteria 1195
132 Ga0068856_100275587 3300005614 Bacteria 1699
133 Ga0070702_100082160 3300005615 Bacteria 1933
134 Ga0070702_100287685 3300005615 Bacteria 1131
135 Ga0068852_100046821 3300005616 Bacteria 3686
136 Ga0068852_100063767 3300005616 Bacteria 3209
137 Ga0068852_100294420 3300005616 Bacteria 1569
138 Ga0068859_100045124 3300005617 Bacteria 4428
139 Ga0068859_100086199 3300005617 Bacteria 3187
140 Ga0068859_100385651 3300005617 Bacteria 1497
141 Ga0068864_100098933 3300005618 Bacteria 2584
142 Ga0068866_10113891 3300005718 Bacteria 1513
143 Ga0068861_100009036 3300005719 Bacteria 6869
144 Ga0068861_100334823 3300005719 Bacteria 1323
145 Ga0068860_100359993 3300005843 Bacteria 1433
146 Ga0068862_100002086 3300005844 Bacteria 18013
147 Ga0070717_10005702 3300006028 Bacteria 9105
148 Ga0070717_10169200 3300006028 Bacteria 1900
149 Ga0075364_10194897 3300006051 Bacteria 1372
150 Ga0070716_100073484 3300006173 Bacteria 2017
151 Ga0070712_100235502 3300006175 Bacteria 1456
152 Ga0070712_100410380 3300006175 Bacteria 1120
153 Ga0075428_100019809 3300006844 Bacteria 7444
154 Ga0075428_100022620 3300006844 Bacteria 6960
155 Ga0075428_100128368 3300006844 Bacteria 2758
156 Ga0075430_100010797 3300006846 Bacteria 7738
157 Ga0075430_100019476 3300006846 Bacteria 5771
158 Ga0075430_100177058 3300006846 Bacteria 1774
159 Ga0075430_100244103 3300006846 Bacteria 1488
160 Ga0075431_100030965 3300006847 Bacteria 5511
161 Ga0075431_100044250 3300006847 Bacteria 4592
162 Ga0075431_100105445 3300006847 Bacteria 2909
163 Ga0075431_100165924 3300006847 Bacteria 2270
164 Ga0075431_100290942 3300006847 Bacteria 1652
165 Ga0075433_10027140 3300006852 Bacteria 4855
166 Ga0075433_10288508 3300006852 Bacteria 1453
167 Ga0075434_100057079 3300006871 Bacteria 3880
168 Ga0075434_100063484 3300006871 Bacteria 3676
169 Ga0075434_100096600 3300006871 Bacteria 2959
170 Ga0075434_100106592 3300006871 Bacteria 2812
171 Ga0075434_100483827 3300006871 Bacteria 1259
172 Ga0075434_100489410 3300006871 Bacteria 1251
173 Ga0075429_100002277 3300006880 Bacteria 16101
174 Ga0075429_100108727 3300006880 Bacteria 2424
175 Ga0075429_100132935 3300006880 Bacteria 2177
176 Ga0075429_100181942 3300006880 Bacteria 1842
177 Ga0075429_100557987 3300006880 Bacteria 1004
178 Ga0068865_100017807 3300006881 Bacteria 4574
179 Ga0068865_100025224 3300006881 Bacteria 3908
180 Ga0068865_100077415 3300006881 Bacteria 2377
181 Ga0075436_100076245 3300006914 Bacteria 2321
182 Ga0097620_100045123 3300006931 Bacteria 4428
183 Ga0097620_100086200 3300006931 Bacteria 3187
184 Ga0097620_100385628 3300006931 Bacteria 1497
185 Ga0075435_100138567 3300007076 Bacteria 2040
186 Ga0075435_100164303 3300007076 Bacteria 1871
187 Ga0099794_10001061 3300007265 Bacteria 9382
188 Ga0099794_10050575 3300007265 Bacteria 1999
189 Ga0099794_10079138 3300007265 Bacteria 1619
190 Ga0105240_10035657 3300009093 Bacteria 6408
191 Ga0105240_10065574 3300009093 Bacteria 4507
192 Ga0105240_10067780 3300009093 Bacteria 4423
193 Ga0105240_10157751 3300009093 Bacteria 2697
194 Ga0111539_10022136 3300009094 Bacteria 7813
195 Ga0111539_10024866 3300009094 Bacteria 7344
196 Ga0111539_10243231 3300009094 Bacteria 2095
197 Ga0111539_10399809 3300009094 Bacteria 1600
198 Ga0105245_10015251 3300009098 Bacteria 6695
199 Ga0114129_10031735 3300009147 Bacteria 7467
200 Ga0114129_10074684 3300009147 Bacteria 4722
201 Ga0114129_10202299 3300009147 Bacteria 2689
202 Ga0114129_10547336 3300009147 Bacteria 1505
203 Ga0114129_10561541 3300009147 Bacteria 1483
204 Ga0114129_10934863 3300009147 Bacteria 1096
205 Ga0105243_10133694 3300009148 Bacteria 2108
206 Ga0105241_10205591 3300009174 Bacteria 1647
207 Ga0105248_10081410 3300009177 Bacteria 3639
208 Ga0105238_10000019 3300009551 Bacteria 212662
209 Ga0105249_10000007 3300009553 Bacteria 349503
210 Ga0105239_10278367 3300010375 Bacteria 1883
211 Ga0157373_10007013 3300013100 Bacteria 8396
212 Ga0157373_10025019 3300013100 Bacteria 4322
213 Ga0157373_10050262 3300013100 Bacteria 2969
214 Ga0157373_10229525 3300013100 Bacteria 1311
215 Ga0157371_10013441 3300013102 Bacteria 6215
216 Ga0157371_10096692 3300013102 Bacteria 2093
217 Ga0157370_10002242 3300013104 Bacteria 23517
218 Ga0157370_10011685 3300013104 Bacteria 9165
219 Ga0157370_10133566 3300013104 Bacteria 2314
220 Ga0157369_10024125 3300013105 Bacteria 6769
221 Ga0157369_10048176 3300013105 Bacteria 4624
222 Ga0157369_10089530 3300013105 Bacteria 3285
223 Ga0157369_10244144 3300013105 Bacteria 1875
224 Ga0157374_10420462 3300013296 Bacteria 1335
225 Ga0157378_10098678 3300013297 Bacteria 2664
226 Ga0157378_10108055 3300013297 Bacteria 2547
227 Ga0157378_10108329 3300013297 Bacteria 2544
228 Ga0157378_10155824 3300013297 Bacteria 2132
229 Ga0157378_10213383 3300013297 Bacteria 1831
230 Ga0163162_10003925 3300013306 Bacteria 14276
231 Ga0163162_10575576 3300013306 Bacteria 1253
232 Ga0157372_10005657 3300013307 Bacteria 13294
233 Ga0157372_10023758 3300013307 Bacteria 6649
234 Ga0157372_10023961 3300013307 Bacteria 6621
235 Ga0157372_10052981 3300013307 Bacteria 4520
236 Ga0157372_10207030 3300013307 Bacteria 2273
237 Ga0157372_10250923 3300013307 Bacteria 2054
238 Ga0157372_10800152 3300013307 Bacteria 1095
