F472653
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 315 | 634 | 507 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10024035|rootH1_100240358 |
| Length | 585 |
| Sequence | MTQAHVPPILAAIDMGSNSFRLELAQLQHGQYRRLDYLKETVRLGAGLDAMSMLTEEAAQRGLDCLRRFAERLADLPGRQVRAVATQTLREARNRNAFLARAQEVLGHPIEVISGREEARLIYAGVARLQTAEDPRLVIDIGGRSTEMILGRGPQPLAAESFQIGSVSLSMRFFTDGRFTAEAFRAAQVAAGAELEEAITQFSRQAAQPRWKQALGSSGTVGAVAQILAANGVSPDGSITLDGLRWCIEQCLLAGRIDALKLPGLKDDRRAVVGGGLCILYTLLTHFDIERLYPAKGALRQGVIFDLAERLDPRLLAAGRDMREQSVSELQRRFAVDRDQAGRVQRIAQRLHAQLAPKAEEEHRRELGWAAALHEIGMMVSHHDHHRHSAYLLSHVDAPGFSQNQLRRLGDLALGQRGGLRKLEEQLQEEPMVWQLLALRLAAIKCHARGEVDATAIKLRREGMNVVIEMRKGWADAHPRAHYLLREELGSARQAWPGPATRVGRTPTRSAHLRFASLGQTASKSVRSPTRVAGPGHARPGTGRTAEKGSEGDGWSGARQGSSWYRRIRACWALTCCGTPSVPMR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 10 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 11 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 12 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 13 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 14 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 15 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 16 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 17 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 18 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 19 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 20 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 21 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 22 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 23 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 24 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 25 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 26 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 34 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 210 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 232 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 233 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 240 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 294 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 303 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 313 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 315 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.93 |
| Metatranscriptomes | 0 |
| Isolates | 3.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.24 |
| Nodule | 0.77 |
| Rhizoplane | 2.15 |
| Rhizosphere | 63.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000049 | 3300002704 | Bacteria | 78961 |
| 2 | JGI25156J39149_1000023 | 3300002705 | Bacteria | 146831 |
| 3 | JGI25156J39149_1000142 | 3300002705 | Bacteria | 52807 |
| 4 | JGI25156J39149_1000220 | 3300002705 | Bacteria | 39809 |
| 5 | JGI25154J39366_1000036 | 3300002738 | Bacteria | 161697 |
| 6 | JGI25154J39366_1003097 | 3300002738 | Bacteria | 3730 |
| 7 | JGI25157J39369_1000023 | 3300002741 | Bacteria | 161697 |
| 8 | JGI25157J39369_1000135 | 3300002741 | Bacteria | 61510 |
| 9 | JGI25152J39213_1005234 | 3300002773 | Bacteria | 3856 |
| 10 | JGI25159J45721_1000160 | 3300002987 | Bacteria | 31836 |
| 11 | JGI25159J45721_1001766 | 3300002987 | Bacteria | 8691 |
| 12 | JGI25153J46596_10004040 | 3300003215 | Bacteria | 7999 |
| 13 | rootH1_10024035 | 3300003316 | Bacteria | 8072 |
| 14 | rootH1_10024035 | 3300003323 | Bacteria | 75545 |
| 15 | rootH1_10028438 | 3300003316 | Bacteria | 4544 |
| 16 | rootH1_10028438 | 3300003323 | Bacteria | 1649 |
| 17 | rootH2_10107905 | 3300003320 | Bacteria | 5069 |
| 18 | rootL2_10001692 | 3300003322 | Bacteria | 21923 |
| 19 | rootL2_10029717 | 3300003322 | Bacteria | 9471 |
| 20 | rootL2_10150743 | 3300003322 | Bacteria | 2608 |
| 21 | rootH1_10002882 | 3300003323 | Bacteria | 3948 |
| 22 | rootH1_10033303 | 3300003323 | Bacteria | 9630 |
| 23 | rootH1_10044884 | 3300003323 | Bacteria | 5575 |
| 24 | JGI25160J50197_1000283 | 3300003354 | Bacteria | 36700 |
| 25 | JGI25160J50197_1000291 | 3300003354 | Bacteria | 36039 |
| 26 | JGI25161J50226_1000015 | 3300003374 | Bacteria | 183773 |
| 27 | Ga0055539_1001240 | 3300003752 | Bacteria | 5124 |
| 28 | Ga0055539_1003715 | 3300003752 | Bacteria | 2088 |
| 29 | Ga0055533_1000172 | 3300003756 | Bacteria | 58634 |
| 30 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 31 | Ga0055535_1000641 | 3300003761 | Bacteria | 27812 |
| 32 | Ga0055529_1000602 | 3300003763 | Bacteria | 27804 |
| 33 | Ga0055526_1000280 | 3300003771 | Bacteria | 43010 |
| 34 | Ga0055526_1002747 | 3300003771 | Bacteria | 11677 |
| 35 | Ga0055526_1002757 | 3300003771 | Bacteria | 11647 |
| 36 | Ga0055537_1000353 | 3300003773 | Bacteria | 31178 |
| 37 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 38 | Ga0055524_1000125 | 3300003775 | Bacteria | 90042 |
| 39 | Ga0055524_1000332 | 3300003775 | Bacteria | 43781 |
| 40 | Ga0055524_1013413 | 3300003775 | Bacteria | 3089 |
| 41 | Ga0055534_1000758 | 3300003784 | Bacteria | 15348 |
| 42 | Ga0055528_1000467 | 3300003790 | Bacteria | 32327 |
| 43 | Ga0055530_10000470 | 3300003791 | Bacteria | 35231 |
| 44 | Ga0055530_10000506 | 3300003791 | Bacteria | 33825 |
| 45 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 46 | Ga0055540_1000144 | 3300003792 | Bacteria | 71420 |
| 47 | Ga0055540_1015157 | 3300003792 | Bacteria | 2259 |
| 48 | Ga0055531_10000168 | 3300003794 | Bacteria | 73798 |
| 49 | Ga0055531_10001304 | 3300003794 | Bacteria | 18797 |
| 50 | Ga0055531_10002564 | 3300003794 | Bacteria | 12058 |
| 51 | Ga0055543_1000366 | 3300004625 | Bacteria | 29918 |
| 52 | Ga0065165_1000569 | 3300005262 | Bacteria | 54781 |
| 53 | Ga0065165_1000967 | 3300005262 | Bacteria | 36011 |
| 54 | Ga0070658_10067036 | 3300005327 | Bacteria | 2932 |
| 55 | Ga0070658_10132277 | 3300005327 | Bacteria | 2079 |
| 56 | Ga0070676_10006846 | 3300005328 | Bacteria | 6103 |
| 57 | Ga0070676_10024703 | 3300005328 | Bacteria | 3388 |
| 58 | Ga0070676_10031112 | 3300005328 | Bacteria | 3047 |
| 59 | Ga0070683_100019870 | 3300005329 | Bacteria | 5971 |
| 60 | Ga0070670_100002757 | 3300005331 | Bacteria | 14508 |
| 61 | Ga0070670_100016141 | 3300005331 | Bacteria | 6410 |
| 62 | Ga0070670_100200726 | 3300005331 | Bacteria | 1733 |
| 63 | Ga0068869_100009386 | 3300005334 | Bacteria | 6347 |
| 64 | Ga0068869_100012836 | 3300005334 | Bacteria | 5545 |
| 65 | Ga0068869_100044676 | 3300005334 | Bacteria | 3186 |
| 66 | Ga0070666_10001889 | 3300005335 | Bacteria | 12748 |
| 67 | Ga0070666_10004949 | 3300005335 | Bacteria | 8151 |
| 68 | Ga0068868_100009443 | 3300005338 | Bacteria | 7021 |
| 69 | Ga0068868_100018937 | 3300005338 | Bacteria | 5153 |
| 70 | Ga0068868_100035076 | 3300005338 | Bacteria | 3876 |
| 71 | Ga0070660_100033296 | 3300005339 | Bacteria | 3884 |
| 72 | Ga0070660_100039589 | 3300005339 | Bacteria | 3584 |
| 73 | Ga0070687_100011716 | 3300005343 | Bacteria | 3848 |
| 74 | Ga0070661_100005430 | 3300005344 | Bacteria | 8788 |
| 75 | Ga0070661_100057373 | 3300005344 | Bacteria | 2853 |
| 76 | Ga0070668_100015572 | 3300005347 | Bacteria | 5683 |
| 77 | Ga0070668_100106439 | 3300005347 | Bacteria | 2228 |
| 78 | Ga0070669_100001532 | 3300005353 | Bacteria | 16719 |
| 79 | Ga0070669_100019216 | 3300005353 | Bacteria | 4881 |
| 80 | Ga0070669_100042130 | 3300005353 | Bacteria | 3321 |
| 81 | Ga0070675_100002630 | 3300005354 | Bacteria | 13494 |
| 82 | Ga0070675_100004892 | 3300005354 | Bacteria | 10219 |
| 83 | Ga0070675_100009918 | 3300005354 | Bacteria | 7426 |
| 84 | Ga0070675_100012854 | 3300005354 | Bacteria | 6570 |
| 85 | Ga0070675_100013570 | 3300005354 | Bacteria | 6407 |
| 86 | Ga0070671_100001183 | 3300005355 | Bacteria | 19526 |
| 87 | Ga0070671_100007139 | 3300005355 | Bacteria | 8925 |
| 88 | Ga0070671_100009160 | 3300005355 | Bacteria | 7948 |
| 89 | Ga0070671_100025386 | 3300005355 | Bacteria | 4862 |
| 90 | Ga0070671_100032256 | 3300005355 | Bacteria | 4332 |
| 91 | Ga0070671_100050555 | 3300005355 | Bacteria | 3457 |
| 92 | Ga0070671_100087272 | 3300005355 | Bacteria | 2611 |
| 93 | Ga0070674_100004750 | 3300005356 | Bacteria | 7784 |
| 94 | Ga0070674_100005318 | 3300005356 | Bacteria | 7423 |
| 95 | Ga0070673_100011474 | 3300005364 | Bacteria | 6047 |
| 96 | Ga0070673_100061796 | 3300005364 | Bacteria | 2973 |
| 97 | Ga0070673_100086278 | 3300005364 | Bacteria | 2557 |
| 98 | Ga0070673_100118179 | 3300005364 | Bacteria | 2207 |
| 99 | Ga0070659_100011766 | 3300005366 | Bacteria | 6475 |
| 100 | Ga0070659_100076260 | 3300005366 | Bacteria | 2673 |
| 101 | Ga0070667_100003099 | 3300005367 | Bacteria | 14303 |
| 102 | Ga0070667_100016360 | 3300005367 | Bacteria | 6136 |
| 103 | Ga0070667_100022100 | 3300005367 | Bacteria | 5276 |
| 104 | Ga0070667_100116953 | 3300005367 | Bacteria | 2316 |
| 105 | Ga0070663_100027938 | 3300005455 | Bacteria | 3836 |
| 106 | Ga0070663_100032881 | 3300005455 | Bacteria | 3579 |
| 107 | Ga0070678_100001686 | 3300005456 | Bacteria | 11852 |
| 108 | Ga0070678_100002569 | 3300005456 | Bacteria | 9969 |
| 109 | Ga0070678_100015381 | 3300005456 | Bacteria | 4862 |
| 110 | Ga0070678_100025559 | 3300005456 | Bacteria | 3975 |
| 111 | Ga0070678_100051966 | 3300005456 | Bacteria | 2973 |
| 112 | Ga0070678_100088955 | 3300005456 | Bacteria | 2363 |
| 113 | Ga0070662_100004089 | 3300005457 | Bacteria | 9163 |
| 114 | Ga0070662_100010527 | 3300005457 | Bacteria | 6074 |
| 115 | Ga0070662_100012262 | 3300005457 | Bacteria | 5677 |
| 116 | Ga0070662_100021663 | 3300005457 | Bacteria | 4391 |
| 117 | Ga0070662_100025849 | 3300005457 | Bacteria | 4059 |
| 118 | Ga0068867_100000249 | 3300005459 | Bacteria | 35572 |
| 119 | Ga0068867_100005468 | 3300005459 | Bacteria | 8990 |
| 120 | Ga0068867_100006301 | 3300005459 | Bacteria | 8395 |
| 121 | Ga0068867_100013331 | 3300005459 | Bacteria | 5823 |
| 122 | Ga0068867_100079502 | 3300005459 | Bacteria | 2468 |
| 123 | Ga0070706_100014174 | 3300005467 | Bacteria | 7365 |
| 124 | Ga0070707_100032795 | 3300005468 | Bacteria | 4949 |
| 125 | Ga0070679_100017226 | 3300005530 | Bacteria | 6988 |
| 126 | Ga0070684_100062895 | 3300005535 | Bacteria | 3252 |
| 127 | Ga0070672_100028249 | 3300005543 | Bacteria | 4193 |
| 128 | Ga0070672_100040042 | 3300005543 | Bacteria | 3594 |
| 129 | Ga0068855_100014551 | 3300005563 | Bacteria | 9477 |
| 130 | Ga0068855_100030962 | 3300005563 | Bacteria | 6394 |
| 131 | Ga0068855_100104465 | 3300005563 | Bacteria | 3259 |
| 132 | Ga0068855_100256732 | 3300005563 | Bacteria | 1948 |
| 133 | Ga0070664_100008373 | 3300005564 | Bacteria | 8361 |
| 134 | Ga0070664_100129894 | 3300005564 | Bacteria | 2212 |
| 135 | Ga0068857_100022930 | 3300005577 | Bacteria | 5492 |
| 136 | Ga0068857_100025706 | 3300005577 | Bacteria | 5184 |
| 137 | Ga0068857_100157822 | 3300005577 | Bacteria | 2057 |
| 138 | Ga0068856_100002754 | 3300005614 | Bacteria | 18000 |
| 139 | Ga0068852_100026667 | 3300005616 | Bacteria | 4701 |
| 140 | Ga0068852_100039272 | 3300005616 | Bacteria | 3984 |
| 141 | Ga0068852_100071257 | 3300005616 | Bacteria | 3051 |
| 142 | Ga0068852_100185946 | 3300005616 | Bacteria | 1957 |
| 143 | Ga0068859_100010856 | 3300005617 | Bacteria | 9164 |
| 144 | Ga0068859_100053491 | 3300005617 | Bacteria | 4061 |