239 Ga0157375_10146445 3300013308 Bacteria 2492
240 Ga0157375_10663437 3300013308 Bacteria 1198
241 Ga0157380_10099681 3300014326 Bacteria 2417
242 Ga0182008_10021888 3300014497 Bacteria 3280
243 Ga0157377_10103990 3300014745 Bacteria 1697
244 Ga0157379_10001076 3300014968 Bacteria 22262
245 Ga0157376_10069179 3300014969 Bacteria 2992
246 Ga0157376_10268607 3300014969 Bacteria 1601
247 Ga0157376_10342272 3300014969 Bacteria 1429
248 Ga0197907_10470673 3300020069 Bacteria 3760
249 Ga0206356_10472128 3300020070 Bacteria 3196
250 Ga0206351_10303140 3300020077 Bacteria 3740
251 Ga0206352_11003307 3300020078 Bacteria 3289
252 Ga0206350_10432484 3300020080 Bacteria 4586
253 Ga0224712_10001472 3300022467 Bacteria 5432
254 Ga0209672_100402 3300025228 Bacteria 25763
255 Ga0209455_1012494 3300025272 Bacteria 2029
256 Ga0207656_10151175 3300025321 Bacteria 1099
257 Ga0207642_10106257 3300025899 Bacteria 1420
258 Ga0207699_10028886 3300025906 Bacteria 3087
259 Ga0207645_10015703 3300025907 Bacteria 5022
260 Ga0207645_10121680 3300025907 Bacteria 1694
261 Ga0207645_10156712 3300025907 Bacteria 1488
262 Ga0207645_10157473 3300025907 Bacteria 1485
263 Ga0207643_10002748 3300025908 Bacteria 9528
264 Ga0207705_10040028 3300025909 Bacteria 3360
265 Ga0207705_10408875 3300025909 Bacteria 1050
266 Ga0207684_10407563 3300025910 Bacteria 1168
267 Ga0207707_10001265 3300025912 Bacteria 23604
268 Ga0207707_10003653 3300025912 Bacteria 13645
269 Ga0207707_10004396 3300025912 Bacteria 12444
270 Ga0207707_10034374 3300025912 Bacteria 4435
271 Ga0207707_10195531 3300025912 Bacteria 1764
272 Ga0207707_10201081 3300025912 Bacteria 1737
273 Ga0207695_10062454 3300025913 Bacteria 3845
274 Ga0207695_10095705 3300025913 Bacteria 2973
275 Ga0207671_10117393 3300025914 Bacteria 2031
276 Ga0207693_10025016 3300025915 Bacteria 4735
277 Ga0207663_10271684 3300025916 Bacteria 1256
278 Ga0207663_10324568 3300025916 Bacteria 1158
279 Ga0207660_10088240 3300025917 Bacteria 2293
280 Ga0207660_10161035 3300025917 Bacteria 1731
281 Ga0207660_10306658 3300025917 Bacteria 1265
282 Ga0207660_10420970 3300025917 Bacteria 1077
283 Ga0207662_10039403 3300025918 Bacteria 2772
284 Ga0207662_10043597 3300025918 Bacteria 2647
285 Ga0207662_10055014 3300025918 Bacteria 2374
286 Ga0207657_10005761 3300025919 Bacteria 12919
287 Ga0207657_10051778 3300025919 Bacteria 3567
288 Ga0207657_10113672 3300025919 Bacteria 2233
289 Ga0207657_10187775 3300025919 Bacteria 1668
290 Ga0207649_10065186 3300025920 Bacteria 2305
291 Ga0207649_10240518 3300025920 Bacteria 1299
292 Ga0207652_10003013 3300025921 Bacteria 14070
293 Ga0207652_10008208 3300025921 Bacteria 8385
294 Ga0207652_10025772 3300025921 Bacteria 4892
295 Ga0207652_10191718 3300025921 Bacteria 1838
296 Ga0207652_10210582 3300025921 Bacteria 1750
297 Ga0207652_10288369 3300025921 Bacteria 1481
298 Ga0207646_10004821 3300025922 Bacteria 14458
299 Ga0207646_10016603 3300025922 Bacteria 6906
300 Ga0207646_10047522 3300025922 Bacteria 3849
301 Ga0207646_10053423 3300025922 Bacteria 3614
302 Ga0207646_10176385 3300025922 Bacteria 1930
303 Ga0207646_10235163 3300025922 Bacteria 1655
304 Ga0207646_10287069 3300025922 Bacteria 1487
305 Ga0207681_10001340 3300025923 Bacteria 15896
306 Ga0207681_10015755 3300025923 Bacteria 4719
307 Ga0207694_10000032 3300025924 Bacteria 212686
308 Ga0207659_10123337 3300025926 Bacteria 1988
309 Ga0207659_10389817 3300025926 Bacteria 1163
310 Ga0207687_10345544 3300025927 Bacteria 1211
311 Ga0207664_10023095 3300025929 Bacteria 4655
312 Ga0207706_10014452 3300025933 Bacteria 7155
313 Ga0207706_10017662 3300025933 Bacteria 6428
314 Ga0207706_10038207 3300025933 Bacteria 4258
315 Ga0207670_10124201 3300025936 Bacteria 1881
316 Ga0207704_10078898 3300025938 Bacteria 2119
317 Ga0207704_10133737 3300025938 Bacteria 1722
318 Ga0207704_10163132 3300025938 Bacteria 1588
319 Ga0207665_10008563 3300025939 Bacteria 6731
320 Ga0207691_10001553 3300025940 Bacteria 22768
321 Ga0207691_10069078 3300025940 Bacteria 3192
322 Ga0207691_10106895 3300025940 Bacteria 2492
323 Ga0207691_10313920 3300025940 Bacteria 1345
324 Ga0207689_10047354 3300025942 Bacteria 3551
325 Ga0207661_10002906 3300025944 Bacteria 11842
326 Ga0207661_10003891 3300025944 Bacteria 10413
327 Ga0207661_10161446 3300025944 Bacteria 1944
328 Ga0207679_10015874 3300025945 Bacteria 4991
329 Ga0207679_10261542 3300025945 Bacteria 1476
330 Ga0207679_10290596 3300025945 Bacteria 1405
331 Ga0207667_10132547 3300025949 Bacteria 2567
332 Ga0207667_10483262 3300025949 Bacteria 1257
333 Ga0207667_10604134 3300025949 Bacteria 1106
334 Ga0207651_10212647 3300025960 Bacteria 1558
335 Ga0207712_10000024 3300025961 Bacteria 275176
336 Ga0207712_10000298 3300025961 Bacteria 46541
337 Ga0207712_10122631 3300025961 Bacteria 1968
338 Ga0207668_10003413 3300025972 Bacteria 9318
339 Ga0207668_10305859 3300025972 Bacteria 1314
340 Ga0207640_10016868 3300025981 Bacteria 4258
341 Ga0207640_10103506 3300025981 Bacteria 2002
342 Ga0207677_10076183 3300026023 Bacteria 2387
343 Ga0207677_10226062 3300026023 Bacteria 1504
344 Ga0207677_10259783 3300026023 Bacteria 1415
345 Ga0207639_10134186 3300026041 Bacteria 2053
346 Ga0207708_10014689 3300026075 Bacteria 5861
347 Ga0207708_10031624 3300026075 Bacteria 4017
348 Ga0207708_10152368 3300026075 Bacteria 1821
349 Ga0207702_10045761 3300026078 Bacteria 3681
350 Ga0207641_10141844 3300026088 Bacteria 2169
351 Ga0207648_10034092 3300026089 Bacteria 4489
352 Ga0207648_10049944 3300026089 Bacteria 3658
353 Ga0207648_10311190 3300026089 Bacteria 1414
354 Ga0207648_10486509 3300026089 Bacteria 1128
355 Ga0207674_10003660 3300026116 Bacteria 18747
356 Ga0207674_10016242 3300026116 Bacteria 8155
357 Ga0207675_100000649 3300026118 Bacteria 34214
358 Ga0207675_100091610 3300026118 Bacteria 2858
359 Ga0207675_100334550 3300026118 Bacteria 1481
360 Ga0207675_100413233 3300026118 Bacteria 1331
361 Ga0207698_10136036 3300026142 Bacteria 2108
362 Ga0209969_1002372 3300027360 Bacteria 2603
363 Ga0209995_1004399 3300027471 Bacteria 2252
364 Ga0209588_1000103 3300027671 Bacteria 26577
365 Ga0209998_10000504 3300027717 Bacteria 10719
366 Ga0207428_10032552 3300027907 Bacteria 4287
367 Ga0268266_10000252 3300028379 Bacteria 90702
368 Ga0268264_10307345 3300028381 Bacteria 1495
369 Ga0265326_10001904 3300028558 Bacteria 7141
370 Ga0265319_1000176 3300028563 Bacteria 48499
371 Ga0265334_10000683 3300028573 Bacteria 16996
372 Ga0265318_10003782 3300028577 Bacteria 7519
373 Ga0265336_10000733 3300028666 Bacteria 17400
374 Ga0265338_10001266 3300028800 Bacteria 41690
375 Ga0265338_10223624 3300028800 Bacteria 1404
376 Ga0265332_10008369 3300031238 Bacteria 4649
377 Ga0265320_10007850 3300031240 Bacteria 6589
378 Ga0265340_10014062 3300031247 Bacteria 4190
379 Ga0265331_10011494 3300031250 Bacteria 4845
380 Ga0265316_10012652 3300031344 Bacteria 7554
381 Ga0307408_100003958 3300031548 Bacteria 10087
382 Ga0307408_100033487 3300031548 Bacteria 3590
383 Ga0307408_100064015 3300031548 Bacteria 2692
384 Ga0307408_100136921 3300031548 Bacteria 1917
385 Ga0307408_100581438 3300031548 Bacteria 992
386 Ga0265313_10007750 3300031595 Bacteria 7265
387 Ga0307514_10128534 3300031649 Bacteria 1750
388 Ga0265342_10003973 3300031712 Bacteria 11844
389 Ga0316576_10192148 3300031727 Bacteria 1539
390 Ga0307405_10000384 3300031731 Bacteria 16564
391 Ga0307405_10001863 3300031731 Bacteria 9056
392 Ga0307405_10100177 3300031731 Bacteria 1941
393 Ga0307405_10255267 3300031731 Bacteria 1307
394 Ga0307405_10326393 3300031731 Bacteria 1174
395 Ga0307413_10009816 3300031824 Bacteria 4604
396 Ga0307413_10031332 3300031824 Bacteria 3000
397 Ga0307413_10064165 3300031824 Bacteria 2280
398 Ga0307413_10100952 3300031824 Bacteria 1906
399 Ga0307413_10305674 3300031824 Bacteria 1208
400 Ga0307410_10008423 3300031852 Bacteria 5716
401 Ga0307410_10022510 3300031852 Bacteria 3897
402 Ga0307410_10025397 3300031852 Bacteria 3716
403 Ga0307410_10033513 3300031852 Bacteria 3316
404 Ga0307410_10044080 3300031852 Bacteria 2960
405 Ga0307410_10047360 3300031852 Bacteria 2873
406 Ga0307410_10100918 3300031852 Bacteria 2068
407 Ga0307410_10101286 3300031852 Bacteria 2065
408 Ga0307410_10201692 3300031852 Bacteria 1519
409 Ga0307410_10535807 3300031852 Bacteria 968
410 Ga0307410_10699943 3300031852 Bacteria 854
411 Ga0307406_10003163 3300031901 Bacteria 8957
412 Ga0307406_10006248 3300031901 Bacteria 6562
413 Ga0307406_10032860 3300031901 Bacteria 3170
414 Ga0307406_10411647 3300031901 Bacteria 1075
415 Ga0307407_10000106 3300031903 Bacteria 27091
416 Ga0307407_10015783 3300031903 Bacteria 3744
417 Ga0307407_10019121 3300031903 Bacteria 3481
418 Ga0307407_10029544 3300031903 Bacteria 2946
419 Ga0307407_10054294 3300031903 Bacteria 2310
420 Ga0307412_10033127 3300031911 Bacteria 3281
421 Ga0307412_10059852 3300031911 Bacteria 2554
422 Ga0307412_10088573 3300031911 Bacteria 2160
423 Ga0307412_10139331 3300031911 Bacteria 1774
424 Ga0307412_10213746 3300031911 Bacteria 1473
425 Ga0307409_100001226 3300031995 Bacteria 12354
426 Ga0307409_100001601 3300031995 Bacteria 11325
427 Ga0307409_100003802 3300031995 Bacteria 8318
428 Ga0307409_100148928 3300031995 Bacteria 2029
429 Ga0307409_100172855 3300031995 Bacteria 1903
430 Ga0307409_100219795 3300031995 Bacteria 1714
431 Ga0307409_100321879 3300031995 Bacteria 1447
432 Ga0307409_100485893 3300031995 Bacteria 1199
433 Ga0307409_100553586 3300031995 Bacteria 1129
434 Ga0307416_100002679 3300032002 Bacteria 10304
435 Ga0307416_100005221 3300032002 Bacteria 7943
436 Ga0307416_100116025 3300032002 Bacteria 2372
437 Ga0307416_100282051 3300032002 Bacteria 1638
438 Ga0307416_100461691 3300032002 Bacteria 1325
439 Ga0307416_100710034 3300032002 Bacteria 1095
440 Ga0307414_10040117 3300032004 Bacteria 3159
441 Ga0307414_10127895 3300032004 Bacteria 1966
442 Ga0307414_10134327 3300032004 Bacteria 1926
443 Ga0307414_10135472 3300032004 Bacteria 1919
444 Ga0307414_10174850 3300032004 Bacteria 1721
445 Ga0307414_10194705 3300032004 Bacteria 1643
446 Ga0307414_10354659 3300032004 Bacteria 1260
447 Ga0307411_10000333 3300032005 Bacteria 15820
448 Ga0307411_10006273 3300032005 Bacteria 5933
449 Ga0307411_10014006 3300032005 Bacteria 4449
450 Ga0307411_10016787 3300032005 Bacteria 4152
451 Ga0307411_10147626 3300032005 Bacteria 1743
452 Ga0307411_10254664 3300032005 Bacteria 1382
453 Ga0307411_10265580 3300032005 Bacteria 1358
454 Ga0307411_10298327 3300032005 Bacteria 1291