| 145 | Ga0068864_100006324 | 3300005618 | Bacteria | 9713 |
| 146 | Ga0068864_100015252 | 3300005618 | Bacteria | 6391 |
| 147 | Ga0068864_100043880 | 3300005618 | Bacteria | 3829 |
| 148 | Ga0068861_100002723 | 3300005719 | Bacteria | 11577 |
| 149 | Ga0068861_100106503 | 3300005719 | Bacteria | 2240 |
| 150 | Ga0068863_100057193 | 3300005841 | Bacteria | 3691 |
| 151 | Ga0068863_100149623 | 3300005841 | Bacteria | 2233 |
| 152 | Ga0068858_100002892 | 3300005842 | Bacteria | 17265 |
| 153 | Ga0068858_100003275 | 3300005842 | Bacteria | 16136 |
| 154 | Ga0068858_100026496 | 3300005842 | Bacteria | 5384 |
| 155 | Ga0068858_100040827 | 3300005842 | Bacteria | 4304 |
| 156 | Ga0068860_100000445 | 3300005843 | Bacteria | 52236 |
| 157 | Ga0068860_100003813 | 3300005843 | Bacteria | 15505 |
| 158 | Ga0068860_100082137 | 3300005843 | Bacteria | 3065 |
| 159 | Ga0068862_100175189 | 3300005844 | Bacteria | 1922 |
| 160 | Ga0075362_10001909 | 3300006177 | Bacteria | 6845 |
| 161 | Ga0075367_10025078 | 3300006178 | Bacteria | 3368 |
| 162 | Ga0075367_10076400 | 3300006178 | Bacteria | 2021 |
| 163 | Ga0075366_10003352 | 3300006195 | Bacteria | 8430 |
| 164 | Ga0075366_10004000 | 3300006195 | Bacteria | 7878 |
| 165 | Ga0075366_10012500 | 3300006195 | Bacteria | 4815 |
| 166 | Ga0075366_10047989 | 3300006195 | Bacteria | 2531 |
| 167 | Ga0075366_10063715 | 3300006195 | Bacteria | 2191 |
| 168 | Ga0097621_100015499 | 3300006237 | Bacteria | 5737 |
| 169 | Ga0075370_10000059 | 3300006353 | Bacteria | 32632 |
| 170 | Ga0075370_10000087 | 3300006353 | Bacteria | 28459 |
| 171 | Ga0075370_10002533 | 3300006353 | Bacteria | 8490 |
| 172 | Ga0075370_10002840 | 3300006353 | Bacteria | 8127 |
| 173 | Ga0075370_10009953 | 3300006353 | Bacteria | 4954 |
| 174 | Ga0075370_10070806 | 3300006353 | Bacteria | 1995 |
| 175 | Ga0068871_100015209 | 3300006358 | Bacteria | 5753 |
| 176 | Ga0068871_100077351 | 3300006358 | Bacteria | 2750 |
| 177 | Ga0075430_100025785 | 3300006846 | Bacteria | 5002 |
| 178 | Ga0075429_100001289 | 3300006880 | Bacteria | 20430 |
| 179 | Ga0068865_100002093 | 3300006881 | Bacteria | 11787 |
| 180 | Ga0097620_100010856 | 3300006931 | Bacteria | 9164 |
| 181 | Ga0097620_100053491 | 3300006931 | Bacteria | 4061 |
| 182 | Ga0099823_1000031 | 3300006944 | Bacteria | 69036 |
| 183 | Ga0079104_1000465 | 3300006946 | Bacteria | 45434 |
| 184 | Ga0105240_10008979 | 3300009093 | Bacteria | 14207 |
| 185 | Ga0105240_10040846 | 3300009093 | Bacteria | 5927 |
| 186 | Ga0105240_10042069 | 3300009093 | Bacteria | 5825 |
| 187 | Ga0105245_10010878 | 3300009098 | Bacteria | 7915 |
| 188 | Ga0105245_10028195 | 3300009098 | Bacteria | 4951 |
| 189 | Ga0105243_10002157 | 3300009148 | Bacteria | 16630 |
| 190 | Ga0105243_10020375 | 3300009148 | Bacteria | 5029 |
| 191 | Ga0105243_10061281 | 3300009148 | Bacteria | 3008 |
| 192 | Ga0105243_10116760 | 3300009148 | Bacteria | 2242 |
| 193 | Ga0105241_10055820 | 3300009174 | Bacteria | 3026 |
| 194 | Ga0105248_10001682 | 3300009177 | Bacteria | 24633 |
| 195 | Ga0105248_10040747 | 3300009177 | Bacteria | 5206 |
| 196 | Ga0105237_10000977 | 3300009545 | Bacteria | 38396 |
| 197 | Ga0105237_10045864 | 3300009545 | Bacteria | 4398 |
| 198 | Ga0105237_10054226 | 3300009545 | Bacteria | 4017 |
| 199 | Ga0105238_10001620 | 3300009551 | Bacteria | 22525 |
| 200 | Ga0105238_10058411 | 3300009551 | Bacteria | 3867 |
| 201 | Ga0105238_10058800 | 3300009551 | Bacteria | 3853 |
| 202 | Ga0105238_10080804 | 3300009551 | Bacteria | 3240 |
| 203 | Ga0105249_10019265 | 3300009553 | Bacteria | 6085 |
| 204 | Ga0105239_10001185 | 3300010375 | Bacteria | 35747 |
| 205 | Ga0105239_10010208 | 3300010375 | Bacteria | 10520 |
| 206 | Ga0105239_10068079 | 3300010375 | Bacteria | 3912 |
| 207 | Ga0157319_1000016 | 3300012497 | Bacteria | 127256 |
| 208 | Ga0157369_10017217 | 3300013105 | Bacteria | 8122 |
| 209 | Ga0157369_10141816 | 3300013105 | Bacteria | 2542 |
| 210 | Ga0157374_10010968 | 3300013296 | Bacteria | 7825 |
| 211 | Ga0157374_10089315 | 3300013296 | Bacteria | 2936 |
| 212 | Ga0157378_10083568 | 3300013297 | Bacteria | 2890 |
| 213 | Ga0163162_10035901 | 3300013306 | Bacteria | 4938 |
| 214 | Ga0163162_10040830 | 3300013306 | Bacteria | 4641 |
| 215 | Ga0157375_10062518 | 3300013308 | Bacteria | 3700 |
| 216 | Ga0157375_10094817 | 3300013308 | Bacteria | 3054 |
| 217 | Ga0157375_10099480 | 3300013308 | Bacteria | 2987 |
| 218 | Ga0157375_10180548 | 3300013308 | Bacteria | 2262 |
| 219 | Ga0163163_10001922 | 3300014325 | Bacteria | 17590 |
| 220 | Ga0163163_10030553 | 3300014325 | Bacteria | 5192 |
| 221 | Ga0157380_10029033 | 3300014326 | Bacteria | 4225 |
| 222 | Ga0157380_10030112 | 3300014326 | Bacteria | 4155 |
| 223 | Ga0157380_10069354 | 3300014326 | Bacteria | 2844 |
| 224 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 225 | Ga0157379_10010706 | 3300014968 | Bacteria | 7991 |
| 226 | Ga0157379_10018753 | 3300014968 | Bacteria | 6101 |
| 227 | Ga0157379_10028002 | 3300014968 | Bacteria | 5016 |
| 228 | Ga0157379_10171980 | 3300014968 | Bacteria | 1956 |
| 229 | Ga0157376_10003522 | 3300014969 | Bacteria | 10798 |
| 230 | Ga0157376_10080035 | 3300014969 | Bacteria | 2802 |
| 231 | Ga0163161_10027822 | 3300017792 | Bacteria | 4011 |
| 232 | Ga0163161_10030998 | 3300017792 | Bacteria | 3808 |
| 233 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 234 | Ga0213872_10000049 | 3300021361 | Bacteria | 109094 |
| 235 | Ga0213872_10000102 | 3300021361 | Bacteria | 79440 |
| 236 | Ga0213872_10000458 | 3300021361 | Bacteria | 33281 |
| 237 | Ga0213872_10006588 | 3300021361 | Bacteria | 5800 |
| 238 | Ga0213872_10006891 | 3300021361 | Bacteria | 5656 |
| 239 | Ga0213872_10019477 | 3300021361 | Bacteria | 3125 |
| 240 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 241 | Ga0209674_100088 | 3300025226 | Bacteria | 181554 |
| 242 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 243 | Ga0209563_100160 | 3300025230 | Bacteria | 58893 |
| 244 | Ga0207427_100296 | 3300025231 | Bacteria | 34920 |
| 245 | Ga0209258_100630 | 3300025242 | Bacteria | 27864 |
| 246 | Ga0209258_100869 | 3300025242 | Bacteria | 16009 |
| 247 | Ga0207425_1002035 | 3300025245 | Bacteria | 7527 |
| 248 | Ga0207425_1004948 | 3300025245 | Bacteria | 3890 |
| 249 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 250 | Ga0209646_1000214 | 3300025246 | Bacteria | 64093 |
| 251 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 252 | Ga0209026_1000059 | 3300025250 | Bacteria | 226652 |
| 253 | Ga0209677_100162 | 3300025253 | Bacteria | 58923 |
| 254 | Ga0209677_100226 | 3300025253 | Bacteria | 40136 |
| 255 | Ga0209148_1001657 | 3300025254 | Bacteria | 10062 |
| 256 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 257 | Ga0209759_1000365 | 3300025256 | Bacteria | 56836 |
| 258 | Ga0209759_1015495 | 3300025256 | Bacteria | 1965 |
| 259 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 260 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 261 | Ga0209455_1000508 | 3300025272 | Bacteria | 27836 |
| 262 | Ga0209673_1000045 | 3300025273 | Bacteria | 290531 |
| 263 | Ga0209673_1002426 | 3300025273 | Bacteria | 12963 |
| 264 | Ga0209673_1004091 | 3300025273 | Bacteria | 8034 |
| 265 | Ga0209673_1004494 | 3300025273 | Bacteria | 7434 |
| 266 | Ga0209673_1013525 | 3300025273 | Bacteria | 3213 |
| 267 | Ga0209130_1000056 | 3300025284 | Bacteria | 210851 |
| 268 | Ga0209130_1000413 | 3300025284 | Bacteria | 46570 |
| 269 | Ga0209675_1000185 | 3300025291 | Bacteria | 68701 |
| 270 | Ga0209675_1006741 | 3300025291 | Bacteria | 4545 |
| 271 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 272 | Ga0209025_1001312 | 3300025294 | Bacteria | 33868 |
| 273 | Ga0209025_1012002 | 3300025294 | Bacteria | 5617 |
| 274 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 275 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 276 | Ga0209564_1000962 | 3300025295 | Bacteria | 36603 |
| 277 | Ga0209564_1001085 | 3300025295 | Bacteria | 32520 |
| 278 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 279 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 280 | Ga0209758_1006478 | 3300025297 | Bacteria | 8385 |
| 281 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 282 | Ga0209050_1000303 | 3300025298 | Bacteria | 101498 |
| 283 | Ga0209050_1000532 | 3300025298 | Bacteria | 63063 |
| 284 | Ga0209050_1002916 | 3300025298 | Bacteria | 13427 |
| 285 | Ga0209050_1014289 | 3300025298 | Bacteria | 3433 |
| 286 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 287 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 288 | Ga0209256_1000579 | 3300025299 | Bacteria | 52079 |
| 289 | Ga0209256_1001555 | 3300025299 | Bacteria | 22789 |
| 290 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 291 | Ga0207426_1001465 | 3300025302 | Bacteria | 19462 |
| 292 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 293 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 294 | Ga0209051_1002125 | 3300025303 | Bacteria | 14777 |
| 295 | Ga0209051_1004657 | 3300025303 | Bacteria | 8357 |
| 296 | Ga0209051_1013338 | 3300025303 | Bacteria | 3918 |
| 297 | Ga0209051_1013557 | 3300025303 | Bacteria | 3872 |
| 298 | Ga0209051_1018089 | 3300025303 | Bacteria | 3129 |
| 299 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 300 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 301 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 302 | Ga0209257_1000984 | 3300025304 | Bacteria | 38671 |
| 303 | Ga0209257_1002626 | 3300025304 | Bacteria | 17340 |
| 304 | Ga0207697_10014052 | 3300025315 | Bacteria | 3333 |
| 305 | Ga0207682_10011915 | 3300025893 | Bacteria | 3396 |
| 306 | Ga0207682_10015574 | 3300025893 | Bacteria | 2960 |
| 307 | Ga0207682_10023242 | 3300025893 | Bacteria | 2447 |
| 308 | Ga0207645_10004810 | 3300025907 | Bacteria | 9928 |
| 309 | Ga0207645_10005113 | 3300025907 | Bacteria | 9597 |
| 310 | Ga0207645_10022159 | 3300025907 | Bacteria | 4135 |
| 311 | Ga0207645_10036572 | 3300025907 | Bacteria | 3152 |
| 312 | Ga0207643_10038616 | 3300025908 | Bacteria | 2682 |
| 313 | Ga0207705_10017825 | 3300025909 | Bacteria | 5078 |
| 314 | Ga0207684_10012635 | 3300025910 | Bacteria | 7333 |
| 315 | Ga0207695_10008251 | 3300025913 | Bacteria | 13072 |
| 316 | Ga0207695_10010519 | 3300025913 | Bacteria | 11315 |
| 317 | Ga0207695_10179493 | 3300025913 | Bacteria | 2038 |
| 318 | Ga0207671_10001232 | 3300025914 | Bacteria | 30245 |
| 319 | Ga0207671_10028129 | 3300025914 | Bacteria | 4202 |
| 320 | Ga0207660_10055979 | 3300025917 | Bacteria | 2820 |
| 321 | Ga0207662_10001761 | 3300025918 | Bacteria | 10629 |
| 322 | Ga0207657_10046733 | 3300025919 | Bacteria | 3790 |
| 323 | Ga0207657_10061183 | 3300025919 | Bacteria | 3230 |
| 324 | Ga0207652_10003603 | 3300025921 | Bacteria | 12761 |
| 325 | Ga0207681_10002612 | 3300025923 | Bacteria | 11407 |
| 326 | Ga0207681_10009154 | 3300025923 | Bacteria | 6048 |
| 327 | Ga0207694_10051529 | 3300025924 | Bacteria | 3190 |
| 328 | Ga0207650_10004499 | 3300025925 | Bacteria | 9532 |
| 329 | Ga0207650_10033157 | 3300025925 | Bacteria | 3738 |
| 330 | Ga0207650_10053437 | 3300025925 | Bacteria | 2994 |