455 Ga0307415_100001095 3300032126 Bacteria 12603
456 Ga0307415_100017952 3300032126 Bacteria 4257
457 Ga0307415_100022029 3300032126 Bacteria 3926
458 Ga0307415_100074379 3300032126 Bacteria 2401
459 Ga0307415_100202784 3300032126 Bacteria 1575
460 Ga0373959_0000361 3300034820 Bacteria 9088
461 Ga0373926_0030597 3300035083 Bacteria 1896
462 Ga0373926_0031183 3300035083 Bacteria 1879
463 Ga0373929_0009433 3300035085 Bacteria 1810
464 Ga0373934_0000055 3300035086 Bacteria 38912
465 Ga0373934_0042201 3300035086 Bacteria 1801
466 Ga0373944_0037172 3300035089 Bacteria 1490
467 Ga0373923_0043646 3300035111 Bacteria 1856
468 Ga0373939_0038079 3300035114 Bacteria 1432
469 Ga0373941_0005976 3300035115 Bacteria 2903
470 Ga0373945_0017936 3300035116 Bacteria 2402
471 Ga0373954_0017946 3300035118 Bacteria 3182
472 Ga0373956_0000817 3300035119 Bacteria 12963
473 Ga0373943_0027950 3300035170 Bacteria 2655
474 Ga0373946_0025267 3300035171 Bacteria 2335
475 Ga0373955_0008578 3300035172 Bacteria 4752
476 Ga0373924_0019967 3300035410 Bacteria 2600
477 Ga0373935_0010304 3300035692 Bacteria 5605
478 Ga0373927_0056496 3300035695 Bacteria 2538
479 Ga0373933_0001568 3300035724 Bacteria 13379
480 Ga0373933_0011182 3300035724 Bacteria 4939
481 Ga0373947_0001880 3300035725 Bacteria 12815
482 Ga0373947_0012822 3300035725 Bacteria 4804
483 Ga0373937_0000332 3300036401 Bacteria 44807
484 Ga0373937_0038760 3300036401 Bacteria 4342
485 Ga0373925_0005556 3300037068 Bacteria 9387
486 Ga0373925_0014219 3300037068 Bacteria 5759
487 Ga0373925_0294157 3300037068 Bacteria 1310
488 Ga0373925_0558424 3300037068 Bacteria 942
489 Ga0395899_0004789 3300037312 Bacteria 10545
490 Ga0395900_0014715 3300037418 Bacteria 7977
491 Ga0395900_0327805 3300037418 Bacteria 1510
492 Ga0395900_0472046 3300037418 Bacteria 1208
493 Ga0395898_0001740 3300037466 Bacteria 28720
494 Ga0395905_0003219 3300037471 Bacteria 17561
495 Ga0395905_0075693 3300037471 Bacteria 3155
496 Ga0395905_0259484 3300037471 Bacteria 1622
497 Ga0395905_0268995 3300037471 Bacteria 1590
498 Ga0395905_0448679 3300037471 Bacteria 1188
499 Ga0395905_0459651 3300037471 Bacteria 1171
500 Ga0436364_0170159 3300037853 Bacteria 1918
501 Ga0395901_0004918 3300038443 Bacteria 13486
502 Ga0395901_0011697 3300038443 Bacteria 8893
503 Ga0439436_0009375 3300041404 Bacteria 3002
504 Ga0451837_1275193 3300041494 Bacteria 1160
505 Ga0451853_0402945 3300041512 Bacteria 1257
506 Ga0439433_0060241 3300041999 Bacteria 904
507 Ga0439445_0004855 3300042004 Bacteria 3054
508 Ga0439445_0067604 3300042004 Bacteria 985
509 Ga0439449_0023296 3300042007 Bacteria 2316
510 Ga0439455_0016860 3300042012 Bacteria 1694
511 Ga0450911_000139 3300042115 Bacteria 29273
512 Ga0450910_016311 3300042147 Bacteria 1099
513 Ga0439446_0051515 3300042156 Bacteria 1230
514 Ga0451577_0002080 3300042876 Bacteria 24661
515 Ga0451577_0010496 3300042876 Bacteria 8845
516 Ga0451577_0019571 3300042876 Bacteria 6222
517 Ga0451577_0222595 3300042876 Bacteria 1706
518 Ga0453683_0024007 3300044673 Bacteria 3883
519 Ga0453684_0000039 3300044712 Bacteria 697730
520 Ga0453684_0015069 3300044712 Bacteria 12267
521 Ga0453684_0050410 3300044712 Bacteria 5476
522 Ga0453684_0354289 3300044712 Bacteria 1654
523 Ga0466959_0026916 3300045049 Bacteria 4265
524 Ga0451576_0023642 3300045051 Bacteria 6652
525 Ga0466958_0032541 3300045836 Bacteria 3103
526 Ga0466967_0615888 3300045976 Bacteria 1072
527 Ga0495592_0010173 3300046454 Bacteria 7092
528 Ga0495603_0029980 3300046455 Bacteria 3279
529 Ga0495629_0007408 3300046459 Bacteria 8087
530 Ga0495629_0029608 3300046459 Bacteria 3882
531 Ga0495629_0273652 3300046459 Bacteria 1160
532 Ga0495638_0000127 3300046460 Bacteria 123576
533 Ga0495638_0013075 3300046460 Bacteria 5667
534 Ga0495651_0000644 3300046462 Bacteria 26939
535 Ga0495653_0000235 3300046463 Bacteria 44573
536 Ga0495580_0001202 3300046472 Bacteria 22775
537 Ga0495580_0069291 3300046472 Bacteria 2465
538 Ga0495639_0067318 3300046475 Bacteria 1649
539 Ga0495639_0084977 3300046475 Bacteria 1478
540 Ga0495606_0000516 3300046507 Bacteria 62632
541 Ga0495608_0001154 3300046511 Bacteria 18675
542 Ga0495618_0058424 3300046514 Bacteria 2443
543 Ga0495628_0003435 3300046516 Bacteria 14183
544 Ga0495628_0087517 3300046516 Bacteria 2415
545 Ga0495630_0008258 3300046517 Bacteria 7477
546 Ga0495630_0021278 3300046517 Bacteria 4789
547 Ga0495643_0000003 3300046522 Bacteria 571962
548 Ga0495652_0004567 3300046529 Bacteria 13203
549 Ga0495665_0003529 3300046531 Bacteria 8492
550 Ga0495586_0016195 3300046535 Bacteria 3966
551 Ga0495587_0000163 3300046536 Bacteria 48430
552 Ga0495645_0000866 3300046543 Bacteria 20642
553 Ga0495645_0017930 3300046543 Bacteria 5080
554 Ga0495622_0003838 3300046557 Bacteria 7020
555 Ga0495667_0001569 3300046559 Bacteria 15185
556 Ga0495625_0021562 3300046660 Bacteria 4957
557 Ga0495635_0000194 3300046663 Bacteria 38505
558 Ga0495588_0002501 3300046674 Bacteria 7875
559 Ga0495657_0000303 3300046675 Bacteria 44902
560 Ga0495599_0034902 3300046678 Bacteria 3158
561 Ga0495623_0000362 3300046679 Bacteria 29744
562 Ga0495646_0001096 3300046680 Bacteria 15748
563 Ga0495658_0352898 3300046683 Bacteria 935
564 Ga0495613_0086403 3300046689 Bacteria 2274
565 Ga0495613_0116142 3300046689 Bacteria 1925
566 Ga0495649_0005043 3300046694 Bacteria 8488
567 Ga0495600_0001333 3300046809 Bacteria 13625
568 Ga0495581_0003541 3300047315 Bacteria 8963
569 Ga0495581_0089198 3300047315 Bacteria 1788
570 Ga0495581_0133888 3300047315 Bacteria 1444
571 Ga0495604_0002244 3300047317 Bacteria 15475
572 Ga0495674_0003135 3300047319 Bacteria 16065
573 Ga0495674_0317865 3300047319 Bacteria 1269
574 Ga0495680_0005929 3300047322 Bacteria 11417
575 Ga0495675_0001215 3300047444 Bacteria 15602
576 Ga0495679_043841 3300047446 Bacteria 1373
577 Ga0495684_0001920 3300047471 Bacteria 16657
578 Ga0495593_0003245 3300047673 Bacteria 9748
579 Ga0495602_0004928 3300048088 Bacteria 13979
580 Ga0495614_0033366 3300048089 Bacteria 2214
581 Ga0496112_0017057 3300048915 Bacteria 6817
582 Ga0496112_0138489 3300048915 Bacteria 2404
583 Ga0496112_0206053 3300048915 Bacteria 1925
584 Ga0496112_0359063 3300048915 Bacteria 1399
585 Ga0496115_0000971 3300048918 Bacteria 20830
586 Ga0496126_0011359 3300048929 Bacteria 9232
587 Ga0496126_0034406 3300048929 Bacteria 4758
588 Ga0496126_0072267 3300048929 Bacteria 3069
589 Ga0495678_004329 3300049459 Bacteria 8271
590 Ga0495682_0004746 3300049460 Bacteria 5744
591 Ga0501040_0005705 3300049576 Bacteria 8052
592 Ga0501041_0037391 3300049577 Bacteria 2942
593 Ga0501046_0105611 3300049580 Bacteria 2157
594 Ga0501047_0018499 3300049581 Bacteria 6682
595 Ga0501048_0047829 3300049582 Bacteria 3052
596 Ga0501067_0140839 3300049583 Bacteria 1343
597 Ga0501070_0192270 3300049586 Bacteria 1677
598 Ga0501072_0094923 3300049588 Bacteria 2370
599 Ga0501073_0129369 3300049589 Bacteria 1750
600 Ga0501075_0114794 3300049591 Bacteria 2048
601 Ga0501075_0191422 3300049591 Bacteria 1560
602 Ga0501076_0084373 3300049592 Bacteria 2552
603 Ga0501208_011454 3300049655 Bacteria 1278
604 Ga0501223_019911 3300049663 Bacteria 1317
605 Ga0501235_039742 3300049669 Bacteria 1074
606 Ga0501242_004993 3300049674 Bacteria 1482
607 Ga0501242_014772 3300049674 Bacteria 969
608 Ga0501249_056251 3300049679 Bacteria 908
609 Ga0501252_001031 3300049682 Bacteria 2448
610 Ga0501259_003989 3300049688 Bacteria 2344
611 Ga0501259_025403 3300049688 Bacteria 1085
612 Ga0501079_0186577 3300049741 Bacteria 1619
613 Ga0501079_0409331 3300049741 Bacteria 1064
614 Ga0501080_0261910 3300049742 Bacteria 1575
615 Ga0501081_0117493 3300049743 Bacteria 1892
616 Ga0501268_021995 3300049765 Bacteria 1098
617 Ga0501272_005057 3300049769 Bacteria 1383
618 nmdc:mga00v17_62836_c1 3300050491 Bacteria 2286
619 nmdc:mga05p37_15800_c1 3300050507 Bacteria 9078
620 nmdc:mga05p37_262865_c1 3300050507 Bacteria 2064
621 nmdc:mga05p37_265675_c1 3300050507 Bacteria 2052
622 nmdc:mga09592_1957_c1 3300050508 Bacteria 16597
623 nmdc:mga09592_24349_c1 3300050508 Bacteria 5005
624 nmdc:mga0qj67_15466_c1 3300050509 Bacteria 5777
625 nmdc:mga0qj67_17148_c1 3300050509 Bacteria 5504
626 nmdc:mga0qj67_4501_c1 3300050509 Bacteria 10099
627 nmdc:mga0qj67_6087_c1 3300050509 Bacteria 8837
628 nmdc:mga06r32_145675_c1 3300050510 Bacteria 2346
629 nmdc:mga06r32_177369_c1 3300050510 Bacteria 2115
630 nmdc:mga06r32_288982_c1 3300050510 Bacteria 1626
631 nmdc:mga06r32_430008_c1 3300050510 Bacteria 1301
632 nmdc:mga06r32_6684_c1 3300050510 Bacteria 10363
633 nmdc:mga06r32_67963_c1 3300050510 Bacteria 3441
634 nmdc:mga08y16_121740_c1 3300050511 Bacteria 2715
635 nmdc:mga08y16_221338_c1 3300050511 Bacteria 1959
636 nmdc:mga08y16_22793_c1 3300050511 Bacteria 6608
637 nmdc:mga08y16_274853_c1 3300050511 Bacteria 1739
638 nmdc:mga0n895_32740_c1 3300050512 Bacteria 4990
639 nmdc:mga0n895_43072_c1 3300050512 Bacteria 4397
640 nmdc:mga0n895_67873_c1 3300050512 Bacteria 3532
641 nmdc:mga08x19_203102_c1 3300050514 Bacteria 1359
642 nmdc:mga08x19_294421_c1 3300050514 Bacteria 1126
643 nmdc:mga08x19_30345_c1 3300050514 Bacteria 3396
644 nmdc:mga08x19_44508_c1 3300050514 Bacteria 2834
645 nmdc:mga08x19_53410_c1 3300050514 Bacteria 2600
646 Ga0495612_0003807 3300053078 Bacteria 6268
647 Ga0495619_0005143 3300053085 Bacteria 8306
648 Ga0500628_006220 3300053129 Bacteria 2011
649 Ga0501084_0169104 3300054114 Bacteria 1845
650 Ga0590071_008724 3300059421 Bacteria 2383
651 2919516939 2919513703 Bacteria 3844312
652 2919677105 2919675420 Bacteria 3969095
653 Ga0070670_100030927
654 JGI24735J21928_10032065
655 rootL2_10023374
656 Ga0065704_10111997
657 Ga0065712_10076995
658 Ga0070658_10001438
659 Ga0070658_10186538
660 Ga0070658_10594164
661 Ga0070676_10049470
662 Ga0070676_10099121
663 Ga0070676_10148236
664 Ga0070683_100004030
665 Ga0070683_100024127
666 Ga0070683_100344377
667 Ga0070683_100429428
668 Ga0070683_100433666
669 Ga0070690_100070809
670 Ga0070690_100073316
671 Ga0070690_100119164
672 Ga0070690_100304291
673 Ga0070680_100003745
674 Ga0070680_100006609
675 Ga0070680_100044155
676 Ga0070680_100077306
677 Ga0070680_100304050
678 Ga0070680_100325463
679 Ga0070680_100492183
680 Ga0070682_100007445
681 Ga0070682_100013680
682 Ga0070682_100043886
683 Ga0068868_100143841
684 Ga0068868_100286942
685 Ga0070660_100002035
686 Ga0070691_10142890
687 Ga0070687_100139536
688 Ga0070687_100190804
689 Ga0070661_100170839
690 Ga0070661_100207330
691 Ga0070692_10027025
692 Ga0070668_100001189
693 Ga0070668_100190803