| 331 | Ga0207650_10100198 | 3300025925 | Bacteria | 2228 |
| 332 | Ga0207659_10001039 | 3300025926 | Bacteria | 16428 |
| 333 | Ga0207659_10005363 | 3300025926 | Bacteria | 7768 |
| 334 | Ga0207659_10024204 | 3300025926 | Bacteria | 4065 |
| 335 | Ga0207687_10033819 | 3300025927 | Bacteria | 3469 |
| 336 | Ga0207687_10060589 | 3300025927 | Bacteria | 2670 |
| 337 | Ga0207644_10000702 | 3300025931 | Bacteria | 21239 |
| 338 | Ga0207644_10006395 | 3300025931 | Bacteria | 7674 |
| 339 | Ga0207644_10022140 | 3300025931 | Bacteria | 4339 |
| 340 | Ga0207644_10079634 | 3300025931 | Bacteria | 2417 |
| 341 | Ga0207690_10083420 | 3300025932 | Bacteria | 2237 |
| 342 | Ga0207706_10000785 | 3300025933 | Bacteria | 32843 |
| 343 | Ga0207706_10002472 | 3300025933 | Bacteria | 18012 |
| 344 | Ga0207706_10009798 | 3300025933 | Bacteria | 8792 |
| 345 | Ga0207706_10029242 | 3300025933 | Bacteria | 4920 |
| 346 | Ga0207706_10071324 | 3300025933 | Bacteria | 3055 |
| 347 | Ga0207706_10222100 | 3300025933 | Bacteria | 1654 |
| 348 | Ga0207709_10024323 | 3300025935 | Bacteria | 3457 |
| 349 | Ga0207709_10084103 | 3300025935 | Bacteria | 2059 |
| 350 | Ga0207709_10092757 | 3300025935 | Bacteria | 1978 |
| 351 | Ga0207669_10006049 | 3300025937 | Bacteria | 5493 |
| 352 | Ga0207691_10004143 | 3300025940 | Bacteria | 14086 |
| 353 | Ga0207691_10006274 | 3300025940 | Bacteria | 11477 |
| 354 | Ga0207691_10006813 | 3300025940 | Bacteria | 11017 |
| 355 | Ga0207691_10024653 | 3300025940 | Bacteria | 5657 |
| 356 | Ga0207691_10041479 | 3300025940 | Bacteria | 4249 |
| 357 | Ga0207691_10064009 | 3300025940 | Bacteria | 3333 |
| 358 | Ga0207691_10068356 | 3300025940 | Bacteria | 3209 |
| 359 | Ga0207711_10003489 | 3300025941 | Bacteria | 13609 |
| 360 | Ga0207711_10081286 | 3300025941 | Bacteria | 2832 |
| 361 | Ga0207689_10003145 | 3300025942 | Bacteria | 15148 |
| 362 | Ga0207689_10004853 | 3300025942 | Bacteria | 12116 |
| 363 | Ga0207689_10128618 | 3300025942 | Bacteria | 2084 |
| 364 | Ga0207661_10130877 | 3300025944 | Bacteria | 2149 |
| 365 | Ga0207679_10002740 | 3300025945 | Bacteria | 10903 |
| 366 | Ga0207679_10030714 | 3300025945 | Bacteria | 3754 |
| 367 | Ga0207667_10166025 | 3300025949 | Bacteria | 2270 |
| 368 | Ga0207667_10177118 | 3300025949 | Bacteria | 2190 |
| 369 | Ga0207651_10012637 | 3300025960 | Bacteria | 4789 |
| 370 | Ga0207651_10021615 | 3300025960 | Bacteria | 3914 |
| 371 | Ga0207651_10052469 | 3300025960 | Bacteria | 2780 |
| 372 | Ga0207651_10109749 | 3300025960 | Bacteria | 2068 |
| 373 | Ga0207640_10046654 | 3300025981 | Bacteria | 2790 |
| 374 | Ga0207658_10034070 | 3300025986 | Bacteria | 3636 |
| 375 | Ga0207658_10044096 | 3300025986 | Bacteria | 3246 |
| 376 | Ga0207677_10012167 | 3300026023 | Bacteria | 4935 |
| 377 | Ga0207677_10043255 | 3300026023 | Bacteria | 2993 |
| 378 | Ga0207703_10001799 | 3300026035 | Bacteria | 19132 |
| 379 | Ga0207703_10102282 | 3300026035 | Bacteria | 2431 |
| 380 | Ga0207678_10022471 | 3300026067 | Bacteria | 5523 |
| 381 | Ga0207678_10084638 | 3300026067 | Bacteria | 2712 |
| 382 | Ga0207678_10133698 | 3300026067 | Bacteria | 2116 |
| 383 | Ga0207702_10001439 | 3300026078 | Bacteria | 23650 |
| 384 | Ga0207702_10037385 | 3300026078 | Bacteria | 4063 |
| 385 | Ga0207641_10028570 | 3300026088 | Bacteria | 4608 |
| 386 | Ga0207641_10035620 | 3300026088 | Bacteria | 4148 |
| 387 | Ga0207641_10082305 | 3300026088 | Bacteria | 2796 |
| 388 | Ga0207648_10000515 | 3300026089 | Bacteria | 43207 |
| 389 | Ga0207648_10003372 | 3300026089 | Bacteria | 16778 |
| 390 | Ga0207648_10004667 | 3300026089 | Bacteria | 14019 |
| 391 | Ga0207648_10030637 | 3300026089 | Bacteria | 4761 |
| 392 | Ga0207648_10071567 | 3300026089 | Bacteria | 3022 |
| 393 | Ga0207648_10084706 | 3300026089 | Bacteria | 2765 |
| 394 | Ga0207676_10003245 | 3300026095 | Bacteria | 11579 |
| 395 | Ga0207676_10005019 | 3300026095 | Bacteria | 9371 |
| 396 | Ga0207676_10043889 | 3300026095 | Bacteria | 3445 |
| 397 | Ga0207674_10006659 | 3300026116 | Bacteria | 13573 |
| 398 | Ga0207674_10022384 | 3300026116 | Bacteria | 6786 |
| 399 | Ga0207674_10057428 | 3300026116 | Bacteria | 3945 |
| 400 | Ga0207674_10157952 | 3300026116 | Bacteria | 2222 |
| 401 | Ga0207675_100004517 | 3300026118 | Bacteria | 13434 |
| 402 | Ga0207675_100007314 | 3300026118 | Bacteria | 10439 |
| 403 | Ga0207683_10006504 | 3300026121 | Bacteria | 10000 |
| 404 | Ga0207683_10007125 | 3300026121 | Bacteria | 9584 |
| 405 | Ga0207683_10008076 | 3300026121 | Bacteria | 9000 |
| 406 | Ga0207683_10044995 | 3300026121 | Bacteria | 3859 |
| 407 | Ga0207683_10055274 | 3300026121 | Bacteria | 3481 |
| 408 | Ga0207683_10061343 | 3300026121 | Bacteria | 3309 |
| 409 | Ga0207683_10122767 | 3300026121 | Bacteria | 2333 |
| 410 | Ga0207698_10033832 | 3300026142 | Bacteria | 3718 |
| 411 | Ga0207698_10073978 | 3300026142 | Bacteria | 2715 |
| 412 | Ga0209281_1000195 | 3300027111 | Bacteria | 139144 |
| 413 | Ga0209389_1042605 | 3300027296 | Bacteria | 3430 |
| 414 | Ga0209968_1000109 | 3300027526 | Bacteria | 15068 |
| 415 | Ga0209966_1000074 | 3300027695 | Bacteria | 43833 |
| 416 | Ga0268265_10009273 | 3300028380 | Bacteria | 6652 |
| 417 | Ga0268264_10012070 | 3300028381 | Bacteria | 7113 |
| 418 | Ga0265336_10000325 | 3300028666 | Bacteria | 31959 |
| 419 | Ga0307517_10002354 | 3300028786 | Bacteria | 30505 |
| 420 | Ga0307517_10077719 | 3300028786 | Bacteria | 2880 |
| 421 | Ga0307515_10000090 | 3300028794 | Bacteria | 215043 |
| 422 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 423 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 424 | Ga0307515_10000889 | 3300028794 | Bacteria | 68865 |
| 425 | Ga0307515_10012418 | 3300028794 | Bacteria | 16020 |
| 426 | Ga0307515_10020693 | 3300028794 | Bacteria | 11719 |
| 427 | Ga0307515_10049679 | 3300028794 | Bacteria | 6301 |
| 428 | Ga0307515_10080551 | 3300028794 | Bacteria | 4244 |
| 429 | Ga0307515_10097244 | 3300028794 | Bacteria | 3600 |
| 430 | Ga0265324_10004959 | 3300029957 | Bacteria | 5852 |
| 431 | Ga0307512_10056274 | 3300030522 | Bacteria | 3091 |
| 432 | Ga0307512_10083573 | 3300030522 | Bacteria | 2275 |
| 433 | Ga0265332_10000033 | 3300031238 | Bacteria | 153334 |
| 434 | Ga0265328_10007975 | 3300031239 | Bacteria | 4391 |
| 435 | Ga0265331_10024328 | 3300031250 | Bacteria | 3064 |
| 436 | Ga0265327_10000328 | 3300031251 | Bacteria | 90489 |
| 437 | Ga0265327_10001872 | 3300031251 | Bacteria | 24338 |
| 438 | Ga0265316_10000456 | 3300031344 | Bacteria | 46381 |
| 439 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 440 | Ga0307513_10000120 | 3300031456 | Bacteria | 110390 |
| 441 | Ga0307513_10004164 | 3300031456 | Bacteria | 19364 |
| 442 | Ga0307513_10021976 | 3300031456 | Bacteria | 7515 |
| 443 | Ga0307513_10137925 | 3300031456 | Bacteria | 2371 |
| 444 | Ga0307509_10000234 | 3300031507 | Bacteria | 89398 |
| 445 | Ga0307509_10038679 | 3300031507 | Bacteria | 5203 |
| 446 | Ga0307509_10039607 | 3300031507 | Bacteria | 5132 |
| 447 | Ga0307509_10090207 | 3300031507 | Bacteria | 3141 |
| 448 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 449 | Ga0307408_100006428 | 3300031548 | Bacteria | 7793 |
| 450 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 451 | Ga0307514_10001372 | 3300031649 | Bacteria | 30729 |
| 452 | Ga0307514_10033870 | 3300031649 | Bacteria | 4073 |
| 453 | Ga0307514_10052858 | 3300031649 | Bacteria | 3137 |
| 454 | Ga0307516_10000678 | 3300031730 | Bacteria | 46164 |
| 455 | Ga0307516_10003314 | 3300031730 | Bacteria | 20839 |
| 456 | Ga0307516_10003708 | 3300031730 | Bacteria | 19431 |
| 457 | Ga0307516_10004597 | 3300031730 | Bacteria | 16937 |
| 458 | Ga0307516_10007334 | 3300031730 | Bacteria | 12692 |
| 459 | Ga0307410_10040033 | 3300031852 | Bacteria | 3082 |
| 460 | Ga0307410_10045174 | 3300031852 | Bacteria | 2931 |
| 461 | Ga0307406_10039791 | 3300031901 | Bacteria | 2919 |
| 462 | Ga0307407_10033554 | 3300031903 | Bacteria | 2802 |
| 463 | Ga0307407_10036927 | 3300031903 | Bacteria | 2696 |
| 464 | Ga0307409_100015946 | 3300031995 | Bacteria | 4952 |
| 465 | Ga0307409_100050912 | 3300031995 | Bacteria | 3166 |
| 466 | Ga0307416_100000708 | 3300032002 | Bacteria | 17322 |
| 467 | Ga0307411_10000283 | 3300032005 | Bacteria | 16905 |
| 468 | Ga0307507_10149169 | 3300033179 | Bacteria | 1766 |
| 469 | Ga0307510_10012165 | 3300033180 | Bacteria | 10203 |
| 470 | Ga0307510_10033672 | 3300033180 | Bacteria | 5750 |
| 471 | Ga0373948_0001072 | 3300034817 | Bacteria | 3698 |
| 472 | Ga0373950_0003524 | 3300034818 | Bacteria | 2241 |
| 473 | Ga0373939_0000052 | 3300035114 | Bacteria | 40835 |
| 474 | Ga0373960_0000046 | 3300035121 | Bacteria | 16294 |
| 475 | Ga0373943_0008194 | 3300035170 | Bacteria | 4690 |
| 476 | Ga0373931_0001666 | 3300035691 | Bacteria | 9620 |
| 477 | Ga0373931_0017131 | 3300035691 | Bacteria | 3577 |
| 478 | Ga0373937_0049472 | 3300036401 | Bacteria | 3849 |
| 479 | Ga0373937_0122137 | 3300036401 | Bacteria | 2428 |
| 480 | Ga0373925_0054284 | 3300037068 | Bacteria | 2997 |
| 481 | Ga0373925_0139896 | 3300037068 | Bacteria | 1894 |
| 482 | Ga0395905_0000140 | 3300037471 | Bacteria | 120221 |
| 483 | Ga0395905_0003324 | 3300037471 | Bacteria | 17264 |
| 484 | Ga0395905_0027913 | 3300037471 | Bacteria | 5321 |
| 485 | Ga0395905_0145432 | 3300037471 | Bacteria | 2230 |
| 486 | Ga0395901_0084843 | 3300038443 | Bacteria | 3310 |
| 487 | Ga0436361_0082864 | 3300039447 | Bacteria | 107951 |
| 488 | Ga0436361_0215868 | 3300039447 | Bacteria | 46672 |
| 489 | Ga0436361_0388468 | 3300039447 | Bacteria | 28849 |
| 490 | Ga0436361_0420292 | 3300039447 | Bacteria | 49111 |
| 491 | Ga0436361_0614815 | 3300039447 | Bacteria | 45728 |
| 492 | Ga0436361_0675147 | 3300039447 | Bacteria | 1843 |
| 493 | Ga0436361_0948538 | 3300039447 | Bacteria | 4731 |
| 494 | Ga0436361_1028338 | 3300039447 | Bacteria | 2650 |
| 495 | Ga0439431_0002567 | 3300041997 | Bacteria | 4008 |
| 496 | Ga0450917_000500 | 3300042120 | Bacteria | 2939 |
| 497 | Ga0450920_002898 | 3300042122 | Bacteria | 2951 |
| 498 | Ga0450923_007216 | 3300042125 | Bacteria | 1870 |
| 499 | Ga0450918_001027 | 3300042531 | Bacteria | 5779 |
| 500 | Ga0451577_0001120 | 3300042876 | Bacteria | 38005 |
| 501 | Ga0451577_0004023 | 3300042876 | Bacteria | 15811 |
| 502 | Ga0451577_0023485 | 3300042876 | Bacteria | 5623 |
| 503 | Ga0451577_0043106 | 3300042876 | Bacteria | 4042 |
| 504 | Ga0451577_0103668 | 3300042876 | Bacteria | 2542 |
| 505 | Ga0466969_0000032 | 3300044656 | Bacteria | 84854 |
| 506 | Ga0466969_0012838 | 3300044656 | Bacteria | 4414 |
| 507 | Ga0466969_0018362 | 3300044656 | Bacteria | 3644 |
| 508 | Ga0466969_0068966 | 3300044656 | Bacteria | 1703 |
| 509 | Ga0466972_0001051 | 3300044658 | Bacteria | 13251 |
| 510 | Ga0453683_0002249 | 3300044673 | Bacteria | 15251 |
| 511 | Ga0453683_0009928 | 3300044673 | Bacteria | 6334 |
| 512 | Ga0466965_0019307 | 3300044683 | Bacteria | 3273 |
| 513 | Ga0466965_0022854 | 3300044683 | Bacteria | 3016 |
| 514 | Ga0466966_0003784 | 3300044684 | Bacteria | 9979 |
| 515 | Ga0466966_0004357 | 3300044684 | Bacteria | 9338 |