694 Ga0070668_100249407
695 Ga0070668_100506395
696 Ga0070669_100009120
697 Ga0070669_100123472
698 Ga0070669_100151101
699 Ga0070675_100020429
700 Ga0070675_100145752
701 Ga0070671_100175530
702 Ga0070688_100115797
703 Ga0070688_100277467
704 Ga0070659_100040326
705 Ga0070659_100580109
706 Ga0070714_100091743
707 Ga0070713_100004184
708 Ga0070713_100008441
709 Ga0070701_10119098
710 Ga0070700_100055874
711 Ga0070694_100011761
712 Ga0070694_100104811
713 Ga0070708_100000224
714 Ga0070663_100092393
715 Ga0070678_100452904
716 Ga0070662_100024843
717 Ga0070662_100104971
718 Ga0070662_100169084
719 Ga0070681_10003651
720 Ga0070681_10013216
721 Ga0070681_10039490
722 Ga0070681_10174712
723 Ga0068867_100043132
724 Ga0068867_100046450
725 Ga0068867_100068117
726 Ga0068867_100102860
727 Ga0068867_100104887
728 Ga0070685_10006891
729 Ga0070685_10028905
730 Ga0070685_10077922
731 Ga0070706_100089204
732 Ga0070706_100122418
733 Ga0070706_100213222
734 Ga0070707_100000567
735 Ga0070707_100003023
736 Ga0070707_100092334
737 Ga0070707_100335036
738 Ga0070698_100052647
739 Ga0070698_100075334
740 Ga0070698_100137906
741 Ga0070699_100004540
742 Ga0070699_100017844
743 Ga0070699_100051424
744 Ga0070699_100275676
745 Ga0070699_100303346
746 Ga0070699_100416093
747 Ga0070679_100003478
748 Ga0070679_100020278
749 Ga0070679_100064362
750 Ga0070679_100080455
751 Ga0070679_100102269
752 Ga0070679_100149402
753 Ga0070679_100156771
754 Ga0070679_100160110
755 Ga0070684_100006771
756 Ga0070684_100021927
757 Ga0070684_100179456
758 Ga0070684_100376687
759 Ga0070697_100053565
760 Ga0070697_100059517
761 Ga0070697_100207181
762 Ga0068853_100099032
763 Ga0070672_100053192
764 Ga0070672_100067173
765 Ga0070695_100002750
766 Ga0070695_100028294
767 Ga0070695_100164527
768 Ga0070696_100034858
769 Ga0070696_100158509
770 Ga0070696_100159540
771 Ga0070665_100000365
772 Ga0070704_100000795
773 Ga0068855_100018134
774 Ga0068855_100047726
775 Ga0068855_100157583
776 Ga0070664_100031147
777 Ga0070664_100195163
778 Ga0068857_100012439
779 Ga0068857_100087846
780 Ga0068857_100235952
781 Ga0068854_100110615
782 Ga0068854_100244428
783 Ga0068854_100359151
784 Ga0068856_100275587
785 Ga0070702_100082160
786 Ga0070702_100287685
787 Ga0068852_100046821
788 Ga0068852_100063767
789 Ga0068852_100294420
790 Ga0068859_100045124
791 Ga0068859_100086199
792 Ga0068859_100385651
793 Ga0068864_100098933
794 Ga0068866_10113891
795 Ga0068861_100009036
796 Ga0068861_100334823
797 Ga0068860_100359993
798 Ga0068862_100002086
799 Ga0070717_10005702
800 Ga0070717_10169200
801 Ga0075364_10194897
802 Ga0070716_100073484
803 Ga0070712_100235502
804 Ga0070712_100410380
805 Ga0075428_100019809
806 Ga0075428_100022620
807 Ga0075428_100128368
808 Ga0075430_100010797
809 Ga0075430_100019476
810 Ga0075430_100177058
811 Ga0075430_100244103
812 Ga0075431_100030965
813 Ga0075431_100044250
814 Ga0075431_100105445
815 Ga0075431_100165924
816 Ga0075431_100290942
817 Ga0075433_10027140
818 Ga0075433_10288508
819 Ga0075434_100057079
820 Ga0075434_100063484
821 Ga0075434_100096600
822 Ga0075434_100106592
823 Ga0075434_100483827
824 Ga0075434_100489410
825 Ga0075429_100002277
826 Ga0075429_100108727
827 Ga0075429_100132935
828 Ga0075429_100181942
829 Ga0075429_100557987
830 Ga0068865_100017807
831 Ga0068865_100025224
832 Ga0068865_100077415
833 Ga0075436_100076245
834 Ga0097620_100045123
835 Ga0097620_100086200
836 Ga0097620_100385628
837 Ga0075435_100138567
838 Ga0075435_100164303
839 Ga0099794_10001061
840 Ga0099794_10050575
841 Ga0099794_10079138
842 Ga0105240_10035657
843 Ga0105240_10065574
844 Ga0105240_10067780
845 Ga0105240_10157751
846 Ga0111539_10022136
847 Ga0111539_10024866
848 Ga0111539_10243231
849 Ga0111539_10399809
850 Ga0105245_10015251
851 Ga0114129_10031735
852 Ga0114129_10074684
853 Ga0114129_10202299
854 Ga0114129_10547336
855 Ga0114129_10561541
856 Ga0114129_10934863
857 Ga0105243_10133694
858 Ga0105241_10205591
859 Ga0105248_10081410
860 Ga0105238_10000019
861 Ga0105249_10000007
862 Ga0105239_10278367
863 Ga0157373_10007013
864 Ga0157373_10025019
865 Ga0157373_10050262
866 Ga0157373_10229525
867 Ga0157371_10013441
868 Ga0157371_10096692
869 Ga0157370_10002242
870 Ga0157370_10011685
871 Ga0157370_10133566
872 Ga0157369_10024125
873 Ga0157369_10048176
874 Ga0157369_10089530
875 Ga0157369_10244144
876 Ga0157374_10420462
877 Ga0157378_10098678
878 Ga0157378_10108055
879 Ga0157378_10108329
880 Ga0157378_10155824
881 Ga0157378_10213383
882 Ga0163162_10003925
883 Ga0163162_10575576
884 Ga0157372_10005657
885 Ga0157372_10023758
886 Ga0157372_10023961
887 Ga0157372_10052981
888 Ga0157372_10207030
889 Ga0157372_10250923
890 Ga0157372_10800152
891 Ga0157375_10146445
892 Ga0157375_10663437
893 Ga0157380_10099681
894 Ga0182008_10021888
895 Ga0157377_10103990
896 Ga0157379_10001076
897 Ga0157376_10069179
898 Ga0157376_10268607
899 Ga0157376_10342272
900 Ga0197907_10470673
901 Ga0206356_10472128
902 Ga0206351_10303140
903 Ga0206352_11003307
904 Ga0206350_10432484
905 Ga0224712_10001472
906 Ga0209672_100402
907 Ga0209455_1012494
908 Ga0207656_10151175
909 Ga0207642_10106257
910 Ga0207699_10028886
911 Ga0207645_10015703
912 Ga0207645_10121680
913 Ga0207645_10156712
914 Ga0207645_10157473
915 Ga0207643_10002748
916 Ga0207705_10040028
917 Ga0207705_10408875
918 Ga0207684_10407563
919 Ga0207707_10001265
920 Ga0207707_10003653
921 Ga0207707_10004396
922 Ga0207707_10034374
923 Ga0207707_10195531
924 Ga0207707_10201081
925 Ga0207695_10062454
926 Ga0207695_10095705
927 Ga0207671_10117393
928 Ga0207693_10025016
929 Ga0207663_10271684
930 Ga0207663_10324568
931 Ga0207660_10088240
932 Ga0207660_10161035
933 Ga0207660_10306658
934 Ga0207660_10420970
935 Ga0207662_10039403
936 Ga0207662_10043597
937 Ga0207662_10055014
938 Ga0207657_10005761
939 Ga0207657_10051778
940 Ga0207657_10113672
941 Ga0207657_10187775
942 Ga0207649_10065186
943 Ga0207649_10240518
944 Ga0207652_10003013
945 Ga0207652_10008208
946 Ga0207652_10025772
947 Ga0207652_10191718
948 Ga0207652_10210582
949 Ga0207652_10288369
950 Ga0207646_10004821
951 Ga0207646_10016603
952 Ga0207646_10047522
953 Ga0207646_10053423
954 Ga0207646_10176385
955 Ga0207646_10235163
956 Ga0207646_10287069
957 Ga0207681_10001340
958 Ga0207681_10015755
959 Ga0207694_10000032
960 Ga0207659_10123337
961 Ga0207659_10389817
962 Ga0207687_10345544
963 Ga0207664_10023095
964 Ga0207706_10014452
965 Ga0207706_10017662
966 Ga0207706_10038207
967 Ga0207670_10124201
968 Ga0207704_10078898
969 Ga0207704_10133737
970 Ga0207704_10163132
971 Ga0207665_10008563
972 Ga0207691_10001553
973 Ga0207691_10069078
974 Ga0207691_10106895
975 Ga0207691_10313920
976 Ga0207689_10047354
977 Ga0207661_10002906
978 Ga0207661_10003891
979 Ga0207661_10161446
980 Ga0207679_10015874
981 Ga0207679_10261542
982 Ga0207679_10290596
983 Ga0207667_10132547
984 Ga0207667_10483262
985 Ga0207667_10604134
986 Ga0207651_10212647
987 Ga0207712_10000024
988 Ga0207712_10000298
989 Ga0207712_10122631
990 Ga0207668_10003413
991 Ga0207668_10305859
992 Ga0207640_10016868
993 Ga0207640_10103506
994 Ga0207677_10076183
995 Ga0207677_10226062
996 Ga0207677_10259783
997 Ga0207639_10134186
998 Ga0207708_10014689
999 Ga0207708_10031624
1000 Ga0207708_10152368
1001 Ga0207702_10045761
1002 Ga0207641_10141844
1003 Ga0207648_10034092
1004 Ga0207648_10049944
1005 Ga0207648_10311190
1006 Ga0207648_10486509
1007 Ga0207674_10003660
1008 Ga0207674_10016242
1009 Ga0207675_100000649
1010 Ga0207675_100091610
1011 Ga0207675_100334550
1012 Ga0207675_100413233
1013 Ga0207698_10136036
1014 Ga0209969_1002372
1015 Ga0209995_1004399
1016 Ga0209588_1000103
1017 Ga0209998_10000504
1018 Ga0207428_10032552
1019 Ga0268266_10000252
1020 Ga0268264_10307345
1021 Ga0265326_10001904
1022 Ga0265319_1000176
1023 Ga0265334_10000683
1024 Ga0265318_10003782
1025 Ga0265336_10000733
1026 Ga0265338_10001266
1027 Ga0265338_10223624
1028 Ga0265332_10008369
1029 Ga0265320_10007850
1030 Ga0265340_10014062
1031 Ga0265331_10011494
1032 Ga0265316_10012652
1033 Ga0307408_100003958
1034 Ga0307408_100033487
1035 Ga0307408_100064015
1036 Ga0307408_100136921
1037 Ga0307408_100581438
1038 Ga0265313_10007750
1039 Ga0307514_10128534
1040 Ga0265342_10003973
1041 Ga0316576_10192148
1042 Ga0307405_10000384
1043 Ga0307405_10001863
1044 Ga0307405_10100177
1045 Ga0307405_10255267
1046 Ga0307405_10326393
1047 Ga0307413_10009816
1048 Ga0307413_10031332
1049 Ga0307413_10064165
1050 Ga0307413_10100952
1051 Ga0307413_10305674
1052 Ga0307410_10008423
1053 Ga0307410_10022510
1054 Ga0307410_10025397
1055 Ga0307410_10033513
1056 Ga0307410_10044080
1057 Ga0307410_10047360
1058 Ga0307410_10100918
1059 Ga0307410_10101286
1060 Ga0307410_10201692
1061 Ga0307410_10535807
1062 Ga0307410_10699943
1063 Ga0307406_10003163
1064 Ga0307406_10006248
1065 Ga0307406_10032860
1066 Ga0307406_10411647
1067 Ga0307407_10000106
1068 Ga0307407_10015783
1069 Ga0307407_10019121
1070 Ga0307407_10029544
1071 Ga0307407_10054294
1072 Ga0307412_10033127
1073 Ga0307412_10059852
1074 Ga0307412_10088573
1075 Ga0307412_10139331
1076 Ga0307412_10213746
1077 Ga0307409_100001226
1078 Ga0307409_100001601
1079 Ga0307409_100003802
1080 Ga0307409_100148928
1081 Ga0307409_100172855
1082 Ga0307409_100219795
1083 Ga0307409_100321879
1084 Ga0307409_100485893
1085 Ga0307409_100553586
1086 Ga0307416_100002679
1087 Ga0307416_100005221
1088 Ga0307416_100116025
1089 Ga0307416_100282051
1090 Ga0307416_100461691
1091 Ga0307416_100710034
1092 Ga0307414_10040117
1093 Ga0307414_10127895
1094 Ga0307414_10134327
1095 Ga0307414_10135472
1096 Ga0307414_10174850
1097 Ga0307414_10194705
1098 Ga0307414_10354659
1099 Ga0307411_10000333
1100 Ga0307411_10006273
1101 Ga0307411_10014006
1102 Ga0307411_10016787
1103 Ga0307411_10147626
1104 Ga0307411_10254664
1105 Ga0307411_10265580
1106 Ga0307411_10298327
1107 Ga0307415_100001095
1108 Ga0307415_100017952
1109 Ga0307415_100022029
1110 Ga0307415_100074379
1111 Ga0307415_100202784
1112 Ga0373959_0000361
1113 Ga0373926_0030597
1114 Ga0373926_0031183
1115 Ga0373929_0009433
1116 Ga0373934_0000055
1117 Ga0373934_0042201
1118 Ga0373944_0037172
1119 Ga0373923_0043646
1120 Ga0373939_0038079
1121 Ga0373941_0005976
1122 Ga0373945_0017936
1123 Ga0373954_0017946
1124 Ga0373956_0000817
1125 Ga0373943_0027950
1126 Ga0373946_0025267
1127 Ga0373955_0008578
1128 Ga0373924_0019967
1129 Ga0373935_0010304
1130 Ga0373927_0056496
1131 Ga0373933_0001568
1132 Ga0373933_0011182
1133 Ga0373947_0001880
1134 Ga0373947_0012822