| 516 | Ga0466961_0001522 | 3300044693 | Bacteria | 14370 |
| 517 | Ga0466961_0015191 | 3300044693 | Bacteria | 4945 |
| 518 | Ga0466961_0026411 | 3300044693 | Bacteria | 3733 |
| 519 | Ga0466963_0000626 | 3300044694 | Bacteria | 16940 |
| 520 | Ga0466964_0006814 | 3300044706 | Bacteria | 4262 |
| 521 | Ga0466964_0010848 | 3300044706 | Bacteria | 3442 |
| 522 | Ga0466964_0019646 | 3300044706 | Bacteria | 2598 |
| 523 | Ga0453684_0034602 | 3300044712 | Bacteria | 7009 |
| 524 | Ga0453684_0043169 | 3300044712 | Bacteria | 6064 |
| 525 | Ga0453684_0043777 | 3300044712 | Bacteria | 6008 |
| 526 | Ga0466968_0061618 | 3300044735 | Bacteria | 1619 |
| 527 | Ga0466970_0031902 | 3300044765 | Bacteria | 2783 |
| 528 | Ga0466959_0002236 | 3300045049 | Bacteria | 12331 |
| 529 | Ga0466959_0012084 | 3300045049 | Bacteria | 6229 |
| 530 | Ga0466959_0030982 | 3300045049 | Bacteria | 3959 |
| 531 | Ga0466959_0064043 | 3300045049 | Bacteria | 2669 |
| 532 | Ga0451576_0001324 | 3300045051 | Bacteria | 42824 |
| 533 | Ga0451576_0004194 | 3300045051 | Bacteria | 18960 |
| 534 | Ga0451576_0006910 | 3300045051 | Bacteria | 13739 |
| 535 | Ga0451576_0012193 | 3300045051 | Bacteria | 9686 |
| 536 | Ga0451576_0244981 | 3300045051 | Bacteria | 1873 |
| 537 | Ga0466967_0043543 | 3300045976 | Bacteria | 3887 |
| 538 | Ga0495592_0000291 | 3300046454 | Bacteria | 42990 |
| 539 | Ga0495629_0102825 | 3300046459 | Bacteria | 1993 |
| 540 | Ga0495638_0061427 | 3300046460 | Bacteria | 2322 |
| 541 | Ga0495650_0002299 | 3300046471 | Bacteria | 15858 |
| 542 | Ga0495650_0005641 | 3300046471 | Bacteria | 8048 |
| 543 | Ga0495580_0027205 | 3300046472 | Bacteria | 4162 |
| 544 | Ga0495583_0000866 | 3300046506 | Bacteria | 36795 |
| 545 | Ga0495606_0005178 | 3300046507 | Bacteria | 12612 |
| 546 | Ga0495610_0032511 | 3300046512 | Bacteria | 2708 |
| 547 | Ga0495632_0002939 | 3300046519 | Bacteria | 12506 |
| 548 | Ga0495632_0006200 | 3300046519 | Bacteria | 7737 |
| 549 | Ga0495632_0017590 | 3300046519 | Bacteria | 3941 |
| 550 | Ga0495632_0026581 | 3300046519 | Bacteria | 3045 |
| 551 | Ga0495643_0051132 | 3300046522 | Bacteria | 2223 |
| 552 | Ga0495666_0021091 | 3300046526 | Bacteria | 3226 |
| 553 | Ga0495621_0000480 | 3300046539 | Bacteria | 9830 |
| 554 | Ga0495621_0015320 | 3300046539 | Bacteria | 2443 |
| 555 | Ga0495597_0002676 | 3300046542 | Bacteria | 11024 |
| 556 | Ga0495597_0003922 | 3300046542 | Bacteria | 8402 |
| 557 | Ga0495622_0025296 | 3300046557 | Bacteria | 2773 |
| 558 | Ga0495625_0010491 | 3300046660 | Bacteria | 7660 |
| 559 | Ga0495625_0066257 | 3300046660 | Bacteria | 2544 |
| 560 | Ga0495658_0004142 | 3300046683 | Bacteria | 7144 |
| 561 | Ga0495658_0004796 | 3300046683 | Bacteria | 6631 |
| 562 | Ga0495613_0086040 | 3300046689 | Bacteria | 2280 |
| 563 | Ga0495624_0056474 | 3300046690 | Bacteria | 2470 |
| 564 | Ga0495649_0004080 | 3300046694 | Bacteria | 9608 |
| 565 | Ga0495649_0007820 | 3300046694 | Bacteria | 6477 |
| 566 | Ga0495660_0028224 | 3300046810 | Bacteria | 3172 |
| 567 | Ga0495676_0061088 | 3300047321 | Bacteria | 2949 |
| 568 | Ga0495687_000367 | 3300047443 | Bacteria | 56387 |
| 569 | Ga0495686_0080608 | 3300047472 | Bacteria | 1989 |
| 570 | Ga0496102_0008877 | 3300048905 | Bacteria | 8627 |
| 571 | Ga0496102_0024537 | 3300048905 | Bacteria | 5362 |
| 572 | Ga0496104_0110012 | 3300048907 | Bacteria | 2641 |
| 573 | Ga0496106_0029413 | 3300048909 | Bacteria | 4094 |
| 574 | Ga0496107_0030805 | 3300048910 | Bacteria | 3825 |
| 575 | Ga0496108_0145926 | 3300048911 | Bacteria | 2040 |
| 576 | Ga0496109_0020125 | 3300048912 | Bacteria | 5895 |
| 577 | Ga0496110_0002606 | 3300048913 | Bacteria | 13565 |
| 578 | Ga0496110_0040140 | 3300048913 | Bacteria | 4079 |
| 579 | Ga0496112_0008913 | 3300048915 | Bacteria | 9004 |
| 580 | Ga0496112_0101626 | 3300048915 | Bacteria | 2845 |
| 581 | Ga0496113_0148710 | 3300048916 | Bacteria | 1847 |
| 582 | Ga0496114_0007954 | 3300048917 | Bacteria | 8390 |
| 583 | Ga0496114_0061805 | 3300048917 | Bacteria | 3134 |
| 584 | Ga0496124_0000786 | 3300048927 | Bacteria | 51804 |
| 585 | Ga0496125_0103222 | 3300048928 | Bacteria | 2093 |
| 586 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 587 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 588 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 589 | Ga0501267_000143 | 3300049764 | Bacteria | 4620 |
| 590 | Ga0501045_0000170 | 3300049824 | Bacteria | 35617 |
| 591 | nmdc:mga03683_17797_c1 | 3300050489 | Bacteria | 2694 |
| 592 | nmdc:mga00v17_10380_c1 | 3300050491 | Bacteria | 5082 |
| 593 | nmdc:mga0k408_11251_c1 | 3300050493 | Bacteria | 4865 |
| 594 | nmdc:mga0k408_2308_c1 | 3300050493 | Bacteria | 10151 |
| 595 | nmdc:mga0k408_27898_c1 | 3300050493 | Bacteria | 3209 |
| 596 | nmdc:mga0k408_28957_c1 | 3300050493 | Bacteria | 3151 |
| 597 | nmdc:mga0k408_355_c1 | 3300050493 | Bacteria | 25188 |
| 598 | nmdc:mga0k408_4782_c1 | 3300050493 | Bacteria | 7179 |
| 599 | nmdc:mga04h51_2722_c1 | 3300050495 | Bacteria | 4209 |
| 600 | nmdc:mga07m45_10918_c1 | 3300050496 | Bacteria | 4758 |
| 601 | nmdc:mga07m45_2223_c1 | 3300050496 | Bacteria | 9067 |
| 602 | nmdc:mga07m45_2314_c1 | 3300050496 | Bacteria | 8922 |
| 603 | nmdc:mga07m45_27823_c1 | 3300050496 | Bacteria | 3118 |
| 604 | nmdc:mga07m45_6961_c1 | 3300050496 | Bacteria | 5751 |
| 605 | nmdc:mga07m45_7357_c1 | 3300050496 | Bacteria | 5622 |
| 606 | nmdc:mga07m45_875_c1 | 3300050496 | Bacteria | 13121 |
| 607 | nmdc:mga09592_4802_c1 | 3300050508 | Bacteria | 10952 |
| 608 | Ga0500635_0000055 | 3300053080 | Bacteria | 74107 |
| 609 | Ga0495619_0041711 | 3300053085 | Bacteria | 3003 |
| 610 | Ga0500578_0000213 | 3300053086 | Bacteria | 71211 |
| 611 | Ga0500646_0000779 | 3300053090 | Bacteria | 8971 |
| 612 | Ga0500651_0005106 | 3300053093 | Bacteria | 7465 |
| 613 | Ga0500651_0048860 | 3300053093 | Bacteria | 2658 |
| 614 | Ga0500569_010492 | 3300053109 | Bacteria | 2185 |
| 615 | Ga0500593_000309 | 3300053117 | Bacteria | 19752 |
| 616 | Ga0500593_000591 | 3300053117 | Bacteria | 13928 |
| 617 | Ga0500594_0000924 | 3300053118 | Bacteria | 6308 |
| 618 | Ga0500628_006632 | 3300053129 | Bacteria | 1963 |
| 619 | Ga0500652_001388 | 3300053131 | Bacteria | 7550 |
| 620 | Ga0500652_053066 | 3300053131 | Bacteria | 1658 |
| 621 | Ga0500658_0002097 | 3300053134 | Bacteria | 7754 |
| 622 | Ga0500559_0002828 | 3300053136 | Bacteria | 8765 |
| 623 | Ga0500559_0020641 | 3300053136 | Bacteria | 2786 |
| 624 | Ga0500568_0005734 | 3300053139 | Bacteria | 6362 |
| 625 | Ga0500604_0005981 | 3300053151 | Bacteria | 3212 |
| 626 | Ga0500619_000067 | 3300053154 | Bacteria | 31547 |
| 627 | Ga0500622_0000631 | 3300053156 | Bacteria | 31645 |
| 628 | Ga0500622_0001490 | 3300053156 | Bacteria | 18621 |
| 629 | Ga0500645_000436 | 3300053730 | Bacteria | 28554 |
| 630 | Ga0500645_002698 | 3300053730 | Bacteria | 7711 |
| 631 | Ga0500645_003651 | 3300053730 | Bacteria | 6154 |
| 632 | Ga0500587_000100 | 3300053739 | Bacteria | 7588 |
| 633 | Ga0500587_002115 | 3300053739 | Bacteria | 2836 |
| 634 | Ga0590071_001924 | 3300059421 | Bacteria | 5316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10133698 | Ga0207678_101336982 | 402 |
| 2 | 3300025907 | Ga0207645_10036572 | Ga0207645_100365723 | 406 |
| 3 | 3300044735 | Ga0466968_0061618 | Ga0466968_0061618_262_1602 | 437 |
| 4 | 3300031548 | Ga0307408_100000008 | Ga0307408_10000000849 | 445 |
| 5 | 3300003322 | rootL2_10029717 | rootL2_100297178 | 447 |
| 6 | 3300031250 | Ga0265331_10024328 | Ga0265331_100243283 | 459 |
| 7 | 3300031251 | Ga0265327_10000328 | Ga0265327_1000032846 | 459 |
| 8 | 3300046471 | Ga0495650_0002299 | Ga0495650_0002299_9643_11145 | 459 |
| 9 | 3300025907 | Ga0207645_10022159 | Ga0207645_100221593 | 464 |
| 10 | 3300044712 | Ga0453684_0034602 | Ga0453684_0034602_3033_4562 | 466 |
| 11 | 3300025925 | Ga0207650_10100198 | Ga0207650_101001982 | 468 |
| 12 | 3300025940 | Ga0207691_10068356 | Ga0207691_100683563 | 468 |
| 13 | 3300021361 | Ga0213872_10000458 | Ga0213872_1000045821 | 470 |
| 14 | 3300039447 | Ga0436361_0420292 | Ga0436361_0420292_25475_27043 | 470 |
| 15 | 3300005457 | Ga0070662_100025849 | Ga0070662_1000258493 | 474 |
| 16 | 3300025933 | Ga0207706_10000785 | Ga0207706_1000078520 | 474 |
| 17 | 3300042876 | Ga0451577_0103668 | Ga0451577_0103668_687_2189 | 474 |
| 18 | 3300046472 | Ga0495580_0027205 | Ga0495580_0027205_77_1537 | 474 |
| 19 | 3300003752 | Ga0055539_1001240 | Ga0055539_10012406 | 475 |
| 20 | 3300003756 | Ga0055533_1000172 | Ga0055533_100017253 | 475 |
| 21 | 3300005355 | Ga0070671_100025386 | Ga0070671_1000253863 | 475 |
| 22 | 3300005456 | Ga0070678_100015381 | Ga0070678_1000153814 | 475 |
| 23 | 3300005563 | Ga0068855_100030962 | Ga0068855_1000309626 | 475 |
| 24 | 3300005719 | Ga0068861_100106503 | Ga0068861_1001065031 | 475 |
| 25 | 3300006195 | Ga0075366_10063715 | Ga0075366_100637152 | 475 |
| 26 | 3300006353 | Ga0075370_10009953 | Ga0075370_100099535 | 475 |
| 27 | 3300013308 | Ga0157375_10099480 | Ga0157375_100994802 | 475 |
| 28 | 3300025226 | Ga0209674_100088 | Ga0209674_1000881 | 475 |
| 29 | 3300025230 | Ga0209563_100160 | Ga0209563_1001601 | 475 |
| 30 | 3300025231 | Ga0207427_100296 | Ga0207427_1002961 | 475 |
| 31 | 3300025253 | Ga0209677_100162 | Ga0209677_1001621 | 475 |
| 32 | 3300025893 | Ga0207682_10015574 | Ga0207682_100155743 | 475 |
| 33 | 3300025913 | Ga0207695_10010519 | Ga0207695_1001051910 | 475 |
| 34 | 3300025913 | Ga0207695_10179493 | Ga0207695_101794931 | 475 |
| 35 | 3300025914 | Ga0207671_10001232 | Ga0207671_1000123211 | 475 |
| 36 | 3300025949 | Ga0207667_10177118 | Ga0207667_101771182 | 475 |
| 37 | 3300026121 | Ga0207683_10055274 | Ga0207683_100552742 | 475 |
| 38 | 3300028666 | Ga0265336_10000325 | Ga0265336_1000032528 | 475 |
| 39 | 3300029957 | Ga0265324_10004959 | Ga0265324_100049591 | 475 |
| 40 | 3300031730 | Ga0307516_10003708 | Ga0307516_1000370822 | 475 |
| 41 | 3300039447 | Ga0436361_0614815 | Ga0436361_0614815_24209_25666 | 475 |
| 42 | 3300005339 | Ga0070660_100033296 | Ga0070660_1000332963 | 476 |
| 43 | 3300005364 | Ga0070673_100061796 | Ga0070673_1000617962 | 476 |
| 44 | 3300005459 | Ga0068867_100079502 | Ga0068867_1000795022 | 476 |
| 45 | 3300005535 | Ga0070684_100062895 | Ga0070684_1000628953 | 476 |
| 46 | 3300005577 | Ga0068857_100157822 | Ga0068857_1001578221 | 476 |
| 47 | 3300025919 | Ga0207657_10046733 | Ga0207657_100467334 | 476 |
| 48 | 3300025960 | Ga0207651_10012637 | Ga0207651_100126373 | 476 |
| 49 | 3300025960 | Ga0207651_10109749 | Ga0207651_101097491 | 476 |
| 50 | 3300026116 | Ga0207674_10057428 | Ga0207674_100574283 | 476 |
| 51 | 3300039447 | Ga0436361_0215868 | Ga0436361_0215868_37202_38740 | 476 |
| 52 | 3300046539 | Ga0495621_0000480 | Ga0495621_0000480_8047_9606 | 476 |
| 53 | 3300046539 | Ga0495621_0015320 | Ga0495621_0015320_872_2431 | 476 |
| 54 | 3300059421 | Ga0590071_001924 | Ga0590071_001924_3416_5035 | 476 |
| 55 | 3300046526 | Ga0495666_0021091 | Ga0495666_0021091_37_1497 | 477 |
| 56 | iso_pu_bacteria | 2643221646 | 2644258749 | 477 |
| 57 | iso_pu_bacteria | 2643221544 | 2643742846 | 478 |
| 58 | iso_pu_bacteria | 2643221585 | 2643933316 | 478 |