1135 Ga0373937_0000332
1136 Ga0373937_0038760
1137 Ga0373925_0005556
1138 Ga0373925_0014219
1139 Ga0373925_0294157
1140 Ga0373925_0558424
1141 Ga0395899_0004789
1142 Ga0395900_0014715
1143 Ga0395900_0327805
1144 Ga0395900_0472046
1145 Ga0395898_0001740
1146 Ga0395905_0003219
1147 Ga0395905_0075693
1148 Ga0395905_0259484
1149 Ga0395905_0268995
1150 Ga0395905_0448679
1151 Ga0395905_0459651
1152 Ga0436364_0170159
1153 Ga0395901_0004918
1154 Ga0395901_0011697
1155 Ga0439436_0009375
1156 Ga0451837_1275193
1157 Ga0451853_0402945
1158 Ga0439433_0060241
1159 Ga0439445_0004855
1160 Ga0439445_0067604
1161 Ga0439449_0023296
1162 Ga0439455_0016860
1163 Ga0450911_000139
1164 Ga0450910_016311
1165 Ga0439446_0051515
1166 Ga0451577_0002080
1167 Ga0451577_0010496
1168 Ga0451577_0019571
1169 Ga0451577_0222595
1170 Ga0453683_0024007
1171 Ga0453684_0000039
1172 Ga0453684_0015069
1173 Ga0453684_0050410
1174 Ga0453684_0354289
1175 Ga0466959_0026916
1176 Ga0451576_0023642
1177 Ga0466958_0032541
1178 Ga0466967_0615888
1179 Ga0495592_0010173
1180 Ga0495603_0029980
1181 Ga0495629_0007408
1182 Ga0495629_0029608
1183 Ga0495629_0273652
1184 Ga0495638_0000127
1185 Ga0495638_0013075
1186 Ga0495651_0000644
1187 Ga0495653_0000235
1188 Ga0495580_0001202
1189 Ga0495580_0069291
1190 Ga0495639_0067318
1191 Ga0495639_0084977
1192 Ga0495606_0000516
1193 Ga0495608_0001154
1194 Ga0495618_0058424
1195 Ga0495628_0003435
1196 Ga0495628_0087517
1197 Ga0495630_0008258
1198 Ga0495630_0021278
1199 Ga0495643_0000003
1200 Ga0495652_0004567
1201 Ga0495665_0003529
1202 Ga0495586_0016195
1203 Ga0495587_0000163
1204 Ga0495645_0000866
1205 Ga0495645_0017930
1206 Ga0495622_0003838
1207 Ga0495667_0001569
1208 Ga0495625_0021562
1209 Ga0495635_0000194
1210 Ga0495588_0002501
1211 Ga0495657_0000303
1212 Ga0495599_0034902
1213 Ga0495623_0000362
1214 Ga0495646_0001096
1215 Ga0495658_0352898
1216 Ga0495613_0086403
1217 Ga0495613_0116142
1218 Ga0495649_0005043
1219 Ga0495600_0001333
1220 Ga0495581_0003541
1221 Ga0495581_0089198
1222 Ga0495581_0133888
1223 Ga0495604_0002244
1224 Ga0495674_0003135
1225 Ga0495674_0317865
1226 Ga0495680_0005929
1227 Ga0495675_0001215
1228 Ga0495679_043841
1229 Ga0495684_0001920
1230 Ga0495593_0003245
1231 Ga0495602_0004928
1232 Ga0495614_0033366
1233 Ga0496112_0017057
1234 Ga0496112_0138489
1235 Ga0496112_0206053
1236 Ga0496112_0359063
1237 Ga0496115_0000971
1238 Ga0496126_0011359
1239 Ga0496126_0034406
1240 Ga0496126_0072267
1241 Ga0495678_004329
1242 Ga0495682_0004746
1243 Ga0501040_0005705
1244 Ga0501041_0037391
1245 Ga0501046_0105611
1246 Ga0501047_0018499
1247 Ga0501048_0047829
1248 Ga0501067_0140839
1249 Ga0501070_0192270
1250 Ga0501072_0094923
1251 Ga0501073_0129369
1252 Ga0501075_0114794
1253 Ga0501075_0191422
1254 Ga0501076_0084373
1255 Ga0501208_011454
1256 Ga0501223_019911
1257 Ga0501235_039742
1258 Ga0501242_004993
1259 Ga0501242_014772
1260 Ga0501249_056251
1261 Ga0501252_001031
1262 Ga0501259_003989
1263 Ga0501259_025403
1264 Ga0501079_0186577
1265 Ga0501079_0409331
1266 Ga0501080_0261910
1267 Ga0501081_0117493
1268 Ga0501268_021995
1269 Ga0501272_005057
1270 nmdc:mga00v17_62836_c1
1271 nmdc:mga05p37_15800_c1
1272 nmdc:mga05p37_262865_c1
1273 nmdc:mga05p37_265675_c1
1274 nmdc:mga09592_1957_c1
1275 nmdc:mga09592_24349_c1
1276 nmdc:mga0qj67_15466_c1
1277 nmdc:mga0qj67_17148_c1
1278 nmdc:mga0qj67_4501_c1
1279 nmdc:mga0qj67_6087_c1
1280 nmdc:mga06r32_145675_c1
1281 nmdc:mga06r32_177369_c1
1282 nmdc:mga06r32_288982_c1
1283 nmdc:mga06r32_430008_c1
1284 nmdc:mga06r32_6684_c1
1285 nmdc:mga06r32_67963_c1
1286 nmdc:mga08y16_121740_c1
1287 nmdc:mga08y16_221338_c1
1288 nmdc:mga08y16_22793_c1
1289 nmdc:mga08y16_274853_c1
1290 nmdc:mga0n895_32740_c1
1291 nmdc:mga0n895_43072_c1
1292 nmdc:mga0n895_67873_c1
1293 nmdc:mga08x19_203102_c1
1294 nmdc:mga08x19_294421_c1
1295 nmdc:mga08x19_30345_c1
1296 nmdc:mga08x19_44508_c1
1297 nmdc:mga08x19_53410_c1
1298 Ga0495612_0003807
1299 Ga0495619_0005143
1300 Ga0500628_006220
1301 Ga0501084_0169104
1302 Ga0590071_008724
1303 2919516939
1304 2919677105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

126

306

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8693 1 262
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8334 1 262
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8233 1 261
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8126 7 273
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8076 4 273
ID Description Score Start End Superfamily
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9292 2 263 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.923 4 260 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9155 1 263 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9092 1 263 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9024 1 263 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2K1S7G9-F1-model_v4 deleted 0.9756 10 273
AF-A0A538EI26-F1-model_v4 Carbohydrate ABC transporter permease 0.9755 21 273 GO:0005886
GO:0055085
AF-A0A7C5IJK5-F1-model_v4 Carbohydrate ABC transporter permease 0.9743 19 262 GO:0005886
GO:0055085
AF-A0A353MRW1-F1-model_v4 deleted 0.9739 47 271
AF-A0A7V4KIJ1-F1-model_v4 Carbohydrate ABC transporter permease 0.9723 22 273 GO:0005886
GO:0055085

Map