| 59 | iso_pu_bacteria | 2643221639 | 2644217520 | 478 |
| 60 | iso_pu_bacteria | 2643221656 | 2644314565 | 478 |
| 61 | iso_pu_bacteria | 2738541337 | 2739055506 | 478 |
| 62 | 3300048917 | Ga0496114_0007954 | Ga0496114_0007954_4860_6350 | 479 |
| 63 | 3300006353 | Ga0075370_10002840 | Ga0075370_100028407 | 480 |
| 64 | 3300009093 | Ga0105240_10008979 | Ga0105240_100089795 | 480 |
| 65 | 3300009545 | Ga0105237_10000977 | Ga0105237_1000097734 | 480 |
| 66 | 3300009551 | Ga0105238_10001620 | Ga0105238_100016208 | 480 |
| 67 | 3300010375 | Ga0105239_10001185 | Ga0105239_1000118526 | 480 |
| 68 | 3300034817 | Ga0373948_0001072 | Ga0373948_0001072_1748_3238 | 480 |
| 69 | 3300034818 | Ga0373950_0003524 | Ga0373950_0003524_419_1909 | 480 |
| 70 | 3300035114 | Ga0373939_0000052 | Ga0373939_0000052_30853_32343 | 480 |
| 71 | 3300035121 | Ga0373960_0000046 | Ga0373960_0000046_13481_14971 | 480 |
| 72 | 3300035691 | Ga0373931_0001666 | Ga0373931_0001666_5932_7422 | 480 |
| 73 | 3300037471 | Ga0395905_0003324 | Ga0395905_0003324_11519_13009 | 480 |
| 74 | 3300049764 | Ga0501267_000143 | Ga0501267_000143_1045_2535 | 480 |
| 75 | 3300050496 | nmdc:mga07m45_875_c1 | nmdc:mga07m45_875_c1_7118_8608 | 480 |
| 76 | 3300003794 | Ga0055531_10000168 | Ga0055531_1000016861 | 481 |
| 77 | 3300006195 | Ga0075366_10003352 | Ga0075366_100033525 | 481 |
| 78 | 3300006195 | Ga0075366_10004000 | Ga0075366_100040006 | 481 |
| 79 | 3300021361 | Ga0213872_10019477 | Ga0213872_100194773 | 481 |
| 80 | 3300025298 | Ga0209050_1014289 | Ga0209050_10142893 | 481 |
| 81 | 3300025303 | Ga0209051_1013338 | Ga0209051_10133383 | 481 |
| 82 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021290 | 481 |
| 83 | 3300028794 | Ga0307515_10097244 | Ga0307515_100972443 | 481 |
| 84 | 3300039447 | Ga0436361_0948538 | Ga0436361_0948538_1054_2613 | 481 |
| 85 | 3300039447 | Ga0436361_1028338 | Ga0436361_1028338_725_2293 | 481 |
| 86 | 3300042120 | Ga0450917_000500 | Ga0450917_000500_668_2161 | 481 |
| 87 | 3300044712 | Ga0453684_0043169 | Ga0453684_0043169_4319_5842 | 481 |
| 88 | 3300050493 | nmdc:mga0k408_355_c1 | nmdc:mga0k408_355_c1_4933_6459 | 481 |
| 89 | 3300053086 | Ga0500578_0000213 | Ga0500578_0000213_30752_32263 | 481 |
| 90 | 3300003322 | rootL2_10150743 | rootL2_101507432 | 482 |
| 91 | 3300005455 | Ga0070663_100032881 | Ga0070663_1000328814 | 482 |
| 92 | 3300009148 | Ga0105243_10002157 | Ga0105243_100021579 | 482 |
| 93 | 3300014745 | Ga0157377_10000016 | Ga0157377_10000016176 | 482 |
| 94 | 3300014968 | Ga0157379_10028002 | Ga0157379_100280023 | 482 |
| 95 | 3300021361 | Ga0213872_10000006 | Ga0213872_10000006196 | 482 |
| 96 | 3300021361 | Ga0213872_10000102 | Ga0213872_1000010255 | 482 |
| 97 | 3300025926 | Ga0207659_10005363 | Ga0207659_100053633 | 482 |
| 98 | 3300026067 | Ga0207678_10084638 | Ga0207678_100846382 | 482 |
| 99 | 3300030522 | Ga0307512_10083573 | Ga0307512_100835732 | 482 |
| 100 | 3300031507 | Ga0307509_10000234 | Ga0307509_1000023435 | 482 |
| 101 | 3300033180 | Ga0307510_10012165 | Ga0307510_100121656 | 482 |
| 102 | 3300044712 | Ga0453684_0043777 | Ga0453684_0043777_3718_5217 | 482 |
| 103 | 3300046519 | Ga0495632_0026581 | Ga0495632_0026581_1082_2581 | 482 |
| 104 | 3300049579 | Ga0501043_0000149 | Ga0501043_0000149_55426_56973 | 482 |
| 105 | 3300049580 | Ga0501046_0000092 | Ga0501046_0000092_8286_9833 | 482 |
| 106 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_163481_165028 | 482 |
| 107 | 3300049824 | Ga0501045_0000170 | Ga0501045_0000170_12657_14204 | 482 |
| 108 | 3300053156 | Ga0500622_0001490 | Ga0500622_0001490_12401_13894 | 482 |
| 109 | iso_pu_bacteria | 2643221654 | 2644303979 | 482 |
| 110 | 3300003215 | JGI25153J46596_10004040 | JGI25153J46596_100040402 | 483 |
| 111 | 3300003759 | Ga0055525_1000031 | Ga0055525_1000031243 | 483 |
| 112 | 3300003775 | Ga0055524_1000125 | Ga0055524_100012515 | 483 |
| 113 | 3300003791 | Ga0055530_10000470 | Ga0055530_100004702 | 483 |
| 114 | 3300003792 | Ga0055540_1000011 | Ga0055540_100001165 | 483 |
| 115 | 3300005262 | Ga0065165_1000967 | Ga0065165_100096725 | 483 |
| 116 | 3300005328 | Ga0070676_10006846 | Ga0070676_100068465 | 483 |
| 117 | 3300005338 | Ga0068868_100009443 | Ga0068868_1000094434 | 483 |
| 118 | 3300005353 | Ga0070669_100042130 | Ga0070669_1000421303 | 483 |
| 119 | 3300005355 | Ga0070671_100032256 | Ga0070671_1000322563 | 483 |
| 120 | 3300005356 | Ga0070674_100005318 | Ga0070674_1000053183 | 483 |
| 121 | 3300005459 | Ga0068867_100000249 | Ga0068867_10000024919 | 483 |
| 122 | 3300006195 | Ga0075366_10012500 | Ga0075366_100125004 | 483 |
| 123 | 3300006353 | Ga0075370_10002533 | Ga0075370_100025333 | 483 |
| 124 | 3300006353 | Ga0075370_10070806 | Ga0075370_100708061 | 483 |
| 125 | 3300006946 | Ga0079104_1000465 | Ga0079104_100046510 | 483 |
| 126 | 3300009098 | Ga0105245_10028195 | Ga0105245_100281953 | 483 |
| 127 | 3300014968 | Ga0157379_10171980 | Ga0157379_101719802 | 483 |
| 128 | 3300025291 | Ga0209675_1006741 | Ga0209675_10067412 | 483 |
| 129 | 3300025298 | Ga0209050_1000303 | Ga0209050_100030393 | 483 |
| 130 | 3300025298 | Ga0209050_1000532 | Ga0209050_100053212 | 483 |
| 131 | 3300025298 | Ga0209050_1002916 | Ga0209050_10029164 | 483 |
| 132 | 3300025299 | Ga0209256_1000113 | Ga0209256_100011383 | 483 |
| 133 | 3300025303 | Ga0209051_1000020 | Ga0209051_100002064 | 483 |
| 134 | 3300025303 | Ga0209051_1013557 | Ga0209051_10135572 | 483 |
| 135 | 3300025304 | Ga0209257_1000085 | Ga0209257_100008564 | 483 |
| 136 | 3300025935 | Ga0207709_10024323 | Ga0207709_100243232 | 483 |
| 137 | 3300026089 | Ga0207648_10000515 | Ga0207648_1000051539 | 483 |
| 138 | 3300027111 | Ga0209281_1000195 | Ga0209281_100019539 | 483 |
| 139 | 3300028786 | Ga0307517_10002354 | Ga0307517_1000235412 | 483 |
| 140 | 3300028786 | Ga0307517_10077719 | Ga0307517_100777192 | 483 |
| 141 | 3300028794 | Ga0307515_10080551 | Ga0307515_100805512 | 483 |
| 142 | 3300031456 | Ga0307513_10137925 | Ga0307513_101379252 | 483 |
| 143 | 3300031507 | Ga0307509_10038679 | Ga0307509_100386792 | 483 |
| 144 | 3300031507 | Ga0307509_10039607 | Ga0307509_100396073 | 483 |
| 145 | 3300031649 | Ga0307514_10033870 | Ga0307514_100338705 | 483 |
| 146 | 3300031649 | Ga0307514_10052858 | Ga0307514_100528583 | 483 |
| 147 | 3300031852 | Ga0307410_10045174 | Ga0307410_100451742 | 483 |
| 148 | 3300031903 | Ga0307407_10033554 | Ga0307407_100335543 | 483 |
| 149 | 3300031995 | Ga0307409_100015946 | Ga0307409_1000159463 | 483 |
| 150 | 3300032005 | Ga0307411_10000283 | Ga0307411_1000028310 | 483 |
| 151 | 3300033180 | Ga0307510_10033672 | Ga0307510_100336724 | 483 |
| 152 | 3300044683 | Ga0466965_0019307 | Ga0466965_0019307_501_2003 | 483 |
| 153 | 3300046454 | Ga0495592_0000291 | Ga0495592_0000291_31076_32608 | 483 |
| 154 | 3300046460 | Ga0495638_0061427 | Ga0495638_0061427_49_1551 | 483 |
| 155 | 3300046519 | Ga0495632_0002939 | Ga0495632_0002939_9505_11007 | 483 |
| 156 | 3300046557 | Ga0495622_0025296 | Ga0495622_0025296_528_2060 | 483 |
| 157 | 3300046683 | Ga0495658_0004796 | Ga0495658_0004796_3104_4636 | 483 |
| 158 | 3300046690 | Ga0495624_0056474 | Ga0495624_0056474_825_2357 | 483 |
| 159 | 3300047321 | Ga0495676_0061088 | Ga0495676_0061088_1266_2798 | 483 |
| 160 | 3300048928 | Ga0496125_0103222 | Ga0496125_0103222_125_1657 | 483 |
| 161 | 3300050489 | nmdc:mga03683_17797_c1 | nmdc:mga03683_17797_c1_511_2013 | 483 |
| 162 | 3300050493 | nmdc:mga0k408_4782_c1 | nmdc:mga0k408_4782_c1_3673_5175 | 483 |
| 163 | 3300050496 | nmdc:mga07m45_27823_c1 | nmdc:mga07m45_27823_c1_660_2192 | 483 |
| 164 | 3300053090 | Ga0500646_0000779 | Ga0500646_0000779_3051_4553 | 483 |
| 165 | 3300053109 | Ga0500569_010492 | Ga0500569_010492_101_1603 | 483 |
| 166 | 3300053118 | Ga0500594_0000924 | Ga0500594_0000924_3386_4918 | 483 |
| 167 | 3300053131 | Ga0500652_001388 | Ga0500652_001388_335_1837 | 483 |
| 168 | 3300053131 | Ga0500652_053066 | Ga0500652_053066_95_1627 | 483 |
| 169 | 3300053136 | Ga0500559_0002828 | Ga0500559_0002828_660_2192 | 483 |
| 170 | 3300053151 | Ga0500604_0005981 | Ga0500604_0005981_315_1817 | 483 |
| 171 | 3300053156 | Ga0500622_0000631 | Ga0500622_0000631_5155_6657 | 483 |
| 172 | 3300053739 | Ga0500587_002115 | Ga0500587_002115_778_2310 | 483 |
| 173 | iso_pu_bacteria | 2585428057 | 2587724867 | 483 |
| 174 | iso_pu_bacteria | 2585428058 | 2587736726 | 483 |
| 175 | iso_pu_bacteria | 2588253510 | 2588295336 | 483 |
| 176 | iso_pu_bacteria | 2643221592 | 2643970208 | 483 |
| 177 | iso_pu_bacteria | 2643221625 | 2644142394 | 483 |
| 178 | iso_pu_bacteria | 2643221648 | 2644275140 | 483 |
| 179 | iso_pu_bacteria | 2831864461 | 2831865514 | 483 |
| 180 | 3300005367 | Ga0070667_100003099 | Ga0070667_1000030998 | 484 |
| 181 | 3300005563 | Ga0068855_100014551 | Ga0068855_1000145515 | 484 |
| 182 | 3300025986 | Ga0207658_10044096 | Ga0207658_100440963 | 484 |
| 183 | 3300028794 | Ga0307515_10000188 | Ga0307515_10000188105 | 484 |
| 184 | 3300033179 | Ga0307507_10149169 | Ga0307507_101491692 | 484 |
| 185 | 3300037471 | Ga0395905_0027913 | Ga0395905_0027913_3439_4941 | 484 |
| 186 | iso_pu_bacteria | 2585428062 | 2587755606 | 484 |
| 187 | 3300005328 | Ga0070676_10031112 | Ga0070676_100311123 | 485 |
| 188 | 3300005331 | Ga0070670_100016141 | Ga0070670_1000161413 | 485 |
| 189 | 3300005334 | Ga0068869_100009386 | Ga0068869_1000093865 | 485 |
| 190 | 3300005338 | Ga0068868_100035076 | Ga0068868_1000350763 | 485 |
| 191 | 3300005355 | Ga0070671_100050555 | Ga0070671_1000505552 | 485 |
| 192 | 3300005459 | Ga0068867_100013331 | Ga0068867_1000133315 | 485 |
| 193 | 3300009148 | Ga0105243_10020375 | Ga0105243_100203754 | 485 |
| 194 | 3300025927 | Ga0207687_10033819 | Ga0207687_100338193 | 485 |
| 195 | 3300027526 | Ga0209968_1000109 | Ga0209968_100010910 | 485 |
| 196 | 3300027695 | Ga0209966_1000074 | Ga0209966_10000744 | 485 |
| 197 | 3300028794 | Ga0307515_10000090 | Ga0307515_10000090140 | 485 |
| 198 | 3300028794 | Ga0307515_10000165 | Ga0307515_10000165107 | 485 |
| 199 | 3300028794 | Ga0307515_10000889 | Ga0307515_1000088961 | 485 |
| 200 | 3300028794 | Ga0307515_10049679 | Ga0307515_100496794 | 485 |
| 201 | 3300030522 | Ga0307512_10056274 | Ga0307512_100562743 | 485 |
| 202 | 3300031239 | Ga0265328_10007975 | Ga0265328_100079752 | 485 |
| 203 | 3300031251 | Ga0265327_10001872 | Ga0265327_1000187215 | 485 |
| 204 | 3300031456 | Ga0307513_10004164 | Ga0307513_100041643 | 485 |
| 205 | 3300031616 | Ga0307508_10000007 | Ga0307508_1000000723 | 485 |
| 206 | 3300037471 | Ga0395905_0000140 | Ga0395905_0000140_39031_40590 | 485 |
| 207 | 3300044656 | Ga0466969_0068966 | Ga0466969_0068966_157_1665 | 485 |
| 208 | 3300044684 | Ga0466966_0004357 | Ga0466966_0004357_7658_9166 | 485 |
| 209 | 3300044693 | Ga0466961_0001522 | Ga0466961_0001522_6034_7542 | 485 |
| 210 | 3300044694 | Ga0466963_0000626 | Ga0466963_0000626_4060_5568 | 485 |
| 211 | 3300044706 | Ga0466964_0006814 | Ga0466964_0006814_214_1722 | 485 |
| 212 | 3300045049 | Ga0466959_0002236 | Ga0466959_0002236_10785_12293 | 485 |
| 213 | 3300045051 | Ga0451576_0012193 | Ga0451576_0012193_6656_8164 | 485 |
| 214 | 3300045976 | Ga0466967_0043543 | Ga0466967_0043543_977_2485 | 485 |
| 215 | 3300048913 | Ga0496110_0040140 | Ga0496110_0040140_2420_3982 | 485 |
| 216 | 3300048916 | Ga0496113_0148710 | Ga0496113_0148710_47_1579 | 485 |
| 217 | 3300002705 | JGI25156J39149_1000220 | JGI25156J39149_10002202 | 486 |
| 218 | 3300002738 | JGI25154J39366_1003097 | JGI25154J39366_10030972 | 486 |
| 219 | 3300002741 | JGI25157J39369_1000135 | JGI25157J39369_100013556 | 486 |
| 220 | 3300003320 | rootH2_10107905 | rootH2_101079051 | 486 |
| 221 | 3300003323 | rootH1_10002882 | rootH1_100028822 | 486 |
| 222 | 3300003323 | rootH1_10044884 | rootH1_100448846 | 486 |
| 223 | 3300003752 | Ga0055539_1003715 | Ga0055539_10037152 | 486 |
| 224 | 3300003761 | Ga0055535_1000641 | Ga0055535_10006411 | 486 |
| 225 | 3300003763 | Ga0055529_1000602 | Ga0055529_100060227 | 486 |
| 226 | 3300005331 | Ga0070670_100002757 | Ga0070670_1000027576 | 486 |
| 227 | 3300005335 | Ga0070666_10001889 | Ga0070666_100018893 | 486 |
| 228 | 3300005338 | Ga0068868_100018937 | Ga0068868_1000189373 | 486 |
| 229 | 3300005344 | Ga0070661_100005430 | Ga0070661_1000054303 | 486 |
| 230 | 3300005347 | Ga0070668_100106439 | Ga0070668_1001064392 | 486 |
| 231 | 3300005354 | Ga0070675_100002630 | Ga0070675_1000026303 | 486 |
| 232 | 3300005354 | Ga0070675_100013570 | Ga0070675_1000135704 | 486 |
| 233 | 3300005355 | Ga0070671_100087272 | Ga0070671_1000872723 | 486 |
| 234 | 3300005364 | Ga0070673_100011474 | Ga0070673_1000114742 | 486 |
| 235 | 3300005366 | Ga0070659_100076260 | Ga0070659_1000762602 | 486 |
| 236 | 3300005367 | Ga0070667_100016360 | Ga0070667_1000163605 | 486 |
| 237 | 3300005456 | Ga0070678_100001686 | Ga0070678_1000016863 | 486 |
| 238 | 3300005456 | Ga0070678_100002569 | Ga0070678_1000025696 | 486 |
| 239 | 3300005456 | Ga0070678_100088955 | Ga0070678_1000889551 | 486 |
| 240 | 3300005543 | Ga0070672_100028249 | Ga0070672_1000282493 | 486 |
| 241 | 3300005563 | Ga0068855_100256732 | Ga0068855_1002567322 | 486 |
| 242 | 3300005564 | Ga0070664_100008373 | Ga0070664_1000083732 | 486 |
| 243 | 3300005564 | Ga0070664_100129894 | Ga0070664_1001298941 | 486 |
| 244 | 3300005616 | Ga0068852_100039272 | Ga0068852_1000392723 | 486 |
| 245 | 3300005616 | Ga0068852_100071257 | Ga0068852_1000712573 | 486 |
| 246 | 3300005617 | Ga0068859_100010856 | Ga0068859_1000108564 | 486 |
| 247 | 3300005618 | Ga0068864_100006324 | Ga0068864_1000063244 | 486 |
| 248 | 3300005618 | Ga0068864_100015252 | Ga0068864_1000152525 | 486 |
| 249 | 3300005842 | Ga0068858_100002892 | Ga0068858_1000028926 | 486 |
| 250 | 3300005843 | Ga0068860_100082137 | Ga0068860_1000821372 | 486 |
| 251 | 3300005844 | Ga0068862_100175189 | Ga0068862_1001751892 | 486 |
| 252 | 3300006237 | Ga0097621_100015499 | Ga0097621_1000154992 | 486 |
| 253 | 3300006358 | Ga0068871_100015209 | Ga0068871_1000152093 | 486 |
| 254 | 3300006931 | Ga0097620_100010856 | Ga0097620_1000108564 | 486 |
| 255 | 3300009093 | Ga0105240_10040846 | Ga0105240_100408461 | 486 |
| 256 | 3300009093 | Ga0105240_10042069 | Ga0105240_100420691 | 486 |
| 257 | 3300009174 | Ga0105241_10055820 | Ga0105241_100558203 | 486 |
| 258 | 3300009551 | Ga0105238_10080804 | Ga0105238_100808043 | 486 |
| 259 | 3300010375 | Ga0105239_10068079 | Ga0105239_100680792 | 486 |
| 260 | 3300013296 | Ga0157374_10089315 | Ga0157374_100893152 | 486 |
| 261 | 3300013297 | Ga0157378_10083568 | Ga0157378_100835683 | 486 |
| 262 | 3300013306 | Ga0163162_10035901 | Ga0163162_100359012 | 486 |
| 263 | 3300013308 | Ga0157375_10094817 | Ga0157375_100948172 | 486 |
| 264 | 3300013308 | Ga0157375_10180548 | Ga0157375_101805482 | 486 |
| 265 | 3300014325 | Ga0163163_10001922 | Ga0163163_1000192216 | 486 |
| 266 | 3300014326 | Ga0157380_10030112 | Ga0157380_100301123 | 486 |
| 267 | 3300014968 | Ga0157379_10018753 | Ga0157379_100187535 | 486 |
| 268 | 3300014969 | Ga0157376_10080035 | Ga0157376_100800353 | 486 |
| 269 | 3300021361 | Ga0213872_10006588 | Ga0213872_100065886 | 486 |
| 270 | 3300025230 | Ga0209563_100044 | Ga0209563_100044312 | 486 |
| 271 | 3300025242 | Ga0209258_100630 | Ga0209258_1006302 | 486 |
| 272 | 3300025242 | Ga0209258_100869 | Ga0209258_10086916 | 486 |
| 273 | 3300025246 | Ga0209646_1000214 | Ga0209646_10002142 | 486 |
| 274 | 3300025250 | Ga0209026_1000059 | Ga0209026_1000059203 | 486 |
| 275 | 3300025253 | Ga0209677_100226 | Ga0209677_10022635 | 486 |
| 276 | 3300025254 | Ga0209148_1001657 | Ga0209148_10016577 | 486 |
| 277 | 3300025256 | Ga0209759_1000365 | Ga0209759_10003652 | 486 |
| 278 | 3300025272 | Ga0209455_1000508 | Ga0209455_10005082 | 486 |
| 279 | 3300025908 | Ga0207643_10038616 | Ga0207643_100386162 | 486 |
| 280 | 3300025913 | Ga0207695_10008251 | Ga0207695_100082512 | 486 |
| 281 | 3300025914 | Ga0207671_10028129 | Ga0207671_100281292 | 486 |
| 282 | 3300025925 | Ga0207650_10004499 | Ga0207650_100044997 | 486 |
| 283 | 3300025926 | Ga0207659_10024204 | Ga0207659_100242043 | 486 |
| 284 | 3300025931 | Ga0207644_10079634 | Ga0207644_100796342 | 486 |
| 285 | 3300025932 | Ga0207690_10083420 | Ga0207690_100834202 | 486 |
| 286 | 3300025933 | Ga0207706_10071324 | Ga0207706_100713242 | 486 |
| 287 | 3300025933 | Ga0207706_10222100 | Ga0207706_102221001 | 486 |
| 288 | 3300025940 | Ga0207691_10006813 | Ga0207691_100068139 | 486 |
| 289 | 3300025940 | Ga0207691_10024653 | Ga0207691_100246534 | 486 |
| 290 | 3300025940 | Ga0207691_10064009 | Ga0207691_100640092 | 486 |
| 291 | 3300025944 | Ga0207661_10130877 | Ga0207661_101308772 | 486 |
| 292 | 3300025945 | Ga0207679_10002740 | Ga0207679_100027406 | 486 |
| 293 | 3300025960 | Ga0207651_10021615 | Ga0207651_100216153 | 486 |
| 294 | 3300025981 | Ga0207640_10046654 | Ga0207640_100466542 | 486 |
| 295 | 3300026023 | Ga0207677_10012167 | Ga0207677_100121673 | 486 |
| 296 | 3300026067 | Ga0207678_10022471 | Ga0207678_100224713 | 486 |
| 297 | 3300026078 | Ga0207702_10001439 | Ga0207702_1000143924 | 486 |
| 298 | 3300026088 | Ga0207641_10028570 | Ga0207641_100285703 | 486 |
| 299 | 3300026095 | Ga0207676_10003245 | Ga0207676_100032457 | 486 |
| 300 | 3300026095 | Ga0207676_10005019 | Ga0207676_100050198 | 486 |
| 301 | 3300026095 | Ga0207676_10043889 | Ga0207676_100438893 | 486 |
| 302 | 3300026116 | Ga0207674_10157952 | Ga0207674_101579522 | 486 |
| 303 | 3300026121 | Ga0207683_10006504 | Ga0207683_100065046 | 486 |
| 304 | 3300026121 | Ga0207683_10007125 | Ga0207683_100071252 | 486 |
| 305 | 3300026121 | Ga0207683_10044995 | Ga0207683_100449952 | 486 |
| 306 | 3300026121 | Ga0207683_10122767 | Ga0207683_101227672 | 486 |
| 307 | 3300026142 | Ga0207698_10073978 | Ga0207698_100739783 | 486 |
| 308 | 3300036401 | Ga0373937_0122137 | Ga0373937_0122137_491_2020 | 486 |
| 309 | 3300037068 | Ga0373925_0054284 | Ga0373925_0054284_1036_2565 | 486 |
| 310 | 3300037068 | Ga0373925_0139896 | Ga0373925_0139896_72_1607 | 486 |
| 311 | 3300038443 | Ga0395901_0084843 | Ga0395901_0084843_248_1750 | 486 |
| 312 | 3300039447 | Ga0436361_0675147 | Ga0436361_0675147_281_1783 | 486 |
| 313 | 3300044656 | Ga0466969_0000032 | Ga0466969_0000032_64916_66427 | 486 |
| 314 | 3300044656 | Ga0466969_0012838 | Ga0466969_0012838_2863_4365 | 486 |
| 315 | 3300044656 | Ga0466969_0018362 | Ga0466969_0018362_571_2088 | 486 |
| 316 | 3300044658 | Ga0466972_0001051 | Ga0466972_0001051_1528_3045 | 486 |
| 317 | 3300044683 | Ga0466965_0022854 | Ga0466965_0022854_27_1529 | 486 |
| 318 | 3300044684 | Ga0466966_0003784 | Ga0466966_0003784_7943_9445 | 486 |
| 319 | 3300044693 | Ga0466961_0015191 | Ga0466961_0015191_3298_4815 | 486 |
| 320 | 3300044693 | Ga0466961_0026411 | Ga0466961_0026411_927_2438 | 486 |
| 321 | 3300044706 | Ga0466964_0010848 | Ga0466964_0010848_1714_3231 | 486 |
| 322 | 3300044706 | Ga0466964_0019646 | Ga0466964_0019646_1045_2547 | 486 |
| 323 | 3300044765 | Ga0466970_0031902 | Ga0466970_0031902_63_1565 | 486 |
| 324 | 3300045049 | Ga0466959_0012084 | Ga0466959_0012084_2071_3588 | 486 |
| 325 | 3300045049 | Ga0466959_0030982 | Ga0466959_0030982_1059_2570 | 486 |
| 326 | 3300045049 | Ga0466959_0064043 | Ga0466959_0064043_1002_2504 | 486 |
| 327 | 3300046471 | Ga0495650_0005641 | Ga0495650_0005641_5907_7409 | 486 |
| 328 | 3300046506 | Ga0495583_0000866 | Ga0495583_0000866_138_1640 | 486 |
| 329 | 3300046507 | Ga0495606_0005178 | Ga0495606_0005178_715_2217 | 486 |
| 330 | 3300046660 | Ga0495625_0066257 | Ga0495625_0066257_810_2312 | 486 |
| 331 | 3300046694 | Ga0495649_0004080 | Ga0495649_0004080_7929_9431 | 486 |
| 332 | 3300048911 | Ga0496108_0145926 | Ga0496108_0145926_134_1663 | 486 |
| 333 | 3300048917 | Ga0496114_0061805 | Ga0496114_0061805_1265_2800 | 486 |
| 334 | 3300050493 | nmdc:mga0k408_28957_c1 | nmdc:mga0k408_28957_c1_979_2481 | 486 |
| 335 | 3300050496 | nmdc:mga07m45_2314_c1 | nmdc:mga07m45_2314_c1_7171_8673 | 486 |
| 336 | 3300053085 | Ga0495619_0041711 | Ga0495619_0041711_291_1820 | 486 |
| 337 | 3300053093 | Ga0500651_0048860 | Ga0500651_0048860_847_2349 | 486 |
| 338 | 3300053136 | Ga0500559_0020641 | Ga0500559_0020641_623_2125 | 486 |
| 339 | 3300003322 | rootL2_10001692 | rootL2_1000169218 | 487 |
| 340 | 3300003323 | rootH1_10033303 | rootH1_100333038 | 487 |
| 341 | 3300003775 | Ga0055524_1013413 | Ga0055524_10134131 | 487 |
| 342 | 3300003792 | Ga0055540_1015157 | Ga0055540_10151572 | 487 |
| 343 | 3300003794 | Ga0055531_10002564 | Ga0055531_100025643 | 487 |
| 344 | 3300005262 | Ga0065165_1000569 | Ga0065165_100056943 | 487 |
| 345 | 3300005327 | Ga0070658_10067036 | Ga0070658_100670361 | 487 |
| 346 | 3300005327 | Ga0070658_10132277 | Ga0070658_101322772 | 487 |
| 347 | 3300005329 | Ga0070683_100019870 | Ga0070683_1000198703 | 487 |
| 348 | 3300005334 | Ga0068869_100012836 | Ga0068869_1000128362 | 487 |
| 349 | 3300005339 | Ga0070660_100039589 | Ga0070660_1000395892 | 487 |
| 350 | 3300005344 | Ga0070661_100057373 | Ga0070661_1000573733 | 487 |
| 351 | 3300005354 | Ga0070675_100012854 | Ga0070675_1000128542 | 487 |
| 352 | 3300005355 | Ga0070671_100001183 | Ga0070671_1000011839 | 487 |
| 353 | 3300005366 | Ga0070659_100011766 | Ga0070659_1000117663 | 487 |
| 354 | 3300005455 | Ga0070663_100027938 | Ga0070663_1000279383 | 487 |
| 355 | 3300005457 | Ga0070662_100012262 | Ga0070662_1000122626 | 487 |
| 356 | 3300005530 | Ga0070679_100017226 | Ga0070679_1000172265 | 487 |
| 357 | 3300005543 | Ga0070672_100040042 | Ga0070672_1000400423 | 487 |
| 358 | 3300005563 | Ga0068855_100104465 | Ga0068855_1001044653 | 487 |
| 359 | 3300005614 | Ga0068856_100002754 | Ga0068856_10000275411 | 487 |
| 360 | 3300005616 | Ga0068852_100026667 | Ga0068852_1000266673 | 487 |
| 361 | 3300005617 | Ga0068859_100053491 | Ga0068859_1000534913 | 487 |
| 362 | 3300005618 | Ga0068864_100043880 | Ga0068864_1000438802 | 487 |
| 363 | 3300005719 | Ga0068861_100002723 | Ga0068861_1000027233 | 487 |
| 364 | 3300005841 | Ga0068863_100057193 | Ga0068863_1000571933 | 487 |
| 365 | 3300005841 | Ga0068863_100149623 | Ga0068863_1001496232 | 487 |
| 366 | 3300005842 | Ga0068858_100003275 | Ga0068858_1000032759 | 487 |
| 367 | 3300005842 | Ga0068858_100040827 | Ga0068858_1000408273 | 487 |
| 368 | 3300005843 | Ga0068860_100003813 | Ga0068860_10000381310 | 487 |
| 369 | 3300006177 | Ga0075362_10001909 | Ga0075362_100019095 | 487 |
| 370 | 3300006178 | Ga0075367_10076400 | Ga0075367_100764002 | 487 |
| 371 | 3300006353 | Ga0075370_10000059 | Ga0075370_100000596 | 487 |
| 372 | 3300006353 | Ga0075370_10000087 | Ga0075370_100000874 | 487 |
| 373 | 3300006358 | Ga0068871_100077351 | Ga0068871_1000773512 | 487 |
| 374 | 3300006931 | Ga0097620_100053491 | Ga0097620_1000534913 | 487 |
| 375 | 3300006944 | Ga0099823_1000031 | Ga0099823_100003140 | 487 |
| 376 | 3300009098 | Ga0105245_10010878 | Ga0105245_100108782 | 487 |
| 377 | 3300009177 | Ga0105248_10040747 | Ga0105248_100407474 | 487 |
| 378 | 3300009545 | Ga0105237_10054226 | Ga0105237_100542262 | 487 |
| 379 | 3300009551 | Ga0105238_10058411 | Ga0105238_100584112 | 487 |
| 380 | 3300009551 | Ga0105238_10058800 | Ga0105238_100588003 | 487 |
| 381 | 3300012497 | Ga0157319_1000016 | Ga0157319_100001637 | 487 |
| 382 | 3300013105 | Ga0157369_10017217 | Ga0157369_100172173 | 487 |
| 383 | 3300013105 | Ga0157369_10141816 | Ga0157369_101418162 | 487 |
| 384 | 3300014325 | Ga0163163_10030553 | Ga0163163_100305533 | 487 |
| 385 | 3300014326 | Ga0157380_10029033 | Ga0157380_100290333 | 487 |
| 386 | 3300014968 | Ga0157379_10010706 | Ga0157379_100107065 | 487 |
| 387 | 3300014969 | Ga0157376_10003522 | Ga0157376_100035222 | 487 |
| 388 | 3300017792 | Ga0163161_10027822 | Ga0163161_100278224 | 487 |
| 389 | 3300025273 | Ga0209673_1002426 | Ga0209673_10024267 | 487 |
| 390 | 3300025273 | Ga0209673_1004091 | Ga0209673_10040912 | 487 |
| 391 | 3300025273 | Ga0209673_1013525 | Ga0209673_10135252 | 487 |
| 392 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008820 | 487 |
| 393 | 3300025299 | Ga0209256_1000579 | Ga0209256_100057926 | 487 |
| 394 | 3300025299 | Ga0209256_1001555 | Ga0209256_10015553 | 487 |
| 395 | 3300025303 | Ga0209051_1002125 | Ga0209051_100212514 | 487 |
| 396 | 3300025303 | Ga0209051_1004657 | Ga0209051_10046578 | 487 |
| 397 | 3300025303 | Ga0209051_1018089 | Ga0209051_10180894 | 487 |
| 398 | 3300025304 | Ga0209257_1000984 | Ga0209257_100098426 | 487 |
| 399 | 3300025304 | Ga0209257_1002626 | Ga0209257_10026261 | 487 |
| 400 | 3300025909 | Ga0207705_10017825 | Ga0207705_100178253 | 487 |
| 401 | 3300025917 | Ga0207660_10055979 | Ga0207660_100559792 | 487 |
| 402 | 3300025919 | Ga0207657_10061183 | Ga0207657_100611832 | 487 |
| 403 | 3300025921 | Ga0207652_10003603 | Ga0207652_1000360310 | 487 |
| 404 | 3300025924 | Ga0207694_10051529 | Ga0207694_100515293 | 487 |
| 405 | 3300025931 | Ga0207644_10000702 | Ga0207644_1000070215 | 487 |
| 406 | 3300025933 | Ga0207706_10002472 | Ga0207706_1000247210 | 487 |
| 407 | 3300025940 | Ga0207691_10006274 | Ga0207691_100062749 | 487 |
| 408 | 3300025941 | Ga0207711_10003489 | Ga0207711_1000348911 | 487 |
| 409 | 3300025941 | Ga0207711_10081286 | Ga0207711_100812862 | 487 |
| 410 | 3300025942 | Ga0207689_10003145 | Ga0207689_1000314510 | 487 |
| 411 | 3300025949 | Ga0207667_10166025 | Ga0207667_101660252 | 487 |
| 412 | 3300026035 | Ga0207703_10102282 | Ga0207703_101022822 | 487 |
| 413 | 3300026078 | Ga0207702_10037385 | Ga0207702_100373854 | 487 |
| 414 | 3300026088 | Ga0207641_10035620 | Ga0207641_100356203 | 487 |
| 415 | 3300026089 | Ga0207648_10084706 | Ga0207648_100847062 | 487 |
| 416 | 3300026118 | Ga0207675_100004517 | Ga0207675_1000045176 | 487 |
| 417 | 3300026121 | Ga0207683_10061343 | Ga0207683_100613432 | 487 |
| 418 | 3300026142 | Ga0207698_10033832 | Ga0207698_100338323 | 487 |
| 419 | 3300027296 | Ga0209389_1042605 | Ga0209389_10426052 | 487 |
| 420 | 3300028381 | Ga0268264_10012070 | Ga0268264_100120702 | 487 |
| 421 | 3300028794 | Ga0307515_10012418 | Ga0307515_1001241811 | 487 |
| 422 | 3300031456 | Ga0307513_10021976 | Ga0307513_100219765 | 487 |
| 423 | 3300031507 | Ga0307509_10090207 | Ga0307509_100902072 | 487 |
| 424 | 3300031730 | Ga0307516_10000678 | Ga0307516_1000067833 | 487 |
| 425 | 3300031852 | Ga0307410_10040033 | Ga0307410_100400332 | 487 |
| 426 | 3300031901 | Ga0307406_10039791 | Ga0307406_100397912 | 487 |
| 427 | 3300031903 | Ga0307407_10036927 | Ga0307407_100369272 | 487 |
| 428 | 3300031995 | Ga0307409_100050912 | Ga0307409_1000509123 | 487 |
| 429 | 3300032002 | Ga0307416_100000708 | Ga0307416_10000070817 | 487 |
| 430 | 3300035691 | Ga0373931_0017131 | Ga0373931_0017131_1274_2818 | 487 |
| 431 | 3300036401 | Ga0373937_0049472 | Ga0373937_0049472_293_1849 | 487 |
| 432 | 3300046459 | Ga0495629_0102825 | Ga0495629_0102825_428_1969 | 487 |
| 433 | 3300046519 | Ga0495632_0006200 | Ga0495632_0006200_4562_6103 | 487 |
| 434 | 3300046694 | Ga0495649_0007820 | Ga0495649_0007820_1019_2560 | 487 |
| 435 | 3300046810 | Ga0495660_0028224 | Ga0495660_0028224_1431_2972 | 487 |
| 436 | 3300048905 | Ga0496102_0008877 | Ga0496102_0008877_889_2418 | 487 |
| 437 | 3300048910 | Ga0496107_0030805 | Ga0496107_0030805_1522_3066 | 487 |
| 438 | 3300048912 | Ga0496109_0020125 | Ga0496109_0020125_3272_4816 | 487 |
| 439 | 3300048915 | Ga0496112_0101626 | Ga0496112_0101626_820_2364 | 487 |
| 440 | 3300050493 | nmdc:mga0k408_2308_c1 | nmdc:mga0k408_2308_c1_4937_6478 | 487 |
| 441 | 3300050493 | nmdc:mga0k408_27898_c1 | nmdc:mga0k408_27898_c1_226_1770 | 487 |
| 442 | 3300050495 | nmdc:mga04h51_2722_c1 | nmdc:mga04h51_2722_c1_712_2253 | 487 |
| 443 | 3300050496 | nmdc:mga07m45_2223_c1 | nmdc:mga07m45_2223_c1_3958_5499 | 487 |
| 444 | 3300053080 | Ga0500635_0000055 | Ga0500635_0000055_72357_73862 | 487 |
| 445 | 3300053134 | Ga0500658_0002097 | Ga0500658_0002097_3358_4899 | 487 |
| 446 | 3300053139 | Ga0500568_0005734 | Ga0500568_0005734_602_2143 | 487 |
| 447 | 3300053154 | Ga0500619_000067 | Ga0500619_000067_23255_24781 | 487 |
| 448 | 3300003316 | rootH1_10028438 | rootH1_100284381 | 488 |
| 449 | 3300005328 | Ga0070676_10024703 | Ga0070676_100247033 | 488 |
| 450 | 3300005331 | Ga0070670_100200726 | Ga0070670_1002007261 | 488 |
| 451 | 3300005334 | Ga0068869_100044676 | Ga0068869_1000446762 | 488 |
| 452 | 3300005335 | Ga0070666_10004949 | Ga0070666_100049498 | 488 |
| 453 | 3300005343 | Ga0070687_100011716 | Ga0070687_1000117163 | 488 |
| 454 | 3300005347 | Ga0070668_100015572 | Ga0070668_1000155725 | 488 |
| 455 | 3300005353 | Ga0070669_100001532 | Ga0070669_1000015325 | 488 |
| 456 | 3300005354 | Ga0070675_100009918 | Ga0070675_1000099183 | 488 |
| 457 | 3300005356 | Ga0070674_100004750 | Ga0070674_1000047505 | 488 |
| 458 | 3300005367 | Ga0070667_100022100 | Ga0070667_1000221002 | 488 |
| 459 | 3300005367 | Ga0070667_100116953 | Ga0070667_1001169532 | 488 |
| 460 | 3300005456 | Ga0070678_100025559 | Ga0070678_1000255592 | 488 |
| 461 | 3300005457 | Ga0070662_100004089 | Ga0070662_1000040895 | 488 |
| 462 | 3300005457 | Ga0070662_100010527 | Ga0070662_1000105273 | 488 |
| 463 | 3300005457 | Ga0070662_100021663 | Ga0070662_1000216633 | 488 |
| 464 | 3300005459 | Ga0068867_100006301 | Ga0068867_1000063011 | 488 |
| 465 | 3300005467 | Ga0070706_100014174 | Ga0070706_1000141743 | 488 |
| 466 | 3300005468 | Ga0070707_100032795 | Ga0070707_1000327954 | 488 |
| 467 | 3300005577 | Ga0068857_100025706 | Ga0068857_1000257063 | 488 |
| 468 | 3300005616 | Ga0068852_100185946 | Ga0068852_1001859462 | 488 |
| 469 | 3300005842 | Ga0068858_100026496 | Ga0068858_1000264965 | 488 |
| 470 | 3300005843 | Ga0068860_100000445 | Ga0068860_10000044548 | 488 |
| 471 | 3300006178 | Ga0075367_10025078 | Ga0075367_100250782 | 488 |
| 472 | 3300006195 | Ga0075366_10047989 | Ga0075366_100479892 | 488 |
| 473 | 3300006881 | Ga0068865_100002093 | Ga0068865_10000209310 | 488 |
| 474 | 3300009148 | Ga0105243_10061281 | Ga0105243_100612813 | 488 |
| 475 | 3300009148 | Ga0105243_10116760 | Ga0105243_101167602 | 488 |
| 476 | 3300009545 | Ga0105237_10045864 | Ga0105237_100458643 | 488 |
| 477 | 3300009553 | Ga0105249_10019265 | Ga0105249_100192654 | 488 |
| 478 | 3300010375 | Ga0105239_10010208 | Ga0105239_100102088 | 488 |
| 479 | 3300013306 | Ga0163162_10040830 | Ga0163162_100408303 | 488 |
| 480 | 3300013308 | Ga0157375_10062518 | Ga0157375_100625183 | 488 |
| 481 | 3300014326 | Ga0157380_10069354 | Ga0157380_100693543 | 488 |
| 482 | 3300017792 | Ga0163161_10030998 | Ga0163161_100309983 | 488 |
| 483 | 3300025893 | Ga0207682_10023242 | Ga0207682_100232421 | 488 |
| 484 | 3300025907 | Ga0207645_10005113 | Ga0207645_100051138 | 488 |
| 485 | 3300025910 | Ga0207684_10012635 | Ga0207684_100126354 | 488 |
| 486 | 3300025918 | Ga0207662_10001761 | Ga0207662_100017613 | 488 |
| 487 | 3300025923 | Ga0207681_10002612 | Ga0207681_1000261212 | 488 |
| 488 | 3300025933 | Ga0207706_10009798 | Ga0207706_100097983 | 488 |
| 489 | 3300025933 | Ga0207706_10029242 | Ga0207706_100292423 | 488 |
| 490 | 3300025935 | Ga0207709_10092757 | Ga0207709_100927572 | 488 |
| 491 | 3300025937 | Ga0207669_10006049 | Ga0207669_100060491 | 488 |
| 492 | 3300025942 | Ga0207689_10004853 | Ga0207689_100048539 | 488 |
| 493 | 3300025986 | Ga0207658_10034070 | Ga0207658_100340703 | 488 |
| 494 | 3300026023 | Ga0207677_10043255 | Ga0207677_100432553 | 488 |
| 495 | 3300026035 | Ga0207703_10001799 | Ga0207703_100017995 | 488 |
| 496 | 3300026088 | Ga0207641_10082305 | Ga0207641_100823052 | 488 |
| 497 | 3300026089 | Ga0207648_10004667 | Ga0207648_100046675 | 488 |
| 498 | 3300026116 | Ga0207674_10022384 | Ga0207674_100223843 | 488 |
| 499 | 3300026118 | Ga0207675_100007314 | Ga0207675_1000073149 | 488 |
| 500 | 3300028380 | Ga0268265_10009273 | Ga0268265_100092733 | 488 |
| 501 | 3300028794 | Ga0307515_10020693 | Ga0307515_1002069312 | 488 |
| 502 | 3300031730 | Ga0307516_10004597 | Ga0307516_100045974 | 488 |
| 503 | 3300031730 | Ga0307516_10007334 | Ga0307516_100073349 | 488 |
| 504 | 3300035170 | Ga0373943_0008194 | Ga0373943_0008194_2566_4104 | 488 |
| 505 | 3300042876 | Ga0451577_0043106 | Ga0451577_0043106_1830_3362 | 488 |
| 506 | 3300046512 | Ga0495610_0032511 | Ga0495610_0032511_830_2353 | 488 |
| 507 | 3300046519 | Ga0495632_0017590 | Ga0495632_0017590_1013_2536 | 488 |
| 508 | 3300046522 | Ga0495643_0051132 | Ga0495643_0051132_110_1633 | 488 |
| 509 | 3300046542 | Ga0495597_0002676 | Ga0495597_0002676_845_2326 | 488 |
| 510 | 3300046542 | Ga0495597_0003922 | Ga0495597_0003922_4340_5890 | 488 |
| 511 | 3300046660 | Ga0495625_0010491 | Ga0495625_0010491_1354_2877 | 488 |
| 512 | 3300046683 | Ga0495658_0004142 | Ga0495658_0004142_2526_4064 | 488 |
| 513 | 3300046689 | Ga0495613_0086040 | Ga0495613_0086040_106_1644 | 488 |
| 514 | 3300047443 | Ga0495687_000367 | Ga0495687_000367_48831_50381 | 488 |
| 515 | 3300047472 | Ga0495686_0080608 | Ga0495686_0080608_290_1813 | 488 |
| 516 | 3300048905 | Ga0496102_0024537 | Ga0496102_0024537_685_2211 | 488 |
| 517 | 3300048909 | Ga0496106_0029413 | Ga0496106_0029413_43_1581 | 488 |
| 518 | 3300048927 | Ga0496124_0000786 | Ga0496124_0000786_42531_44108 | 488 |
| 519 | 3300050491 | nmdc:mga00v17_10380_c1 | nmdc:mga00v17_10380_c1_2050_3600 | 488 |
| 520 | 3300050493 | nmdc:mga0k408_11251_c1 | nmdc:mga0k408_11251_c1_2485_4035 | 488 |
| 521 | 3300050496 | nmdc:mga07m45_6961_c1 | nmdc:mga07m45_6961_c1_3799_5349 | 488 |
| 522 | 3300050496 | nmdc:mga07m45_7357_c1 | nmdc:mga07m45_7357_c1_702_2237 | 488 |
| 523 | 3300053730 | Ga0500645_003651 | Ga0500645_003651_1270_2808 | 488 |
| 524 | 3300053739 | Ga0500587_000100 | Ga0500587_000100_1144_2667 | 488 |
| 525 | 3300003316 | rootH1_10024035 | rootH1_100240358 | 489 |
| 526 | 3300005353 | Ga0070669_100019216 | Ga0070669_1000192163 | 489 |
| 527 | 3300005354 | Ga0070675_100004892 | Ga0070675_1000048925 | 489 |
| 528 | 3300005355 | Ga0070671_100007139 | Ga0070671_1000071395 | 489 |
| 529 | 3300005364 | Ga0070673_100086278 | Ga0070673_1000862781 | 489 |
| 530 | 3300005456 | Ga0070678_100051966 | Ga0070678_1000519663 | 489 |
| 531 | 3300005459 | Ga0068867_100005468 | Ga0068867_1000054684 | 489 |
| 532 | 3300025315 | Ga0207697_10014052 | Ga0207697_100140523 | 489 |
| 533 | 3300025893 | Ga0207682_10011915 | Ga0207682_100119153 | 489 |
| 534 | 3300025923 | Ga0207681_10009154 | Ga0207681_100091544 | 489 |
| 535 | 3300025925 | Ga0207650_10033157 | Ga0207650_100331573 | 489 |
| 536 | 3300025926 | Ga0207659_10001039 | Ga0207659_100010399 | 489 |
| 537 | 3300025931 | Ga0207644_10006395 | Ga0207644_100063955 | 489 |
| 538 | 3300025940 | Ga0207691_10041479 | Ga0207691_100414793 | 489 |
| 539 | 3300025945 | Ga0207679_10030714 | Ga0207679_100307143 | 489 |
| 540 | 3300025960 | Ga0207651_10052469 | Ga0207651_100524692 | 489 |
| 541 | 3300026089 | Ga0207648_10030637 | Ga0207648_100306375 | 489 |
| 542 | 3300026121 | Ga0207683_10008076 | Ga0207683_100080763 | 489 |
| 543 | 3300031344 | Ga0265316_10000456 | Ga0265316_1000045628 | 489 |
| 544 | 3300031456 | Ga0307513_10000010 | Ga0307513_10000010347 | 489 |
| 545 | 3300031649 | Ga0307514_10001372 | Ga0307514_100013723 | 489 |
| 546 | 3300042876 | Ga0451577_0004023 | Ga0451577_0004023_1324_2841 | 489 |
| 547 | 3300045051 | Ga0451576_0001324 | Ga0451576_0001324_22434_23999 | 489 |
| 548 | 3300005355 | Ga0070671_100009160 | Ga0070671_1000091607 | 490 |
| 549 | 3300009177 | Ga0105248_10001682 | Ga0105248_1000168213 | 490 |
| 550 | 3300025297 | Ga0209758_1000146 | Ga0209758_100014622 | 490 |
| 551 | 3300025907 | Ga0207645_10004810 | Ga0207645_100048103 | 490 |
| 552 | 3300025931 | Ga0207644_10022140 | Ga0207644_100221404 | 490 |
| 553 | 3300026089 | Ga0207648_10071567 | Ga0207648_100715673 | 490 |
| 554 | 3300048915 | Ga0496112_0008913 | Ga0496112_0008913_518_2068 | 490 |
| 555 | iso_pu_bacteria | 2643221660 | 2644338795 | 490 |
| 556 | 3300005577 | Ga0068857_100022930 | Ga0068857_1000229305 | 491 |
| 557 | 3300006846 | Ga0075430_100025785 | Ga0075430_1000257853 | 491 |
| 558 | 3300006880 | Ga0075429_100001289 | Ga0075429_1000012893 | 491 |
| 559 | 3300021361 | Ga0213872_10000049 | Ga0213872_1000004943 | 491 |
| 560 | 3300025925 | Ga0207650_10053437 | Ga0207650_100534372 | 491 |
| 561 | 3300025927 | Ga0207687_10060589 | Ga0207687_100605892 | 491 |
| 562 | 3300025935 | Ga0207709_10084103 | Ga0207709_100841032 | 491 |
| 563 | 3300025940 | Ga0207691_10004143 | Ga0207691_100041432 | 491 |
| 564 | 3300025942 | Ga0207689_10128618 | Ga0207689_101286181 | 491 |
| 565 | 3300026089 | Ga0207648_10003372 | Ga0207648_100033727 | 491 |
| 566 | 3300026116 | Ga0207674_10006659 | Ga0207674_1000665913 | 491 |
| 567 | 3300039447 | Ga0436361_0082864 | Ga0436361_0082864_57235_58776 | 491 |
| 568 | 3300042876 | Ga0451577_0001120 | Ga0451577_0001120_8932_10464 | 491 |
| 569 | 3300048913 | Ga0496110_0002606 | Ga0496110_0002606_3329_4903 | 491 |
| 570 | 3300050508 | nmdc:mga09592_4802_c1 | nmdc:mga09592_4802_c1_6676_8211 | 491 |
| 571 | iso_pu_bacteria | 2881101125 | 2881103199 | 491 |
| 572 | 3300002773 | JGI25152J39213_1005234 | JGI25152J39213_10052342 | 492 |
| 573 | 3300003771 | Ga0055526_1000280 | Ga0055526_10002802 | 492 |
| 574 | 3300021361 | Ga0213872_10006891 | Ga0213872_100068914 | 492 |
| 575 | 3300025245 | Ga0207425_1002035 | Ga0207425_10020356 | 492 |
| 576 | 3300025258 | Ga0209129_1000027 | Ga0209129_100002746 | 492 |
| 577 | 3300025273 | Ga0209673_1004494 | Ga0209673_10044941 | 492 |
| 578 | 3300025295 | Ga0209564_1000139 | Ga0209564_100013937 | 492 |
| 579 | 3300025297 | Ga0209758_1000052 | Ga0209758_100005274 | 492 |
| 580 | 3300037471 | Ga0395905_0145432 | Ga0395905_0145432_52_1590 | 492 |
| 581 | 3300039447 | Ga0436361_0388468 | Ga0436361_0388468_7955_9433 | 492 |
| 582 | 3300041997 | Ga0439431_0002567 | Ga0439431_0002567_784_2310 | 492 |
| 583 | 3300045051 | Ga0451576_0244981 | Ga0451576_0244981_16_1569 | 492 |
| 584 | 3300048907 | Ga0496104_0110012 | Ga0496104_0110012_330_1889 | 492 |
| 585 | iso_pu_bacteria | 2904479285 | 2904480971 | 492 |
| 586 | 3300005364 | Ga0070673_100118179 | Ga0070673_1001181792 | 493 |
| 587 | 3300013296 | Ga0157374_10010968 | Ga0157374_100109689 | 493 |
| 588 | 3300044673 | Ga0453683_0009928 | Ga0453683_0009928_3559_5046 | 494 |
| 589 | 3300045051 | Ga0451576_0004194 | Ga0451576_0004194_3702_5189 | 494 |
| 590 | iso_pu_bacteria | 2643221644 | 2644248237 | 494 |
| 591 | 3300042122 | Ga0450920_002898 | Ga0450920_002898_1125_2690 | 495 |
| 592 | 3300042125 | Ga0450923_007216 | Ga0450923_007216_281_1846 | 495 |
| 593 | 3300042531 | Ga0450918_001027 | Ga0450918_001027_3592_5157 | 495 |
| 594 | iso_pu_bacteria | 2511231002 | 2511246094 | 495 |
| 595 | 3300042876 | Ga0451577_0023485 | Ga0451577_0023485_2932_4425 | 496 |
| 596 | 3300044673 | Ga0453683_0002249 | Ga0453683_0002249_5659_7152 | 496 |
| 597 | 3300045051 | Ga0451576_0006910 | Ga0451576_0006910_4862_6355 | 496 |
| 598 | 3300053093 | Ga0500651_0005106 | Ga0500651_0005106_4519_6009 | 496 |
| 599 | 3300053117 | Ga0500593_000309 | Ga0500593_000309_10599_12170 | 496 |
| 600 | 3300031730 | Ga0307516_10003314 | Ga0307516_1000331412 | 498 |
| 601 | 3300002987 | JGI25159J45721_1000160 | JGI25159J45721_100016014 | 499 |
| 602 | 3300002987 | JGI25159J45721_1001766 | JGI25159J45721_10017665 | 499 |
| 603 | 3300003354 | JGI25160J50197_1000283 | JGI25160J50197_100028332 | 499 |
| 604 | 3300003354 | JGI25160J50197_1000291 | JGI25160J50197_100029136 | 499 |
| 605 | 3300003374 | JGI25161J50226_1000015 | JGI25161J50226_100001536 | 499 |
| 606 | 3300003771 | Ga0055526_1002747 | Ga0055526_10027479 | 499 |
| 607 | 3300003771 | Ga0055526_1002757 | Ga0055526_10027579 | 499 |
| 608 | 3300003773 | Ga0055537_1000353 | Ga0055537_100035325 | 499 |
| 609 | 3300003775 | Ga0055524_1000016 | Ga0055524_1000016221 | 499 |
| 610 | 3300003775 | Ga0055524_1000332 | Ga0055524_100033214 | 499 |
| 611 | 3300003784 | Ga0055534_1000758 | Ga0055534_100075813 | 499 |
| 612 | 3300003790 | Ga0055528_1000467 | Ga0055528_10004676 | 499 |
| 613 | 3300003791 | Ga0055530_10000506 | Ga0055530_1000050626 | 499 |
| 614 | 3300003792 | Ga0055540_1000144 | Ga0055540_100014434 | 499 |
| 615 | 3300003794 | Ga0055531_10001304 | Ga0055531_1000130413 | 499 |
| 616 | 3300004625 | Ga0055543_1000366 | Ga0055543_100036615 | 499 |
| 617 | 3300025245 | Ga0207425_1004948 | Ga0207425_10049484 | 499 |
| 618 | 3300025256 | Ga0209759_1015495 | Ga0209759_10154951 | 499 |
| 619 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004178 | 499 |
| 620 | 3300025273 | Ga0209673_1000045 | Ga0209673_1000045194 | 499 |
| 621 | 3300025284 | Ga0209130_1000413 | Ga0209130_100041313 | 499 |
| 622 | 3300025291 | Ga0209675_1000185 | Ga0209675_100018529 | 499 |
| 623 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007730 | 499 |
| 624 | 3300025294 | Ga0209025_1001312 | Ga0209025_10013125 | 499 |
| 625 | 3300025294 | Ga0209025_1012002 | Ga0209025_10120026 | 499 |
| 626 | 3300025295 | Ga0209564_1000962 | Ga0209564_100096226 | 499 |
| 627 | 3300025295 | Ga0209564_1001085 | Ga0209564_100108523 | 499 |
| 628 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003778 | 499 |
| 629 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001790 | 499 |
| 630 | 3300025302 | Ga0207426_1001465 | Ga0207426_10014657 | 499 |
| 631 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003778 | 499 |
| 632 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020730 | 499 |
| 633 | 3300031238 | Ga0265332_10000033 | Ga0265332_1000003355 | 499 |
| 634 | 3300053730 | Ga0500645_000436 | Ga0500645_000436_2716_4215 | 499 |
| 635 | 3300053730 | Ga0500645_002698 | Ga0500645_002698_5324_6823 | 499 |
| 636 | 3300050496 | nmdc:mga07m45_10918_c1 | nmdc:mga07m45_10918_c1_1694_3334 | 502 |
| 637 | 3300031456 | Ga0307513_10000120 | Ga0307513_1000012096 | 514 |
| 638 | 3300002704 | JGI25155J39150_1000049 | JGI25155J39150_100004917 | 516 |
| 639 | 3300002705 | JGI25156J39149_1000023 | JGI25156J39149_1000023126 | 516 |
| 640 | 3300002705 | JGI25156J39149_1000142 | JGI25156J39149_100014222 | 516 |
| 641 | 3300002738 | JGI25154J39366_1000036 | JGI25154J39366_100003631 | 516 |
| 642 | 3300002741 | JGI25157J39369_1000023 | JGI25157J39369_1000023127 | 516 |
| 643 | 3300025206 | Ga0209435_100001 | Ga0209435_100001278 | 516 |
| 644 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001647 | 516 |
| 645 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003278 | 516 |
| 646 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001278 | 516 |
| 647 | 3300025284 | Ga0209130_1000056 | Ga0209130_1000056156 | 516 |
| 648 | 3300025297 | Ga0209758_1006478 | Ga0209758_10064786 | 516 |
| 649 | 3300025302 | Ga0207426_1000025 | Ga0207426_1000025166 | 516 |
| 650 | 3300031548 | Ga0307408_100006428 | Ga0307408_1000064283 | 516 |
| 651 | 3300053117 | Ga0500593_000591 | Ga0500593_000591_2585_4135 | 516 |
| 652 | 3300053129 | Ga0500628_006632 | Ga0500628_006632_278_1828 | 516 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u6z-assembly1.cif.gz_B | structure of an e. coli exopolyphosphatase: insight into the processive hydrolysis of polyphosphate and its regulation | 0.9102 | 24 | 513 |
| 6xb3-assembly7.cif.gz_N | structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] | 0.9021 | 150 | 176 |
| 6xb3-assembly5.cif.gz_I | structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] | 0.8908 | 150 | 176 |
| 1u6z-assembly1.cif.gz_B | structure of an e. coli exopolyphosphatase: insight into the processive hydrolysis of polyphosphate and its regulation | 0.8908 | 24 | 513 |
| 3cer-assembly5.cif.gz_E | crystal structure of the exopolyphosphatase-like protein q8g5j2. northeast structural genomics consortium target blr13 | 0.8846 | 22 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2floB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9714 | 24 | 127 | 3.30.420.40 |
| 2floD02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 | 0.965 | 128 | 307 | 3.30.420.150 |
| 2floD02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 | 0.9596 | 128 | 307 | 3.30.420.150 |
| 3mdqA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.919 | 22 | 135 | 3.30.420.40 |
| af_P96374_2_133_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9132 | 22 | 135 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0HER2-F1-model_v4 | Ppx/GppA family phosphatase | 0.9847 | 22 | 279 |
GO:0004309
GO:0006798 |
| AF-A0A6N1X2S7-F1-model_v4 | Ppx/GppA family phosphatase | 0.9818 | 18 | 318 |
GO:0016462
|
| AF-A0A519I708-F1-model_v4 | deleted | 0.9818 | 18 | 178 |
|
| AF-A0A6N7D3X5-F1-model_v4 | Exopolyphosphatase | 0.9811 | 18 | 516 |
GO:0016462
|
| AF-A0A5S3VSS5-F1-model_v4 | Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase | 0.9809 | 57 | 147 |
GO:0008894
GO:0015949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar