F472653

General Info

Members Datasets Scaffolds Average Seq Length
652 315 634 507

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10024035|rootH1_100240358
Length 585
Sequence MTQAHVPPILAAIDMGSNSFRLELAQLQHGQYRRLDYLKETVRLGAGLDAMSMLTEEAAQRGLDCLRRFAERLADLPGRQVRAVATQTLREARNRNAFLARAQEVLGHPIEVISGREEARLIYAGVARLQTAEDPRLVIDIGGRSTEMILGRGPQPLAAESFQIGSVSLSMRFFTDGRFTAEAFRAAQVAAGAELEEAITQFSRQAAQPRWKQALGSSGTVGAVAQILAANGVSPDGSITLDGLRWCIEQCLLAGRIDALKLPGLKDDRRAVVGGGLCILYTLLTHFDIERLYPAKGALRQGVIFDLAERLDPRLLAAGRDMREQSVSELQRRFAVDRDQAGRVQRIAQRLHAQLAPKAEEEHRRELGWAAALHEIGMMVSHHDHHRHSAYLLSHVDAPGFSQNQLRRLGDLALGQRGGLRKLEEQLQEEPMVWQLLALRLAAIKCHARGEVDATAIKLRREGMNVVIEMRKGWADAHPRAHYLLREELGSARQAWPGPATRVGRTPTRSAHLRFASLGQTASKSVRSPTRVAGPGHARPGTGRTAEKGSEGDGWSGARQGSSWYRRIRACWALTCCGTPSVPMR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
13 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221656 Pelomonas sp. Root405 Isolate Unclassified
16 2643221660 Methylibium sp. Root1272 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2831864461 Roseateles noduli HZ7 Isolate Nodule
19 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
20 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
21 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
22 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
233 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
303 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
304 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
305 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
311 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
312 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
315 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.93
Metatranscriptomes 0
Isolates 3.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.24
Nodule 0.77
Rhizoplane 2.15
Rhizosphere 63.65
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000049 3300002704 Bacteria 78961
2 JGI25156J39149_1000023 3300002705 Bacteria 146831
3 JGI25156J39149_1000142 3300002705 Bacteria 52807
4 JGI25156J39149_1000220 3300002705 Bacteria 39809
5 JGI25154J39366_1000036 3300002738 Bacteria 161697
6 JGI25154J39366_1003097 3300002738 Bacteria 3730
7 JGI25157J39369_1000023 3300002741 Bacteria 161697
8 JGI25157J39369_1000135 3300002741 Bacteria 61510
9 JGI25152J39213_1005234 3300002773 Bacteria 3856
10 JGI25159J45721_1000160 3300002987 Bacteria 31836
11 JGI25159J45721_1001766 3300002987 Bacteria 8691
12 JGI25153J46596_10004040 3300003215 Bacteria 7999
13 rootH1_10024035 3300003316 Bacteria 8072
14 rootH1_10024035 3300003323 Bacteria 75545
15 rootH1_10028438 3300003316 Bacteria 4544
16 rootH1_10028438 3300003323 Bacteria 1649
17 rootH2_10107905 3300003320 Bacteria 5069
18 rootL2_10001692 3300003322 Bacteria 21923
19 rootL2_10029717 3300003322 Bacteria 9471
20 rootL2_10150743 3300003322 Bacteria 2608
21 rootH1_10002882 3300003323 Bacteria 3948
22 rootH1_10033303 3300003323 Bacteria 9630
23 rootH1_10044884 3300003323 Bacteria 5575
24 JGI25160J50197_1000283 3300003354 Bacteria 36700
25 JGI25160J50197_1000291 3300003354 Bacteria 36039
26 JGI25161J50226_1000015 3300003374 Bacteria 183773
27 Ga0055539_1001240 3300003752 Bacteria 5124
28 Ga0055539_1003715 3300003752 Bacteria 2088
29 Ga0055533_1000172 3300003756 Bacteria 58634
30 Ga0055525_1000031 3300003759 Bacteria 314909
31 Ga0055535_1000641 3300003761 Bacteria 27812
32 Ga0055529_1000602 3300003763 Bacteria 27804
33 Ga0055526_1000280 3300003771 Bacteria 43010
34 Ga0055526_1002747 3300003771 Bacteria 11677
35 Ga0055526_1002757 3300003771 Bacteria 11647
36 Ga0055537_1000353 3300003773 Bacteria 31178
37 Ga0055524_1000016 3300003775 Bacteria 244926
38 Ga0055524_1000125 3300003775 Bacteria 90042
39 Ga0055524_1000332 3300003775 Bacteria 43781
40 Ga0055524_1013413 3300003775 Bacteria 3089
41 Ga0055534_1000758 3300003784 Bacteria 15348
42 Ga0055528_1000467 3300003790 Bacteria 32327
43 Ga0055530_10000470 3300003791 Bacteria 35231
44 Ga0055530_10000506 3300003791 Bacteria 33825
45 Ga0055540_1000011 3300003792 Bacteria 282927
46 Ga0055540_1000144 3300003792 Bacteria 71420
47 Ga0055540_1015157 3300003792 Bacteria 2259
48 Ga0055531_10000168 3300003794 Bacteria 73798
49 Ga0055531_10001304 3300003794 Bacteria 18797
50 Ga0055531_10002564 3300003794 Bacteria 12058
51 Ga0055543_1000366 3300004625 Bacteria 29918
52 Ga0065165_1000569 3300005262 Bacteria 54781
53 Ga0065165_1000967 3300005262 Bacteria 36011
54 Ga0070658_10067036 3300005327 Bacteria 2932
55 Ga0070658_10132277 3300005327 Bacteria 2079
56 Ga0070676_10006846 3300005328 Bacteria 6103
57 Ga0070676_10024703 3300005328 Bacteria 3388
58 Ga0070676_10031112 3300005328 Bacteria 3047
59 Ga0070683_100019870 3300005329 Bacteria 5971
60 Ga0070670_100002757 3300005331 Bacteria 14508
61 Ga0070670_100016141 3300005331 Bacteria 6410
62 Ga0070670_100200726 3300005331 Bacteria 1733
63 Ga0068869_100009386 3300005334 Bacteria 6347
64 Ga0068869_100012836 3300005334 Bacteria 5545
65 Ga0068869_100044676 3300005334 Bacteria 3186
66 Ga0070666_10001889 3300005335 Bacteria 12748
67 Ga0070666_10004949 3300005335 Bacteria 8151
68 Ga0068868_100009443 3300005338 Bacteria 7021
69 Ga0068868_100018937 3300005338 Bacteria 5153
70 Ga0068868_100035076 3300005338 Bacteria 3876
71 Ga0070660_100033296 3300005339 Bacteria 3884
72 Ga0070660_100039589 3300005339 Bacteria 3584
73 Ga0070687_100011716 3300005343 Bacteria 3848
74 Ga0070661_100005430 3300005344 Bacteria 8788
75 Ga0070661_100057373 3300005344 Bacteria 2853
76 Ga0070668_100015572 3300005347 Bacteria 5683
77 Ga0070668_100106439 3300005347 Bacteria 2228
78 Ga0070669_100001532 3300005353 Bacteria 16719
79 Ga0070669_100019216 3300005353 Bacteria 4881
80 Ga0070669_100042130 3300005353 Bacteria 3321
81 Ga0070675_100002630 3300005354 Bacteria 13494
82 Ga0070675_100004892 3300005354 Bacteria 10219
83 Ga0070675_100009918 3300005354 Bacteria 7426
84 Ga0070675_100012854 3300005354 Bacteria 6570
85 Ga0070675_100013570 3300005354 Bacteria 6407
86 Ga0070671_100001183 3300005355 Bacteria 19526
87 Ga0070671_100007139 3300005355 Bacteria 8925
88 Ga0070671_100009160 3300005355 Bacteria 7948
89 Ga0070671_100025386 3300005355 Bacteria 4862
90 Ga0070671_100032256 3300005355 Bacteria 4332
91 Ga0070671_100050555 3300005355 Bacteria 3457
92 Ga0070671_100087272 3300005355 Bacteria 2611
93 Ga0070674_100004750 3300005356 Bacteria 7784
94 Ga0070674_100005318 3300005356 Bacteria 7423
95 Ga0070673_100011474 3300005364 Bacteria 6047
96 Ga0070673_100061796 3300005364 Bacteria 2973
97 Ga0070673_100086278 3300005364 Bacteria 2557
98 Ga0070673_100118179 3300005364 Bacteria 2207
99 Ga0070659_100011766 3300005366 Bacteria 6475
100 Ga0070659_100076260 3300005366 Bacteria 2673
101 Ga0070667_100003099 3300005367 Bacteria 14303
102 Ga0070667_100016360 3300005367 Bacteria 6136
103 Ga0070667_100022100 3300005367 Bacteria 5276
104 Ga0070667_100116953 3300005367 Bacteria 2316
105 Ga0070663_100027938 3300005455 Bacteria 3836
106 Ga0070663_100032881 3300005455 Bacteria 3579
107 Ga0070678_100001686 3300005456 Bacteria 11852
108 Ga0070678_100002569 3300005456 Bacteria 9969
109 Ga0070678_100015381 3300005456 Bacteria 4862
110 Ga0070678_100025559 3300005456 Bacteria 3975
111 Ga0070678_100051966 3300005456 Bacteria 2973
112 Ga0070678_100088955 3300005456 Bacteria 2363
113 Ga0070662_100004089 3300005457 Bacteria 9163
114 Ga0070662_100010527 3300005457 Bacteria 6074
115 Ga0070662_100012262 3300005457 Bacteria 5677
116 Ga0070662_100021663 3300005457 Bacteria 4391
117 Ga0070662_100025849 3300005457 Bacteria 4059
118 Ga0068867_100000249 3300005459 Bacteria 35572
119 Ga0068867_100005468 3300005459 Bacteria 8990
120 Ga0068867_100006301 3300005459 Bacteria 8395
121 Ga0068867_100013331 3300005459 Bacteria 5823
122 Ga0068867_100079502 3300005459 Bacteria 2468
123 Ga0070706_100014174 3300005467 Bacteria 7365
124 Ga0070707_100032795 3300005468 Bacteria 4949
125 Ga0070679_100017226 3300005530 Bacteria 6988
126 Ga0070684_100062895 3300005535 Bacteria 3252
127 Ga0070672_100028249 3300005543 Bacteria 4193
128 Ga0070672_100040042 3300005543 Bacteria 3594
129 Ga0068855_100014551 3300005563 Bacteria 9477
130 Ga0068855_100030962 3300005563 Bacteria 6394
131 Ga0068855_100104465 3300005563 Bacteria 3259
132 Ga0068855_100256732 3300005563 Bacteria 1948
133 Ga0070664_100008373 3300005564 Bacteria 8361
134 Ga0070664_100129894 3300005564 Bacteria 2212
135 Ga0068857_100022930 3300005577 Bacteria 5492
136 Ga0068857_100025706 3300005577 Bacteria 5184
137 Ga0068857_100157822 3300005577 Bacteria 2057
138 Ga0068856_100002754 3300005614 Bacteria 18000
139 Ga0068852_100026667 3300005616 Bacteria 4701
140 Ga0068852_100039272 3300005616 Bacteria 3984
141 Ga0068852_100071257 3300005616 Bacteria 3051
142 Ga0068852_100185946 3300005616 Bacteria 1957
143 Ga0068859_100010856 3300005617 Bacteria 9164
144 Ga0068859_100053491 3300005617 Bacteria 4061
145 Ga0068864_100006324 3300005618 Bacteria 9713
146 Ga0068864_100015252 3300005618 Bacteria 6391
147 Ga0068864_100043880 3300005618 Bacteria 3829
148 Ga0068861_100002723 3300005719 Bacteria 11577
149 Ga0068861_100106503 3300005719 Bacteria 2240
150 Ga0068863_100057193 3300005841 Bacteria 3691
151 Ga0068863_100149623 3300005841 Bacteria 2233
152 Ga0068858_100002892 3300005842 Bacteria 17265
153 Ga0068858_100003275 3300005842 Bacteria 16136
154 Ga0068858_100026496 3300005842 Bacteria 5384
155 Ga0068858_100040827 3300005842 Bacteria 4304
156 Ga0068860_100000445 3300005843 Bacteria 52236
157 Ga0068860_100003813 3300005843 Bacteria 15505
158 Ga0068860_100082137 3300005843 Bacteria 3065
159 Ga0068862_100175189 3300005844 Bacteria 1922
160 Ga0075362_10001909 3300006177 Bacteria 6845
161 Ga0075367_10025078 3300006178 Bacteria 3368
162 Ga0075367_10076400 3300006178 Bacteria 2021
163 Ga0075366_10003352 3300006195 Bacteria 8430
164 Ga0075366_10004000 3300006195 Bacteria 7878
165 Ga0075366_10012500 3300006195 Bacteria 4815
166 Ga0075366_10047989 3300006195 Bacteria 2531
167 Ga0075366_10063715 3300006195 Bacteria 2191
168 Ga0097621_100015499 3300006237 Bacteria 5737
169 Ga0075370_10000059 3300006353 Bacteria 32632
170 Ga0075370_10000087 3300006353 Bacteria 28459
171 Ga0075370_10002533 3300006353 Bacteria 8490
172 Ga0075370_10002840 3300006353 Bacteria 8127
173 Ga0075370_10009953 3300006353 Bacteria 4954
174 Ga0075370_10070806 3300006353 Bacteria 1995
175 Ga0068871_100015209 3300006358 Bacteria 5753
176 Ga0068871_100077351 3300006358 Bacteria 2750
177 Ga0075430_100025785 3300006846 Bacteria 5002
178 Ga0075429_100001289 3300006880 Bacteria 20430
179 Ga0068865_100002093 3300006881 Bacteria 11787
180 Ga0097620_100010856 3300006931 Bacteria 9164
181 Ga0097620_100053491 3300006931 Bacteria 4061
182 Ga0099823_1000031 3300006944 Bacteria 69036
183 Ga0079104_1000465 3300006946 Bacteria 45434
184 Ga0105240_10008979 3300009093 Bacteria 14207
185 Ga0105240_10040846 3300009093 Bacteria 5927
186 Ga0105240_10042069 3300009093 Bacteria 5825
187 Ga0105245_10010878 3300009098 Bacteria 7915
188 Ga0105245_10028195 3300009098 Bacteria 4951
189 Ga0105243_10002157 3300009148 Bacteria 16630
190 Ga0105243_10020375 3300009148 Bacteria 5029
191 Ga0105243_10061281 3300009148 Bacteria 3008
192 Ga0105243_10116760 3300009148 Bacteria 2242
193 Ga0105241_10055820 3300009174 Bacteria 3026
194 Ga0105248_10001682 3300009177 Bacteria 24633
195 Ga0105248_10040747 3300009177 Bacteria 5206
196 Ga0105237_10000977 3300009545 Bacteria 38396
197 Ga0105237_10045864 3300009545 Bacteria 4398
198 Ga0105237_10054226 3300009545 Bacteria 4017
199 Ga0105238_10001620 3300009551 Bacteria 22525
200 Ga0105238_10058411 3300009551 Bacteria 3867
201 Ga0105238_10058800 3300009551 Bacteria 3853
202 Ga0105238_10080804 3300009551 Bacteria 3240
203 Ga0105249_10019265 3300009553 Bacteria 6085
204 Ga0105239_10001185 3300010375 Bacteria 35747
205 Ga0105239_10010208 3300010375 Bacteria 10520
206 Ga0105239_10068079 3300010375 Bacteria 3912
207 Ga0157319_1000016 3300012497 Bacteria 127256
208 Ga0157369_10017217 3300013105 Bacteria 8122
209 Ga0157369_10141816 3300013105 Bacteria 2542
210 Ga0157374_10010968 3300013296 Bacteria 7825
211 Ga0157374_10089315 3300013296 Bacteria 2936
212 Ga0157378_10083568 3300013297 Bacteria 2890
213 Ga0163162_10035901 3300013306 Bacteria 4938
214 Ga0163162_10040830 3300013306 Bacteria 4641
215 Ga0157375_10062518 3300013308 Bacteria 3700
216 Ga0157375_10094817 3300013308 Bacteria 3054
217 Ga0157375_10099480 3300013308 Bacteria 2987
218 Ga0157375_10180548 3300013308 Bacteria 2262
219 Ga0163163_10001922 3300014325 Bacteria 17590
220 Ga0163163_10030553 3300014325 Bacteria 5192
221 Ga0157380_10029033 3300014326 Bacteria 4225
222 Ga0157380_10030112 3300014326 Bacteria 4155
223 Ga0157380_10069354 3300014326 Bacteria 2844
224 Ga0157377_10000016 3300014745 Bacteria 190613
225 Ga0157379_10010706 3300014968 Bacteria 7991
226 Ga0157379_10018753 3300014968 Bacteria 6101
227 Ga0157379_10028002 3300014968 Bacteria 5016
228 Ga0157379_10171980 3300014968 Bacteria 1956
229 Ga0157376_10003522 3300014969 Bacteria 10798
230 Ga0157376_10080035 3300014969 Bacteria 2802
231 Ga0163161_10027822 3300017792 Bacteria 4011
232 Ga0163161_10030998 3300017792 Bacteria 3808
233 Ga0213872_10000006 3300021361 Bacteria 249845
234 Ga0213872_10000049 3300021361 Bacteria 109094
235 Ga0213872_10000102 3300021361 Bacteria 79440
236 Ga0213872_10000458 3300021361 Bacteria 33281
237 Ga0213872_10006588 3300021361 Bacteria 5800
238 Ga0213872_10006891 3300021361 Bacteria 5656
239 Ga0213872_10019477 3300021361 Bacteria 3125
240 Ga0209435_100001 3300025206 Bacteria 1424171
241 Ga0209674_100088 3300025226 Bacteria 181554
242 Ga0209563_100044 3300025230 Bacteria 396812
243 Ga0209563_100160 3300025230 Bacteria 58893
244 Ga0207427_100296 3300025231 Bacteria 34920
245 Ga0209258_100630 3300025242 Bacteria 27864
246 Ga0209258_100869 3300025242 Bacteria 16009
247 Ga0207425_1002035 3300025245 Bacteria 7527
248 Ga0207425_1004948 3300025245 Bacteria 3890
249 Ga0209646_1000001 3300025246 Bacteria 3092932
250 Ga0209646_1000214 3300025246 Bacteria 64093
251 Ga0209026_1000003 3300025250 Bacteria 1060571
252 Ga0209026_1000059 3300025250 Bacteria 226652
253 Ga0209677_100162 3300025253 Bacteria 58923
254 Ga0209677_100226 3300025253 Bacteria 40136
255 Ga0209148_1001657 3300025254 Bacteria 10062
256 Ga0209759_1000001 3300025256 Bacteria 2799452
257 Ga0209759_1000365 3300025256 Bacteria 56836
258 Ga0209759_1015495 3300025256 Bacteria 1965
259 Ga0209129_1000027 3300025258 Bacteria 409587
260 Ga0209565_1000004 3300025263 Bacteria 983150
261 Ga0209455_1000508 3300025272 Bacteria 27836
262 Ga0209673_1000045 3300025273 Bacteria 290531
263 Ga0209673_1002426 3300025273 Bacteria 12963
264 Ga0209673_1004091 3300025273 Bacteria 8034
265 Ga0209673_1004494 3300025273 Bacteria 7434
266 Ga0209673_1013525 3300025273 Bacteria 3213
267 Ga0209130_1000056 3300025284 Bacteria 210851
268 Ga0209130_1000413 3300025284 Bacteria 46570
269 Ga0209675_1000185 3300025291 Bacteria 68701
270 Ga0209675_1006741 3300025291 Bacteria 4545
271 Ga0209676_1000007 3300025292 Bacteria 1029371
272 Ga0209025_1001312 3300025294 Bacteria 33868
273 Ga0209025_1012002 3300025294 Bacteria 5617
274 Ga0209564_1000008 3300025295 Bacteria 953227
275 Ga0209564_1000139 3300025295 Bacteria 180328
276 Ga0209564_1000962 3300025295 Bacteria 36603
277 Ga0209564_1001085 3300025295 Bacteria 32520
278 Ga0209758_1000052 3300025297 Bacteria 338962
279 Ga0209758_1000146 3300025297 Bacteria 169246
280 Ga0209758_1006478 3300025297 Bacteria 8385
281 Ga0209050_1000003 3300025298 Bacteria 1609245
282 Ga0209050_1000303 3300025298 Bacteria 101498
283 Ga0209050_1000532 3300025298 Bacteria 63063
284 Ga0209050_1002916 3300025298 Bacteria 13427
285 Ga0209050_1014289 3300025298 Bacteria 3433
286 Ga0209256_1000001 3300025299 Bacteria 2166974
287 Ga0209256_1000113 3300025299 Bacteria 175296
288 Ga0209256_1000579 3300025299 Bacteria 52079
289 Ga0209256_1001555 3300025299 Bacteria 22789
290 Ga0207426_1000025 3300025302 Bacteria 532921
291 Ga0207426_1001465 3300025302 Bacteria 19462
292 Ga0209051_1000003 3300025303 Bacteria 1609245
293 Ga0209051_1000020 3300025303 Bacteria 508628
294 Ga0209051_1002125 3300025303 Bacteria 14777
295 Ga0209051_1004657 3300025303 Bacteria 8357
296 Ga0209051_1013338 3300025303 Bacteria 3918
297 Ga0209051_1013557 3300025303 Bacteria 3872
298 Ga0209051_1018089 3300025303 Bacteria 3129
299 Ga0209257_1000020 3300025304 Bacteria 773356
300 Ga0209257_1000021 3300025304 Bacteria 771986
301 Ga0209257_1000085 3300025304 Bacteria 291117
302 Ga0209257_1000984 3300025304 Bacteria 38671
303 Ga0209257_1002626 3300025304 Bacteria 17340
304 Ga0207697_10014052 3300025315 Bacteria 3333
305 Ga0207682_10011915 3300025893 Bacteria 3396
306 Ga0207682_10015574 3300025893 Bacteria 2960
307 Ga0207682_10023242 3300025893 Bacteria 2447
308 Ga0207645_10004810 3300025907 Bacteria 9928
309 Ga0207645_10005113 3300025907 Bacteria 9597
310 Ga0207645_10022159 3300025907 Bacteria 4135
311 Ga0207645_10036572 3300025907 Bacteria 3152
312 Ga0207643_10038616 3300025908 Bacteria 2682
313 Ga0207705_10017825 3300025909 Bacteria 5078
314 Ga0207684_10012635 3300025910 Bacteria 7333
315 Ga0207695_10008251 3300025913 Bacteria 13072
316 Ga0207695_10010519 3300025913 Bacteria 11315
317 Ga0207695_10179493 3300025913 Bacteria 2038
318 Ga0207671_10001232 3300025914 Bacteria 30245
319 Ga0207671_10028129 3300025914 Bacteria 4202
320 Ga0207660_10055979 3300025917 Bacteria 2820
321 Ga0207662_10001761 3300025918 Bacteria 10629
322 Ga0207657_10046733 3300025919 Bacteria 3790
323 Ga0207657_10061183 3300025919 Bacteria 3230
324 Ga0207652_10003603 3300025921 Bacteria 12761
325 Ga0207681_10002612 3300025923 Bacteria 11407
326 Ga0207681_10009154 3300025923 Bacteria 6048
327 Ga0207694_10051529 3300025924 Bacteria 3190
328 Ga0207650_10004499 3300025925 Bacteria 9532
329 Ga0207650_10033157 3300025925 Bacteria 3738
330 Ga0207650_10053437 3300025925 Bacteria 2994
331 Ga0207650_10100198 3300025925 Bacteria 2228
332 Ga0207659_10001039 3300025926 Bacteria 16428
333 Ga0207659_10005363 3300025926 Bacteria 7768
334 Ga0207659_10024204 3300025926 Bacteria 4065
335 Ga0207687_10033819 3300025927 Bacteria 3469
336 Ga0207687_10060589 3300025927 Bacteria 2670
337 Ga0207644_10000702 3300025931 Bacteria 21239
338 Ga0207644_10006395 3300025931 Bacteria 7674
339 Ga0207644_10022140 3300025931 Bacteria 4339
340 Ga0207644_10079634 3300025931 Bacteria 2417
341 Ga0207690_10083420 3300025932 Bacteria 2237
342 Ga0207706_10000785 3300025933 Bacteria 32843
343 Ga0207706_10002472 3300025933 Bacteria 18012
344 Ga0207706_10009798 3300025933 Bacteria 8792
345 Ga0207706_10029242 3300025933 Bacteria 4920
346 Ga0207706_10071324 3300025933 Bacteria 3055
347 Ga0207706_10222100 3300025933 Bacteria 1654
348 Ga0207709_10024323 3300025935 Bacteria 3457
349 Ga0207709_10084103 3300025935 Bacteria 2059
350 Ga0207709_10092757 3300025935 Bacteria 1978
351 Ga0207669_10006049 3300025937 Bacteria 5493
352 Ga0207691_10004143 3300025940 Bacteria 14086
353 Ga0207691_10006274 3300025940 Bacteria 11477
354 Ga0207691_10006813 3300025940 Bacteria 11017
355 Ga0207691_10024653 3300025940 Bacteria 5657
356 Ga0207691_10041479 3300025940 Bacteria 4249
357 Ga0207691_10064009 3300025940 Bacteria 3333
358 Ga0207691_10068356 3300025940 Bacteria 3209
359 Ga0207711_10003489 3300025941 Bacteria 13609
360 Ga0207711_10081286 3300025941 Bacteria 2832
361 Ga0207689_10003145 3300025942 Bacteria 15148
362 Ga0207689_10004853 3300025942 Bacteria 12116
363 Ga0207689_10128618 3300025942 Bacteria 2084
364 Ga0207661_10130877 3300025944 Bacteria 2149
365 Ga0207679_10002740 3300025945 Bacteria 10903
366 Ga0207679_10030714 3300025945 Bacteria 3754
367 Ga0207667_10166025 3300025949 Bacteria 2270
368 Ga0207667_10177118 3300025949 Bacteria 2190
369 Ga0207651_10012637 3300025960 Bacteria 4789
370 Ga0207651_10021615 3300025960 Bacteria 3914
371 Ga0207651_10052469 3300025960 Bacteria 2780
372 Ga0207651_10109749 3300025960 Bacteria 2068
373 Ga0207640_10046654 3300025981 Bacteria 2790
374 Ga0207658_10034070 3300025986 Bacteria 3636
375 Ga0207658_10044096 3300025986 Bacteria 3246
376 Ga0207677_10012167 3300026023 Bacteria 4935
377 Ga0207677_10043255 3300026023 Bacteria 2993
378 Ga0207703_10001799 3300026035 Bacteria 19132
379 Ga0207703_10102282 3300026035 Bacteria 2431
380 Ga0207678_10022471 3300026067 Bacteria 5523
381 Ga0207678_10084638 3300026067 Bacteria 2712
382 Ga0207678_10133698 3300026067 Bacteria 2116
383 Ga0207702_10001439 3300026078 Bacteria 23650
384 Ga0207702_10037385 3300026078 Bacteria 4063
385 Ga0207641_10028570 3300026088 Bacteria 4608
386 Ga0207641_10035620 3300026088 Bacteria 4148
387 Ga0207641_10082305 3300026088 Bacteria 2796
388 Ga0207648_10000515 3300026089 Bacteria 43207
389 Ga0207648_10003372 3300026089 Bacteria 16778
390 Ga0207648_10004667 3300026089 Bacteria 14019
391 Ga0207648_10030637 3300026089 Bacteria 4761
392 Ga0207648_10071567 3300026089 Bacteria 3022
393 Ga0207648_10084706 3300026089 Bacteria 2765
394 Ga0207676_10003245 3300026095 Bacteria 11579
395 Ga0207676_10005019 3300026095 Bacteria 9371
396 Ga0207676_10043889 3300026095 Bacteria 3445
397 Ga0207674_10006659 3300026116 Bacteria 13573
398 Ga0207674_10022384 3300026116 Bacteria 6786
399 Ga0207674_10057428 3300026116 Bacteria 3945
400 Ga0207674_10157952 3300026116 Bacteria 2222
401 Ga0207675_100004517 3300026118 Bacteria 13434
402 Ga0207675_100007314 3300026118 Bacteria 10439
403 Ga0207683_10006504 3300026121 Bacteria 10000
404 Ga0207683_10007125 3300026121 Bacteria 9584
405 Ga0207683_10008076 3300026121 Bacteria 9000
406 Ga0207683_10044995 3300026121 Bacteria 3859
407 Ga0207683_10055274 3300026121 Bacteria 3481
408 Ga0207683_10061343 3300026121 Bacteria 3309
409 Ga0207683_10122767 3300026121 Bacteria 2333
410 Ga0207698_10033832 3300026142 Bacteria 3718
411 Ga0207698_10073978 3300026142 Bacteria 2715
412 Ga0209281_1000195 3300027111 Bacteria 139144
413 Ga0209389_1042605 3300027296 Bacteria 3430
414 Ga0209968_1000109 3300027526 Bacteria 15068
415 Ga0209966_1000074 3300027695 Bacteria 43833
416 Ga0268265_10009273 3300028380 Bacteria 6652
417 Ga0268264_10012070 3300028381 Bacteria 7113
418 Ga0265336_10000325 3300028666 Bacteria 31959
419 Ga0307517_10002354 3300028786 Bacteria 30505
420 Ga0307517_10077719 3300028786 Bacteria 2880
421 Ga0307515_10000090 3300028794 Bacteria 215043
422 Ga0307515_10000165 3300028794 Bacteria 162589
423 Ga0307515_10000188 3300028794 Bacteria 151439
424 Ga0307515_10000889 3300028794 Bacteria 68865
425 Ga0307515_10012418 3300028794 Bacteria 16020
426 Ga0307515_10020693 3300028794 Bacteria 11719
427 Ga0307515_10049679 3300028794 Bacteria 6301
428 Ga0307515_10080551 3300028794 Bacteria 4244
429 Ga0307515_10097244 3300028794 Bacteria 3600
430 Ga0265324_10004959 3300029957 Bacteria 5852
431 Ga0307512_10056274 3300030522 Bacteria 3091
432 Ga0307512_10083573 3300030522 Bacteria 2275
433 Ga0265332_10000033 3300031238 Bacteria 153334
434 Ga0265328_10007975 3300031239 Bacteria 4391
435 Ga0265331_10024328 3300031250 Bacteria 3064
436 Ga0265327_10000328 3300031251 Bacteria 90489
437 Ga0265327_10001872 3300031251 Bacteria 24338
438 Ga0265316_10000456 3300031344 Bacteria 46381
439 Ga0307513_10000010 3300031456 Bacteria 360812
440 Ga0307513_10000120 3300031456 Bacteria 110390
441 Ga0307513_10004164 3300031456 Bacteria 19364
442 Ga0307513_10021976 3300031456 Bacteria 7515
443 Ga0307513_10137925 3300031456 Bacteria 2371
444 Ga0307509_10000234 3300031507 Bacteria 89398
445 Ga0307509_10038679 3300031507 Bacteria 5203
446 Ga0307509_10039607 3300031507 Bacteria 5132
447 Ga0307509_10090207 3300031507 Bacteria 3141
448 Ga0307408_100000008 3300031548 Bacteria 456355
449 Ga0307408_100006428 3300031548 Bacteria 7793
450 Ga0307508_10000007 3300031616 Bacteria 268359
451 Ga0307514_10001372 3300031649 Bacteria 30729
452 Ga0307514_10033870 3300031649 Bacteria 4073
453 Ga0307514_10052858 3300031649 Bacteria 3137
454 Ga0307516_10000678 3300031730 Bacteria 46164
455 Ga0307516_10003314 3300031730 Bacteria 20839
456 Ga0307516_10003708 3300031730 Bacteria 19431
457 Ga0307516_10004597 3300031730 Bacteria 16937
458 Ga0307516_10007334 3300031730 Bacteria 12692
459 Ga0307410_10040033 3300031852 Bacteria 3082
460 Ga0307410_10045174 3300031852 Bacteria 2931
461 Ga0307406_10039791 3300031901 Bacteria 2919
462 Ga0307407_10033554 3300031903 Bacteria 2802
463 Ga0307407_10036927 3300031903 Bacteria 2696
464 Ga0307409_100015946 3300031995 Bacteria 4952
465 Ga0307409_100050912 3300031995 Bacteria 3166
466 Ga0307416_100000708 3300032002 Bacteria 17322
467 Ga0307411_10000283 3300032005 Bacteria 16905
468 Ga0307507_10149169 3300033179 Bacteria 1766
469 Ga0307510_10012165 3300033180 Bacteria 10203
470 Ga0307510_10033672 3300033180 Bacteria 5750
471 Ga0373948_0001072 3300034817 Bacteria 3698
472 Ga0373950_0003524 3300034818 Bacteria 2241
473 Ga0373939_0000052 3300035114 Bacteria 40835
474 Ga0373960_0000046 3300035121 Bacteria 16294
475 Ga0373943_0008194 3300035170 Bacteria 4690
476 Ga0373931_0001666 3300035691 Bacteria 9620
477 Ga0373931_0017131 3300035691 Bacteria 3577
478 Ga0373937_0049472 3300036401 Bacteria 3849
479 Ga0373937_0122137 3300036401 Bacteria 2428
480 Ga0373925_0054284 3300037068 Bacteria 2997
481 Ga0373925_0139896 3300037068 Bacteria 1894
482 Ga0395905_0000140 3300037471 Bacteria 120221
483 Ga0395905_0003324 3300037471 Bacteria 17264
484 Ga0395905_0027913 3300037471 Bacteria 5321
485 Ga0395905_0145432 3300037471 Bacteria 2230
486 Ga0395901_0084843 3300038443 Bacteria 3310
487 Ga0436361_0082864 3300039447 Bacteria 107951
488 Ga0436361_0215868 3300039447 Bacteria 46672
489 Ga0436361_0388468 3300039447 Bacteria 28849
490 Ga0436361_0420292 3300039447 Bacteria 49111
491 Ga0436361_0614815 3300039447 Bacteria 45728
492 Ga0436361_0675147 3300039447 Bacteria 1843
493 Ga0436361_0948538 3300039447 Bacteria 4731
494 Ga0436361_1028338 3300039447 Bacteria 2650
495 Ga0439431_0002567 3300041997 Bacteria 4008
496 Ga0450917_000500 3300042120 Bacteria 2939
497 Ga0450920_002898 3300042122 Bacteria 2951
498 Ga0450923_007216 3300042125 Bacteria 1870
499 Ga0450918_001027 3300042531 Bacteria 5779
500 Ga0451577_0001120 3300042876 Bacteria 38005
501 Ga0451577_0004023 3300042876 Bacteria 15811
502 Ga0451577_0023485 3300042876 Bacteria 5623
503 Ga0451577_0043106 3300042876 Bacteria 4042
504 Ga0451577_0103668 3300042876 Bacteria 2542
505 Ga0466969_0000032 3300044656 Bacteria 84854
506 Ga0466969_0012838 3300044656 Bacteria 4414
507 Ga0466969_0018362 3300044656 Bacteria 3644
508 Ga0466969_0068966 3300044656 Bacteria 1703
509 Ga0466972_0001051 3300044658 Bacteria 13251
510 Ga0453683_0002249 3300044673 Bacteria 15251
511 Ga0453683_0009928 3300044673 Bacteria 6334
512 Ga0466965_0019307 3300044683 Bacteria 3273
513 Ga0466965_0022854 3300044683 Bacteria 3016
514 Ga0466966_0003784 3300044684 Bacteria 9979
515 Ga0466966_0004357 3300044684 Bacteria 9338
516 Ga0466961_0001522 3300044693 Bacteria 14370
517 Ga0466961_0015191 3300044693 Bacteria 4945
518 Ga0466961_0026411 3300044693 Bacteria 3733
519 Ga0466963_0000626 3300044694 Bacteria 16940
520 Ga0466964_0006814 3300044706 Bacteria 4262
521 Ga0466964_0010848 3300044706 Bacteria 3442
522 Ga0466964_0019646 3300044706 Bacteria 2598
523 Ga0453684_0034602 3300044712 Bacteria 7009
524 Ga0453684_0043169 3300044712 Bacteria 6064
525 Ga0453684_0043777 3300044712 Bacteria 6008
526 Ga0466968_0061618 3300044735 Bacteria 1619
527 Ga0466970_0031902 3300044765 Bacteria 2783
528 Ga0466959_0002236 3300045049 Bacteria 12331
529 Ga0466959_0012084 3300045049 Bacteria 6229
530 Ga0466959_0030982 3300045049 Bacteria 3959
531 Ga0466959_0064043 3300045049 Bacteria 2669
532 Ga0451576_0001324 3300045051 Bacteria 42824
533 Ga0451576_0004194 3300045051 Bacteria 18960
534 Ga0451576_0006910 3300045051 Bacteria 13739
535 Ga0451576_0012193 3300045051 Bacteria 9686
536 Ga0451576_0244981 3300045051 Bacteria 1873
537 Ga0466967_0043543 3300045976 Bacteria 3887
538 Ga0495592_0000291 3300046454 Bacteria 42990
539 Ga0495629_0102825 3300046459 Bacteria 1993
540 Ga0495638_0061427 3300046460 Bacteria 2322
541 Ga0495650_0002299 3300046471 Bacteria 15858
542 Ga0495650_0005641 3300046471 Bacteria 8048
543 Ga0495580_0027205 3300046472 Bacteria 4162
544 Ga0495583_0000866 3300046506 Bacteria 36795
545 Ga0495606_0005178 3300046507 Bacteria 12612
546 Ga0495610_0032511 3300046512 Bacteria 2708
547 Ga0495632_0002939 3300046519 Bacteria 12506
548 Ga0495632_0006200 3300046519 Bacteria 7737
549 Ga0495632_0017590 3300046519 Bacteria 3941
550 Ga0495632_0026581 3300046519 Bacteria 3045
551 Ga0495643_0051132 3300046522 Bacteria 2223
552 Ga0495666_0021091 3300046526 Bacteria 3226
553 Ga0495621_0000480 3300046539 Bacteria 9830
554 Ga0495621_0015320 3300046539 Bacteria 2443
555 Ga0495597_0002676 3300046542 Bacteria 11024
556 Ga0495597_0003922 3300046542 Bacteria 8402
557 Ga0495622_0025296 3300046557 Bacteria 2773
558 Ga0495625_0010491 3300046660 Bacteria 7660
559 Ga0495625_0066257 3300046660 Bacteria 2544
560 Ga0495658_0004142 3300046683 Bacteria 7144
561 Ga0495658_0004796 3300046683 Bacteria 6631
562 Ga0495613_0086040 3300046689 Bacteria 2280
563 Ga0495624_0056474 3300046690 Bacteria 2470
564 Ga0495649_0004080 3300046694 Bacteria 9608
565 Ga0495649_0007820 3300046694 Bacteria 6477
566 Ga0495660_0028224 3300046810 Bacteria 3172
567 Ga0495676_0061088 3300047321 Bacteria 2949
568 Ga0495687_000367 3300047443 Bacteria 56387
569 Ga0495686_0080608 3300047472 Bacteria 1989
570 Ga0496102_0008877 3300048905 Bacteria 8627
571 Ga0496102_0024537 3300048905 Bacteria 5362
572 Ga0496104_0110012 3300048907 Bacteria 2641
573 Ga0496106_0029413 3300048909 Bacteria 4094
574 Ga0496107_0030805 3300048910 Bacteria 3825
575 Ga0496108_0145926 3300048911 Bacteria 2040
576 Ga0496109_0020125 3300048912 Bacteria 5895
577 Ga0496110_0002606 3300048913 Bacteria 13565
578 Ga0496110_0040140 3300048913 Bacteria 4079
579 Ga0496112_0008913 3300048915 Bacteria 9004
580 Ga0496112_0101626 3300048915 Bacteria 2845
581 Ga0496113_0148710 3300048916 Bacteria 1847
582 Ga0496114_0007954 3300048917 Bacteria 8390
583 Ga0496114_0061805 3300048917 Bacteria 3134
584 Ga0496124_0000786 3300048927 Bacteria 51804
585 Ga0496125_0103222 3300048928 Bacteria 2093
586 Ga0501043_0000149 3300049579 Bacteria 65122
587 Ga0501046_0000092 3300049580 Bacteria 97456
588 Ga0501047_0000028 3300049581 Bacteria 220279
589 Ga0501267_000143 3300049764 Bacteria 4620
590 Ga0501045_0000170 3300049824 Bacteria 35617
591 nmdc:mga03683_17797_c1 3300050489 Bacteria 2694
592 nmdc:mga00v17_10380_c1 3300050491 Bacteria 5082
593 nmdc:mga0k408_11251_c1 3300050493 Bacteria 4865
594 nmdc:mga0k408_2308_c1 3300050493 Bacteria 10151
595 nmdc:mga0k408_27898_c1 3300050493 Bacteria 3209
596 nmdc:mga0k408_28957_c1 3300050493 Bacteria 3151
597 nmdc:mga0k408_355_c1 3300050493 Bacteria 25188
598 nmdc:mga0k408_4782_c1 3300050493 Bacteria 7179
599 nmdc:mga04h51_2722_c1 3300050495 Bacteria 4209
600 nmdc:mga07m45_10918_c1 3300050496 Bacteria 4758
601 nmdc:mga07m45_2223_c1 3300050496 Bacteria 9067
602 nmdc:mga07m45_2314_c1 3300050496 Bacteria 8922
603 nmdc:mga07m45_27823_c1 3300050496 Bacteria 3118
604 nmdc:mga07m45_6961_c1 3300050496 Bacteria 5751
605 nmdc:mga07m45_7357_c1 3300050496 Bacteria 5622
606 nmdc:mga07m45_875_c1 3300050496 Bacteria 13121
607 nmdc:mga09592_4802_c1 3300050508 Bacteria 10952
608 Ga0500635_0000055 3300053080 Bacteria 74107
609 Ga0495619_0041711 3300053085 Bacteria 3003
610 Ga0500578_0000213 3300053086 Bacteria 71211
611 Ga0500646_0000779 3300053090 Bacteria 8971
612 Ga0500651_0005106 3300053093 Bacteria 7465
613 Ga0500651_0048860 3300053093 Bacteria 2658
614 Ga0500569_010492 3300053109 Bacteria 2185
615 Ga0500593_000309 3300053117 Bacteria 19752
616 Ga0500593_000591 3300053117 Bacteria 13928
617 Ga0500594_0000924 3300053118 Bacteria 6308
618 Ga0500628_006632 3300053129 Bacteria 1963
619 Ga0500652_001388 3300053131 Bacteria 7550
620 Ga0500652_053066 3300053131 Bacteria 1658
621 Ga0500658_0002097 3300053134 Bacteria 7754
622 Ga0500559_0002828 3300053136 Bacteria 8765
623 Ga0500559_0020641 3300053136 Bacteria 2786
624 Ga0500568_0005734 3300053139 Bacteria 6362
625 Ga0500604_0005981 3300053151 Bacteria 3212
626 Ga0500619_000067 3300053154 Bacteria 31547
627 Ga0500622_0000631 3300053156 Bacteria 31645
628 Ga0500622_0001490 3300053156 Bacteria 18621
629 Ga0500645_000436 3300053730 Bacteria 28554
630 Ga0500645_002698 3300053730 Bacteria 7711
631 Ga0500645_003651 3300053730 Bacteria 6154
632 Ga0500587_000100 3300053739 Bacteria 7588
633 Ga0500587_002115 3300053739 Bacteria 2836
634 Ga0590071_001924 3300059421 Bacteria 5316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10133698 Ga0207678_101336982 402
2 3300025907 Ga0207645_10036572 Ga0207645_100365723 406
3 3300044735 Ga0466968_0061618 Ga0466968_0061618_262_1602 437
4 3300031548 Ga0307408_100000008 Ga0307408_10000000849 445
5 3300003322 rootL2_10029717 rootL2_100297178 447
6 3300031250 Ga0265331_10024328 Ga0265331_100243283 459
7 3300031251 Ga0265327_10000328 Ga0265327_1000032846 459
8 3300046471 Ga0495650_0002299 Ga0495650_0002299_9643_11145 459
9 3300025907 Ga0207645_10022159 Ga0207645_100221593 464
10 3300044712 Ga0453684_0034602 Ga0453684_0034602_3033_4562 466
11 3300025925 Ga0207650_10100198 Ga0207650_101001982 468
12 3300025940 Ga0207691_10068356 Ga0207691_100683563 468
13 3300021361 Ga0213872_10000458 Ga0213872_1000045821 470
14 3300039447 Ga0436361_0420292 Ga0436361_0420292_25475_27043 470
15 3300005457 Ga0070662_100025849 Ga0070662_1000258493 474
16 3300025933 Ga0207706_10000785 Ga0207706_1000078520 474
17 3300042876 Ga0451577_0103668 Ga0451577_0103668_687_2189 474
18 3300046472 Ga0495580_0027205 Ga0495580_0027205_77_1537 474
19 3300003752 Ga0055539_1001240 Ga0055539_10012406 475
20 3300003756 Ga0055533_1000172 Ga0055533_100017253 475
21 3300005355 Ga0070671_100025386 Ga0070671_1000253863 475
22 3300005456 Ga0070678_100015381 Ga0070678_1000153814 475
23 3300005563 Ga0068855_100030962 Ga0068855_1000309626 475
24 3300005719 Ga0068861_100106503 Ga0068861_1001065031 475
25 3300006195 Ga0075366_10063715 Ga0075366_100637152 475
26 3300006353 Ga0075370_10009953 Ga0075370_100099535 475
27 3300013308 Ga0157375_10099480 Ga0157375_100994802 475
28 3300025226 Ga0209674_100088 Ga0209674_1000881 475
29 3300025230 Ga0209563_100160 Ga0209563_1001601 475
30 3300025231 Ga0207427_100296 Ga0207427_1002961 475
31 3300025253 Ga0209677_100162 Ga0209677_1001621 475
32 3300025893 Ga0207682_10015574 Ga0207682_100155743 475
33 3300025913 Ga0207695_10010519 Ga0207695_1001051910 475
34 3300025913 Ga0207695_10179493 Ga0207695_101794931 475
35 3300025914 Ga0207671_10001232 Ga0207671_1000123211 475
36 3300025949 Ga0207667_10177118 Ga0207667_101771182 475
37 3300026121 Ga0207683_10055274 Ga0207683_100552742 475
38 3300028666 Ga0265336_10000325 Ga0265336_1000032528 475
39 3300029957 Ga0265324_10004959 Ga0265324_100049591 475
40 3300031730 Ga0307516_10003708 Ga0307516_1000370822 475
41 3300039447 Ga0436361_0614815 Ga0436361_0614815_24209_25666 475
42 3300005339 Ga0070660_100033296 Ga0070660_1000332963 476
43 3300005364 Ga0070673_100061796 Ga0070673_1000617962 476
44 3300005459 Ga0068867_100079502 Ga0068867_1000795022 476
45 3300005535 Ga0070684_100062895 Ga0070684_1000628953 476
46 3300005577 Ga0068857_100157822 Ga0068857_1001578221 476
47 3300025919 Ga0207657_10046733 Ga0207657_100467334 476
48 3300025960 Ga0207651_10012637 Ga0207651_100126373 476
49 3300025960 Ga0207651_10109749 Ga0207651_101097491 476
50 3300026116 Ga0207674_10057428 Ga0207674_100574283 476
51 3300039447 Ga0436361_0215868 Ga0436361_0215868_37202_38740 476
52 3300046539 Ga0495621_0000480 Ga0495621_0000480_8047_9606 476
53 3300046539 Ga0495621_0015320 Ga0495621_0015320_872_2431 476
54 3300059421 Ga0590071_001924 Ga0590071_001924_3416_5035 476
55 3300046526 Ga0495666_0021091 Ga0495666_0021091_37_1497 477
56 iso_pu_bacteria 2643221646 2644258749 477
57 iso_pu_bacteria 2643221544 2643742846 478
58 iso_pu_bacteria 2643221585 2643933316 478
59 iso_pu_bacteria 2643221639 2644217520 478
60 iso_pu_bacteria 2643221656 2644314565 478
61 iso_pu_bacteria 2738541337 2739055506 478
62 3300048917 Ga0496114_0007954 Ga0496114_0007954_4860_6350 479
63 3300006353 Ga0075370_10002840 Ga0075370_100028407 480
64 3300009093 Ga0105240_10008979 Ga0105240_100089795 480
65 3300009545 Ga0105237_10000977 Ga0105237_1000097734 480
66 3300009551 Ga0105238_10001620 Ga0105238_100016208 480
67 3300010375 Ga0105239_10001185 Ga0105239_1000118526 480
68 3300034817 Ga0373948_0001072 Ga0373948_0001072_1748_3238 480
69 3300034818 Ga0373950_0003524 Ga0373950_0003524_419_1909 480
70 3300035114 Ga0373939_0000052 Ga0373939_0000052_30853_32343 480
71 3300035121 Ga0373960_0000046 Ga0373960_0000046_13481_14971 480
72 3300035691 Ga0373931_0001666 Ga0373931_0001666_5932_7422 480
73 3300037471 Ga0395905_0003324 Ga0395905_0003324_11519_13009 480
74 3300049764 Ga0501267_000143 Ga0501267_000143_1045_2535 480
75 3300050496 nmdc:mga07m45_875_c1 nmdc:mga07m45_875_c1_7118_8608 480
76 3300003794 Ga0055531_10000168 Ga0055531_1000016861 481
77 3300006195 Ga0075366_10003352 Ga0075366_100033525 481
78 3300006195 Ga0075366_10004000 Ga0075366_100040006 481
79 3300021361 Ga0213872_10019477 Ga0213872_100194773 481
80 3300025298 Ga0209050_1014289 Ga0209050_10142893 481
81 3300025303 Ga0209051_1013338 Ga0209051_10133383 481
82 3300025304 Ga0209257_1000021 Ga0209257_1000021290 481
83 3300028794 Ga0307515_10097244 Ga0307515_100972443 481
84 3300039447 Ga0436361_0948538 Ga0436361_0948538_1054_2613 481
85 3300039447 Ga0436361_1028338 Ga0436361_1028338_725_2293 481
86 3300042120 Ga0450917_000500 Ga0450917_000500_668_2161 481
87 3300044712 Ga0453684_0043169 Ga0453684_0043169_4319_5842 481
88 3300050493 nmdc:mga0k408_355_c1 nmdc:mga0k408_355_c1_4933_6459 481
89 3300053086 Ga0500578_0000213 Ga0500578_0000213_30752_32263 481
90 3300003322 rootL2_10150743 rootL2_101507432 482
91 3300005455 Ga0070663_100032881 Ga0070663_1000328814 482
92 3300009148 Ga0105243_10002157 Ga0105243_100021579 482
93 3300014745 Ga0157377_10000016 Ga0157377_10000016176 482
94 3300014968 Ga0157379_10028002 Ga0157379_100280023 482
95 3300021361 Ga0213872_10000006 Ga0213872_10000006196 482
96 3300021361 Ga0213872_10000102 Ga0213872_1000010255 482
97 3300025926 Ga0207659_10005363 Ga0207659_100053633 482
98 3300026067 Ga0207678_10084638 Ga0207678_100846382 482
99 3300030522 Ga0307512_10083573 Ga0307512_100835732 482
100 3300031507 Ga0307509_10000234 Ga0307509_1000023435 482
101 3300033180 Ga0307510_10012165 Ga0307510_100121656 482
102 3300044712 Ga0453684_0043777 Ga0453684_0043777_3718_5217 482
103 3300046519 Ga0495632_0026581 Ga0495632_0026581_1082_2581 482
104 3300049579 Ga0501043_0000149 Ga0501043_0000149_55426_56973 482
105 3300049580 Ga0501046_0000092 Ga0501046_0000092_8286_9833 482
106 3300049581 Ga0501047_0000028 Ga0501047_0000028_163481_165028 482
107 3300049824 Ga0501045_0000170 Ga0501045_0000170_12657_14204 482
108 3300053156 Ga0500622_0001490 Ga0500622_0001490_12401_13894 482
109 iso_pu_bacteria 2643221654 2644303979 482
110 3300003215 JGI25153J46596_10004040 JGI25153J46596_100040402 483
111 3300003759 Ga0055525_1000031 Ga0055525_1000031243 483
112 3300003775 Ga0055524_1000125 Ga0055524_100012515 483
113 3300003791 Ga0055530_10000470 Ga0055530_100004702 483
114 3300003792 Ga0055540_1000011 Ga0055540_100001165 483
115 3300005262 Ga0065165_1000967 Ga0065165_100096725 483
116 3300005328 Ga0070676_10006846 Ga0070676_100068465 483
117 3300005338 Ga0068868_100009443 Ga0068868_1000094434 483
118 3300005353 Ga0070669_100042130 Ga0070669_1000421303 483
119 3300005355 Ga0070671_100032256 Ga0070671_1000322563 483
120 3300005356 Ga0070674_100005318 Ga0070674_1000053183 483
121 3300005459 Ga0068867_100000249 Ga0068867_10000024919 483
122 3300006195 Ga0075366_10012500 Ga0075366_100125004 483
123 3300006353 Ga0075370_10002533 Ga0075370_100025333 483
124 3300006353 Ga0075370_10070806 Ga0075370_100708061 483
125 3300006946 Ga0079104_1000465 Ga0079104_100046510 483
126 3300009098 Ga0105245_10028195 Ga0105245_100281953 483
127 3300014968 Ga0157379_10171980 Ga0157379_101719802 483
128 3300025291 Ga0209675_1006741 Ga0209675_10067412 483
129 3300025298 Ga0209050_1000303 Ga0209050_100030393 483
130 3300025298 Ga0209050_1000532 Ga0209050_100053212 483
131 3300025298 Ga0209050_1002916 Ga0209050_10029164 483
132 3300025299 Ga0209256_1000113 Ga0209256_100011383 483
133 3300025303 Ga0209051_1000020 Ga0209051_100002064 483
134 3300025303 Ga0209051_1013557 Ga0209051_10135572 483
135 3300025304 Ga0209257_1000085 Ga0209257_100008564 483
136 3300025935 Ga0207709_10024323 Ga0207709_100243232 483
137 3300026089 Ga0207648_10000515 Ga0207648_1000051539 483
138 3300027111 Ga0209281_1000195 Ga0209281_100019539 483
139 3300028786 Ga0307517_10002354 Ga0307517_1000235412 483
140 3300028786 Ga0307517_10077719 Ga0307517_100777192 483
141 3300028794 Ga0307515_10080551 Ga0307515_100805512 483
142 3300031456 Ga0307513_10137925 Ga0307513_101379252 483
143 3300031507 Ga0307509_10038679 Ga0307509_100386792 483
144 3300031507 Ga0307509_10039607 Ga0307509_100396073 483
145 3300031649 Ga0307514_10033870 Ga0307514_100338705 483
146 3300031649 Ga0307514_10052858 Ga0307514_100528583 483
147 3300031852 Ga0307410_10045174 Ga0307410_100451742 483
148 3300031903 Ga0307407_10033554 Ga0307407_100335543 483
149 3300031995 Ga0307409_100015946 Ga0307409_1000159463 483
150 3300032005 Ga0307411_10000283 Ga0307411_1000028310 483
151 3300033180 Ga0307510_10033672 Ga0307510_100336724 483
152 3300044683 Ga0466965_0019307 Ga0466965_0019307_501_2003 483
153 3300046454 Ga0495592_0000291 Ga0495592_0000291_31076_32608 483
154 3300046460 Ga0495638_0061427 Ga0495638_0061427_49_1551 483
155 3300046519 Ga0495632_0002939 Ga0495632_0002939_9505_11007 483
156 3300046557 Ga0495622_0025296 Ga0495622_0025296_528_2060 483
157 3300046683 Ga0495658_0004796 Ga0495658_0004796_3104_4636 483
158 3300046690 Ga0495624_0056474 Ga0495624_0056474_825_2357 483
159 3300047321 Ga0495676_0061088 Ga0495676_0061088_1266_2798 483
160 3300048928 Ga0496125_0103222 Ga0496125_0103222_125_1657 483
161 3300050489 nmdc:mga03683_17797_c1 nmdc:mga03683_17797_c1_511_2013 483
162 3300050493 nmdc:mga0k408_4782_c1 nmdc:mga0k408_4782_c1_3673_5175 483
163 3300050496 nmdc:mga07m45_27823_c1 nmdc:mga07m45_27823_c1_660_2192 483
164 3300053090 Ga0500646_0000779 Ga0500646_0000779_3051_4553 483
165 3300053109 Ga0500569_010492 Ga0500569_010492_101_1603 483
166 3300053118 Ga0500594_0000924 Ga0500594_0000924_3386_4918 483
167 3300053131 Ga0500652_001388 Ga0500652_001388_335_1837 483
168 3300053131 Ga0500652_053066 Ga0500652_053066_95_1627 483
169 3300053136 Ga0500559_0002828 Ga0500559_0002828_660_2192 483
170 3300053151 Ga0500604_0005981 Ga0500604_0005981_315_1817 483
171 3300053156 Ga0500622_0000631 Ga0500622_0000631_5155_6657 483
172 3300053739 Ga0500587_002115 Ga0500587_002115_778_2310 483
173 iso_pu_bacteria 2585428057 2587724867 483
174 iso_pu_bacteria 2585428058 2587736726 483
175 iso_pu_bacteria 2588253510 2588295336 483
176 iso_pu_bacteria 2643221592 2643970208 483
177 iso_pu_bacteria 2643221625 2644142394 483
178 iso_pu_bacteria 2643221648 2644275140 483
179 iso_pu_bacteria 2831864461 2831865514 483
180 3300005367 Ga0070667_100003099 Ga0070667_1000030998 484
181 3300005563 Ga0068855_100014551 Ga0068855_1000145515 484
182 3300025986 Ga0207658_10044096 Ga0207658_100440963 484
183 3300028794 Ga0307515_10000188 Ga0307515_10000188105 484
184 3300033179 Ga0307507_10149169 Ga0307507_101491692 484
185 3300037471 Ga0395905_0027913 Ga0395905_0027913_3439_4941 484
186 iso_pu_bacteria 2585428062 2587755606 484
187 3300005328 Ga0070676_10031112 Ga0070676_100311123 485
188 3300005331 Ga0070670_100016141 Ga0070670_1000161413 485
189 3300005334 Ga0068869_100009386 Ga0068869_1000093865 485
190 3300005338 Ga0068868_100035076 Ga0068868_1000350763 485
191 3300005355 Ga0070671_100050555 Ga0070671_1000505552 485
192 3300005459 Ga0068867_100013331 Ga0068867_1000133315 485
193 3300009148 Ga0105243_10020375 Ga0105243_100203754 485
194 3300025927 Ga0207687_10033819 Ga0207687_100338193 485
195 3300027526 Ga0209968_1000109 Ga0209968_100010910 485
196 3300027695 Ga0209966_1000074 Ga0209966_10000744 485
197 3300028794 Ga0307515_10000090 Ga0307515_10000090140 485
198 3300028794 Ga0307515_10000165 Ga0307515_10000165107 485
199 3300028794 Ga0307515_10000889 Ga0307515_1000088961 485
200 3300028794 Ga0307515_10049679 Ga0307515_100496794 485
201 3300030522 Ga0307512_10056274 Ga0307512_100562743 485
202 3300031239 Ga0265328_10007975 Ga0265328_100079752 485
203 3300031251 Ga0265327_10001872 Ga0265327_1000187215 485
204 3300031456 Ga0307513_10004164 Ga0307513_100041643 485
205 3300031616 Ga0307508_10000007 Ga0307508_1000000723 485
206 3300037471 Ga0395905_0000140 Ga0395905_0000140_39031_40590 485
207 3300044656 Ga0466969_0068966 Ga0466969_0068966_157_1665 485
208 3300044684 Ga0466966_0004357 Ga0466966_0004357_7658_9166 485
209 3300044693 Ga0466961_0001522 Ga0466961_0001522_6034_7542 485
210 3300044694 Ga0466963_0000626 Ga0466963_0000626_4060_5568 485
211 3300044706 Ga0466964_0006814 Ga0466964_0006814_214_1722 485
212 3300045049 Ga0466959_0002236 Ga0466959_0002236_10785_12293 485
213 3300045051 Ga0451576_0012193 Ga0451576_0012193_6656_8164 485
214 3300045976 Ga0466967_0043543 Ga0466967_0043543_977_2485 485
215 3300048913 Ga0496110_0040140 Ga0496110_0040140_2420_3982 485
216 3300048916 Ga0496113_0148710 Ga0496113_0148710_47_1579 485
217 3300002705 JGI25156J39149_1000220 JGI25156J39149_10002202 486
218 3300002738 JGI25154J39366_1003097 JGI25154J39366_10030972 486
219 3300002741 JGI25157J39369_1000135 JGI25157J39369_100013556 486
220 3300003320 rootH2_10107905 rootH2_101079051 486
221 3300003323 rootH1_10002882 rootH1_100028822 486
222 3300003323 rootH1_10044884 rootH1_100448846 486
223 3300003752 Ga0055539_1003715 Ga0055539_10037152 486
224 3300003761 Ga0055535_1000641 Ga0055535_10006411 486
225 3300003763 Ga0055529_1000602 Ga0055529_100060227 486
226 3300005331 Ga0070670_100002757 Ga0070670_1000027576 486
227 3300005335 Ga0070666_10001889 Ga0070666_100018893 486
228 3300005338 Ga0068868_100018937 Ga0068868_1000189373 486
229 3300005344 Ga0070661_100005430 Ga0070661_1000054303 486
230 3300005347 Ga0070668_100106439 Ga0070668_1001064392 486
231 3300005354 Ga0070675_100002630 Ga0070675_1000026303 486
232 3300005354 Ga0070675_100013570 Ga0070675_1000135704 486
233 3300005355 Ga0070671_100087272 Ga0070671_1000872723 486
234 3300005364 Ga0070673_100011474 Ga0070673_1000114742 486
235 3300005366 Ga0070659_100076260 Ga0070659_1000762602 486
236 3300005367 Ga0070667_100016360 Ga0070667_1000163605 486
237 3300005456 Ga0070678_100001686 Ga0070678_1000016863 486
238 3300005456 Ga0070678_100002569 Ga0070678_1000025696 486
239 3300005456 Ga0070678_100088955 Ga0070678_1000889551 486
240 3300005543 Ga0070672_100028249 Ga0070672_1000282493 486
241 3300005563 Ga0068855_100256732 Ga0068855_1002567322 486
242 3300005564 Ga0070664_100008373 Ga0070664_1000083732 486
243 3300005564 Ga0070664_100129894 Ga0070664_1001298941 486
244 3300005616 Ga0068852_100039272 Ga0068852_1000392723 486
245 3300005616 Ga0068852_100071257 Ga0068852_1000712573 486
246 3300005617 Ga0068859_100010856 Ga0068859_1000108564 486
247 3300005618 Ga0068864_100006324 Ga0068864_1000063244 486
248 3300005618 Ga0068864_100015252 Ga0068864_1000152525 486
249 3300005842 Ga0068858_100002892 Ga0068858_1000028926 486
250 3300005843 Ga0068860_100082137 Ga0068860_1000821372 486
251 3300005844 Ga0068862_100175189 Ga0068862_1001751892 486
252 3300006237 Ga0097621_100015499 Ga0097621_1000154992 486
253 3300006358 Ga0068871_100015209 Ga0068871_1000152093 486
254 3300006931 Ga0097620_100010856 Ga0097620_1000108564 486
255 3300009093 Ga0105240_10040846 Ga0105240_100408461 486
256 3300009093 Ga0105240_10042069 Ga0105240_100420691 486
257 3300009174 Ga0105241_10055820 Ga0105241_100558203 486
258 3300009551 Ga0105238_10080804 Ga0105238_100808043 486
259 3300010375 Ga0105239_10068079 Ga0105239_100680792 486
260 3300013296 Ga0157374_10089315 Ga0157374_100893152 486
261 3300013297 Ga0157378_10083568 Ga0157378_100835683 486
262 3300013306 Ga0163162_10035901 Ga0163162_100359012 486
263 3300013308 Ga0157375_10094817 Ga0157375_100948172 486
264 3300013308 Ga0157375_10180548 Ga0157375_101805482 486
265 3300014325 Ga0163163_10001922 Ga0163163_1000192216 486
266 3300014326 Ga0157380_10030112 Ga0157380_100301123 486
267 3300014968 Ga0157379_10018753 Ga0157379_100187535 486
268 3300014969 Ga0157376_10080035 Ga0157376_100800353 486
269 3300021361 Ga0213872_10006588 Ga0213872_100065886 486
270 3300025230 Ga0209563_100044 Ga0209563_100044312 486
271 3300025242 Ga0209258_100630 Ga0209258_1006302 486
272 3300025242 Ga0209258_100869 Ga0209258_10086916 486
273 3300025246 Ga0209646_1000214 Ga0209646_10002142 486
274 3300025250 Ga0209026_1000059 Ga0209026_1000059203 486
275 3300025253 Ga0209677_100226 Ga0209677_10022635 486
276 3300025254 Ga0209148_1001657 Ga0209148_10016577 486
277 3300025256 Ga0209759_1000365 Ga0209759_10003652 486
278 3300025272 Ga0209455_1000508 Ga0209455_10005082 486
279 3300025908 Ga0207643_10038616 Ga0207643_100386162 486
280 3300025913 Ga0207695_10008251 Ga0207695_100082512 486
281 3300025914 Ga0207671_10028129 Ga0207671_100281292 486
282 3300025925 Ga0207650_10004499 Ga0207650_100044997 486
283 3300025926 Ga0207659_10024204 Ga0207659_100242043 486
284 3300025931 Ga0207644_10079634 Ga0207644_100796342 486
285 3300025932 Ga0207690_10083420 Ga0207690_100834202 486
286 3300025933 Ga0207706_10071324 Ga0207706_100713242 486
287 3300025933 Ga0207706_10222100 Ga0207706_102221001 486
288 3300025940 Ga0207691_10006813 Ga0207691_100068139 486
289 3300025940 Ga0207691_10024653 Ga0207691_100246534 486
290 3300025940 Ga0207691_10064009 Ga0207691_100640092 486
291 3300025944 Ga0207661_10130877 Ga0207661_101308772 486
292 3300025945 Ga0207679_10002740 Ga0207679_100027406 486
293 3300025960 Ga0207651_10021615 Ga0207651_100216153 486
294 3300025981 Ga0207640_10046654 Ga0207640_100466542 486
295 3300026023 Ga0207677_10012167 Ga0207677_100121673 486
296 3300026067 Ga0207678_10022471 Ga0207678_100224713 486
297 3300026078 Ga0207702_10001439 Ga0207702_1000143924 486
298 3300026088 Ga0207641_10028570 Ga0207641_100285703 486
299 3300026095 Ga0207676_10003245 Ga0207676_100032457 486
300 3300026095 Ga0207676_10005019 Ga0207676_100050198 486
301 3300026095 Ga0207676_10043889 Ga0207676_100438893 486
302 3300026116 Ga0207674_10157952 Ga0207674_101579522 486
303 3300026121 Ga0207683_10006504 Ga0207683_100065046 486
304 3300026121 Ga0207683_10007125 Ga0207683_100071252 486
305 3300026121 Ga0207683_10044995 Ga0207683_100449952 486
306 3300026121 Ga0207683_10122767 Ga0207683_101227672 486
307 3300026142 Ga0207698_10073978 Ga0207698_100739783 486
308 3300036401 Ga0373937_0122137 Ga0373937_0122137_491_2020 486
309 3300037068 Ga0373925_0054284 Ga0373925_0054284_1036_2565 486
310 3300037068 Ga0373925_0139896 Ga0373925_0139896_72_1607 486
311 3300038443 Ga0395901_0084843 Ga0395901_0084843_248_1750 486
312 3300039447 Ga0436361_0675147 Ga0436361_0675147_281_1783 486
313 3300044656 Ga0466969_0000032 Ga0466969_0000032_64916_66427 486
314 3300044656 Ga0466969_0012838 Ga0466969_0012838_2863_4365 486
315 3300044656 Ga0466969_0018362 Ga0466969_0018362_571_2088 486
316 3300044658 Ga0466972_0001051 Ga0466972_0001051_1528_3045 486
317 3300044683 Ga0466965_0022854 Ga0466965_0022854_27_1529 486
318 3300044684 Ga0466966_0003784 Ga0466966_0003784_7943_9445 486
319 3300044693 Ga0466961_0015191 Ga0466961_0015191_3298_4815 486
320 3300044693 Ga0466961_0026411 Ga0466961_0026411_927_2438 486
321 3300044706 Ga0466964_0010848 Ga0466964_0010848_1714_3231 486
322 3300044706 Ga0466964_0019646 Ga0466964_0019646_1045_2547 486
323 3300044765 Ga0466970_0031902 Ga0466970_0031902_63_1565 486
324 3300045049 Ga0466959_0012084 Ga0466959_0012084_2071_3588 486
325 3300045049 Ga0466959_0030982 Ga0466959_0030982_1059_2570 486
326 3300045049 Ga0466959_0064043 Ga0466959_0064043_1002_2504 486
327 3300046471 Ga0495650_0005641 Ga0495650_0005641_5907_7409 486
328 3300046506 Ga0495583_0000866 Ga0495583_0000866_138_1640 486
329 3300046507 Ga0495606_0005178 Ga0495606_0005178_715_2217 486
330 3300046660 Ga0495625_0066257 Ga0495625_0066257_810_2312 486
331 3300046694 Ga0495649_0004080 Ga0495649_0004080_7929_9431 486
332 3300048911 Ga0496108_0145926 Ga0496108_0145926_134_1663 486
333 3300048917 Ga0496114_0061805 Ga0496114_0061805_1265_2800 486
334 3300050493 nmdc:mga0k408_28957_c1 nmdc:mga0k408_28957_c1_979_2481 486
335 3300050496 nmdc:mga07m45_2314_c1 nmdc:mga07m45_2314_c1_7171_8673 486
336 3300053085 Ga0495619_0041711 Ga0495619_0041711_291_1820 486
337 3300053093 Ga0500651_0048860 Ga0500651_0048860_847_2349 486
338 3300053136 Ga0500559_0020641 Ga0500559_0020641_623_2125 486
339 3300003322 rootL2_10001692 rootL2_1000169218 487
340 3300003323 rootH1_10033303 rootH1_100333038 487
341 3300003775 Ga0055524_1013413 Ga0055524_10134131 487
342 3300003792 Ga0055540_1015157 Ga0055540_10151572 487
343 3300003794 Ga0055531_10002564 Ga0055531_100025643 487
344 3300005262 Ga0065165_1000569 Ga0065165_100056943 487
345 3300005327 Ga0070658_10067036 Ga0070658_100670361 487
346 3300005327 Ga0070658_10132277 Ga0070658_101322772 487
347 3300005329 Ga0070683_100019870 Ga0070683_1000198703 487
348 3300005334 Ga0068869_100012836 Ga0068869_1000128362 487
349 3300005339 Ga0070660_100039589 Ga0070660_1000395892 487
350 3300005344 Ga0070661_100057373 Ga0070661_1000573733 487
351 3300005354 Ga0070675_100012854 Ga0070675_1000128542 487
352 3300005355 Ga0070671_100001183 Ga0070671_1000011839 487
353 3300005366 Ga0070659_100011766 Ga0070659_1000117663 487
354 3300005455 Ga0070663_100027938 Ga0070663_1000279383 487
355 3300005457 Ga0070662_100012262 Ga0070662_1000122626 487
356 3300005530 Ga0070679_100017226 Ga0070679_1000172265 487
357 3300005543 Ga0070672_100040042 Ga0070672_1000400423 487
358 3300005563 Ga0068855_100104465 Ga0068855_1001044653 487
359 3300005614 Ga0068856_100002754 Ga0068856_10000275411 487
360 3300005616 Ga0068852_100026667 Ga0068852_1000266673 487
361 3300005617 Ga0068859_100053491 Ga0068859_1000534913 487
362 3300005618 Ga0068864_100043880 Ga0068864_1000438802 487
363 3300005719 Ga0068861_100002723 Ga0068861_1000027233 487
364 3300005841 Ga0068863_100057193 Ga0068863_1000571933 487
365 3300005841 Ga0068863_100149623 Ga0068863_1001496232 487
366 3300005842 Ga0068858_100003275 Ga0068858_1000032759 487
367 3300005842 Ga0068858_100040827 Ga0068858_1000408273 487
368 3300005843 Ga0068860_100003813 Ga0068860_10000381310 487
369 3300006177 Ga0075362_10001909 Ga0075362_100019095 487
370 3300006178 Ga0075367_10076400 Ga0075367_100764002 487
371 3300006353 Ga0075370_10000059 Ga0075370_100000596 487
372 3300006353 Ga0075370_10000087 Ga0075370_100000874 487
373 3300006358 Ga0068871_100077351 Ga0068871_1000773512 487
374 3300006931 Ga0097620_100053491 Ga0097620_1000534913 487
375 3300006944 Ga0099823_1000031 Ga0099823_100003140 487
376 3300009098 Ga0105245_10010878 Ga0105245_100108782 487
377 3300009177 Ga0105248_10040747 Ga0105248_100407474 487
378 3300009545 Ga0105237_10054226 Ga0105237_100542262 487
379 3300009551 Ga0105238_10058411 Ga0105238_100584112 487
380 3300009551 Ga0105238_10058800 Ga0105238_100588003 487
381 3300012497 Ga0157319_1000016 Ga0157319_100001637 487
382 3300013105 Ga0157369_10017217 Ga0157369_100172173 487
383 3300013105 Ga0157369_10141816 Ga0157369_101418162 487
384 3300014325 Ga0163163_10030553 Ga0163163_100305533 487
385 3300014326 Ga0157380_10029033 Ga0157380_100290333 487
386 3300014968 Ga0157379_10010706 Ga0157379_100107065 487
387 3300014969 Ga0157376_10003522 Ga0157376_100035222 487
388 3300017792 Ga0163161_10027822 Ga0163161_100278224 487
389 3300025273 Ga0209673_1002426 Ga0209673_10024267 487
390 3300025273 Ga0209673_1004091 Ga0209673_10040912 487
391 3300025273 Ga0209673_1013525 Ga0209673_10135252 487
392 3300025295 Ga0209564_1000008 Ga0209564_1000008820 487
393 3300025299 Ga0209256_1000579 Ga0209256_100057926 487
394 3300025299 Ga0209256_1001555 Ga0209256_10015553 487
395 3300025303 Ga0209051_1002125 Ga0209051_100212514 487
396 3300025303 Ga0209051_1004657 Ga0209051_10046578 487
397 3300025303 Ga0209051_1018089 Ga0209051_10180894 487
398 3300025304 Ga0209257_1000984 Ga0209257_100098426 487
399 3300025304 Ga0209257_1002626 Ga0209257_10026261 487
400 3300025909 Ga0207705_10017825 Ga0207705_100178253 487
401 3300025917 Ga0207660_10055979 Ga0207660_100559792 487
402 3300025919 Ga0207657_10061183 Ga0207657_100611832 487
403 3300025921 Ga0207652_10003603 Ga0207652_1000360310 487
404 3300025924 Ga0207694_10051529 Ga0207694_100515293 487
405 3300025931 Ga0207644_10000702 Ga0207644_1000070215 487
406 3300025933 Ga0207706_10002472 Ga0207706_1000247210 487
407 3300025940 Ga0207691_10006274 Ga0207691_100062749 487
408 3300025941 Ga0207711_10003489 Ga0207711_1000348911 487
409 3300025941 Ga0207711_10081286 Ga0207711_100812862 487
410 3300025942 Ga0207689_10003145 Ga0207689_1000314510 487
411 3300025949 Ga0207667_10166025 Ga0207667_101660252 487
412 3300026035 Ga0207703_10102282 Ga0207703_101022822 487
413 3300026078 Ga0207702_10037385 Ga0207702_100373854 487
414 3300026088 Ga0207641_10035620 Ga0207641_100356203 487
415 3300026089 Ga0207648_10084706 Ga0207648_100847062 487
416 3300026118 Ga0207675_100004517 Ga0207675_1000045176 487
417 3300026121 Ga0207683_10061343 Ga0207683_100613432 487
418 3300026142 Ga0207698_10033832 Ga0207698_100338323 487
419 3300027296 Ga0209389_1042605 Ga0209389_10426052 487
420 3300028381 Ga0268264_10012070 Ga0268264_100120702 487
421 3300028794 Ga0307515_10012418 Ga0307515_1001241811 487
422 3300031456 Ga0307513_10021976 Ga0307513_100219765 487
423 3300031507 Ga0307509_10090207 Ga0307509_100902072 487
424 3300031730 Ga0307516_10000678 Ga0307516_1000067833 487
425 3300031852 Ga0307410_10040033 Ga0307410_100400332 487
426 3300031901 Ga0307406_10039791 Ga0307406_100397912 487
427 3300031903 Ga0307407_10036927 Ga0307407_100369272 487
428 3300031995 Ga0307409_100050912 Ga0307409_1000509123 487
429 3300032002 Ga0307416_100000708 Ga0307416_10000070817 487
430 3300035691 Ga0373931_0017131 Ga0373931_0017131_1274_2818 487
431 3300036401 Ga0373937_0049472 Ga0373937_0049472_293_1849 487
432 3300046459 Ga0495629_0102825 Ga0495629_0102825_428_1969 487
433 3300046519 Ga0495632_0006200 Ga0495632_0006200_4562_6103 487
434 3300046694 Ga0495649_0007820 Ga0495649_0007820_1019_2560 487
435 3300046810 Ga0495660_0028224 Ga0495660_0028224_1431_2972 487
436 3300048905 Ga0496102_0008877 Ga0496102_0008877_889_2418 487
437 3300048910 Ga0496107_0030805 Ga0496107_0030805_1522_3066 487
438 3300048912 Ga0496109_0020125 Ga0496109_0020125_3272_4816 487
439 3300048915 Ga0496112_0101626 Ga0496112_0101626_820_2364 487
440 3300050493 nmdc:mga0k408_2308_c1 nmdc:mga0k408_2308_c1_4937_6478 487
441 3300050493 nmdc:mga0k408_27898_c1 nmdc:mga0k408_27898_c1_226_1770 487
442 3300050495 nmdc:mga04h51_2722_c1 nmdc:mga04h51_2722_c1_712_2253 487
443 3300050496 nmdc:mga07m45_2223_c1 nmdc:mga07m45_2223_c1_3958_5499 487
444 3300053080 Ga0500635_0000055 Ga0500635_0000055_72357_73862 487
445 3300053134 Ga0500658_0002097 Ga0500658_0002097_3358_4899 487
446 3300053139 Ga0500568_0005734 Ga0500568_0005734_602_2143 487
447 3300053154 Ga0500619_000067 Ga0500619_000067_23255_24781 487
448 3300003316 rootH1_10028438 rootH1_100284381 488
449 3300005328 Ga0070676_10024703 Ga0070676_100247033 488
450 3300005331 Ga0070670_100200726 Ga0070670_1002007261 488
451 3300005334 Ga0068869_100044676 Ga0068869_1000446762 488
452 3300005335 Ga0070666_10004949 Ga0070666_100049498 488
453 3300005343 Ga0070687_100011716 Ga0070687_1000117163 488
454 3300005347 Ga0070668_100015572 Ga0070668_1000155725 488
455 3300005353 Ga0070669_100001532 Ga0070669_1000015325 488
456 3300005354 Ga0070675_100009918 Ga0070675_1000099183 488
457 3300005356 Ga0070674_100004750 Ga0070674_1000047505 488
458 3300005367 Ga0070667_100022100 Ga0070667_1000221002 488
459 3300005367 Ga0070667_100116953 Ga0070667_1001169532 488
460 3300005456 Ga0070678_100025559 Ga0070678_1000255592 488
461 3300005457 Ga0070662_100004089 Ga0070662_1000040895 488
462 3300005457 Ga0070662_100010527 Ga0070662_1000105273 488
463 3300005457 Ga0070662_100021663 Ga0070662_1000216633 488
464 3300005459 Ga0068867_100006301 Ga0068867_1000063011 488
465 3300005467 Ga0070706_100014174 Ga0070706_1000141743 488
466 3300005468 Ga0070707_100032795 Ga0070707_1000327954 488
467 3300005577 Ga0068857_100025706 Ga0068857_1000257063 488
468 3300005616 Ga0068852_100185946 Ga0068852_1001859462 488
469 3300005842 Ga0068858_100026496 Ga0068858_1000264965 488
470 3300005843 Ga0068860_100000445 Ga0068860_10000044548 488
471 3300006178 Ga0075367_10025078 Ga0075367_100250782 488
472 3300006195 Ga0075366_10047989 Ga0075366_100479892 488
473 3300006881 Ga0068865_100002093 Ga0068865_10000209310 488
474 3300009148 Ga0105243_10061281 Ga0105243_100612813 488
475 3300009148 Ga0105243_10116760 Ga0105243_101167602 488
476 3300009545 Ga0105237_10045864 Ga0105237_100458643 488
477 3300009553 Ga0105249_10019265 Ga0105249_100192654 488
478 3300010375 Ga0105239_10010208 Ga0105239_100102088 488
479 3300013306 Ga0163162_10040830 Ga0163162_100408303 488
480 3300013308 Ga0157375_10062518 Ga0157375_100625183 488
481 3300014326 Ga0157380_10069354 Ga0157380_100693543 488
482 3300017792 Ga0163161_10030998 Ga0163161_100309983 488
483 3300025893 Ga0207682_10023242 Ga0207682_100232421 488
484 3300025907 Ga0207645_10005113 Ga0207645_100051138 488
485 3300025910 Ga0207684_10012635 Ga0207684_100126354 488
486 3300025918 Ga0207662_10001761 Ga0207662_100017613 488
487 3300025923 Ga0207681_10002612 Ga0207681_1000261212 488
488 3300025933 Ga0207706_10009798 Ga0207706_100097983 488
489 3300025933 Ga0207706_10029242 Ga0207706_100292423 488
490 3300025935 Ga0207709_10092757 Ga0207709_100927572 488
491 3300025937 Ga0207669_10006049 Ga0207669_100060491 488
492 3300025942 Ga0207689_10004853 Ga0207689_100048539 488
493 3300025986 Ga0207658_10034070 Ga0207658_100340703 488
494 3300026023 Ga0207677_10043255 Ga0207677_100432553 488
495 3300026035 Ga0207703_10001799 Ga0207703_100017995 488
496 3300026088 Ga0207641_10082305 Ga0207641_100823052 488
497 3300026089 Ga0207648_10004667 Ga0207648_100046675 488
498 3300026116 Ga0207674_10022384 Ga0207674_100223843 488
499 3300026118 Ga0207675_100007314 Ga0207675_1000073149 488
500 3300028380 Ga0268265_10009273 Ga0268265_100092733 488
501 3300028794 Ga0307515_10020693 Ga0307515_1002069312 488
502 3300031730 Ga0307516_10004597 Ga0307516_100045974 488
503 3300031730 Ga0307516_10007334 Ga0307516_100073349 488
504 3300035170 Ga0373943_0008194 Ga0373943_0008194_2566_4104 488
505 3300042876 Ga0451577_0043106 Ga0451577_0043106_1830_3362 488
506 3300046512 Ga0495610_0032511 Ga0495610_0032511_830_2353 488
507 3300046519 Ga0495632_0017590 Ga0495632_0017590_1013_2536 488
508 3300046522 Ga0495643_0051132 Ga0495643_0051132_110_1633 488
509 3300046542 Ga0495597_0002676 Ga0495597_0002676_845_2326 488
510 3300046542 Ga0495597_0003922 Ga0495597_0003922_4340_5890 488
511 3300046660 Ga0495625_0010491 Ga0495625_0010491_1354_2877 488
512 3300046683 Ga0495658_0004142 Ga0495658_0004142_2526_4064 488
513 3300046689 Ga0495613_0086040 Ga0495613_0086040_106_1644 488
514 3300047443 Ga0495687_000367 Ga0495687_000367_48831_50381 488
515 3300047472 Ga0495686_0080608 Ga0495686_0080608_290_1813 488
516 3300048905 Ga0496102_0024537 Ga0496102_0024537_685_2211 488
517 3300048909 Ga0496106_0029413 Ga0496106_0029413_43_1581 488
518 3300048927 Ga0496124_0000786 Ga0496124_0000786_42531_44108 488
519 3300050491 nmdc:mga00v17_10380_c1 nmdc:mga00v17_10380_c1_2050_3600 488
520 3300050493 nmdc:mga0k408_11251_c1 nmdc:mga0k408_11251_c1_2485_4035 488
521 3300050496 nmdc:mga07m45_6961_c1 nmdc:mga07m45_6961_c1_3799_5349 488
522 3300050496 nmdc:mga07m45_7357_c1 nmdc:mga07m45_7357_c1_702_2237 488
523 3300053730 Ga0500645_003651 Ga0500645_003651_1270_2808 488
524 3300053739 Ga0500587_000100 Ga0500587_000100_1144_2667 488
525 3300003316 rootH1_10024035 rootH1_100240358 489
526 3300005353 Ga0070669_100019216 Ga0070669_1000192163 489
527 3300005354 Ga0070675_100004892 Ga0070675_1000048925 489
528 3300005355 Ga0070671_100007139 Ga0070671_1000071395 489
529 3300005364 Ga0070673_100086278 Ga0070673_1000862781 489
530 3300005456 Ga0070678_100051966 Ga0070678_1000519663 489
531 3300005459 Ga0068867_100005468 Ga0068867_1000054684 489
532 3300025315 Ga0207697_10014052 Ga0207697_100140523 489
533 3300025893 Ga0207682_10011915 Ga0207682_100119153 489
534 3300025923 Ga0207681_10009154 Ga0207681_100091544 489
535 3300025925 Ga0207650_10033157 Ga0207650_100331573 489
536 3300025926 Ga0207659_10001039 Ga0207659_100010399 489
537 3300025931 Ga0207644_10006395 Ga0207644_100063955 489
538 3300025940 Ga0207691_10041479 Ga0207691_100414793 489
539 3300025945 Ga0207679_10030714 Ga0207679_100307143 489
540 3300025960 Ga0207651_10052469 Ga0207651_100524692 489
541 3300026089 Ga0207648_10030637 Ga0207648_100306375 489
542 3300026121 Ga0207683_10008076 Ga0207683_100080763 489
543 3300031344 Ga0265316_10000456 Ga0265316_1000045628 489
544 3300031456 Ga0307513_10000010 Ga0307513_10000010347 489
545 3300031649 Ga0307514_10001372 Ga0307514_100013723 489
546 3300042876 Ga0451577_0004023 Ga0451577_0004023_1324_2841 489
547 3300045051 Ga0451576_0001324 Ga0451576_0001324_22434_23999 489
548 3300005355 Ga0070671_100009160 Ga0070671_1000091607 490
549 3300009177 Ga0105248_10001682 Ga0105248_1000168213 490
550 3300025297 Ga0209758_1000146 Ga0209758_100014622 490
551 3300025907 Ga0207645_10004810 Ga0207645_100048103 490
552 3300025931 Ga0207644_10022140 Ga0207644_100221404 490
553 3300026089 Ga0207648_10071567 Ga0207648_100715673 490
554 3300048915 Ga0496112_0008913 Ga0496112_0008913_518_2068 490
555 iso_pu_bacteria 2643221660 2644338795 490
556 3300005577 Ga0068857_100022930 Ga0068857_1000229305 491
557 3300006846 Ga0075430_100025785 Ga0075430_1000257853 491
558 3300006880 Ga0075429_100001289 Ga0075429_1000012893 491
559 3300021361 Ga0213872_10000049 Ga0213872_1000004943 491
560 3300025925 Ga0207650_10053437 Ga0207650_100534372 491
561 3300025927 Ga0207687_10060589 Ga0207687_100605892 491
562 3300025935 Ga0207709_10084103 Ga0207709_100841032 491
563 3300025940 Ga0207691_10004143 Ga0207691_100041432 491
564 3300025942 Ga0207689_10128618 Ga0207689_101286181 491
565 3300026089 Ga0207648_10003372 Ga0207648_100033727 491
566 3300026116 Ga0207674_10006659 Ga0207674_1000665913 491
567 3300039447 Ga0436361_0082864 Ga0436361_0082864_57235_58776 491
568 3300042876 Ga0451577_0001120 Ga0451577_0001120_8932_10464 491
569 3300048913 Ga0496110_0002606 Ga0496110_0002606_3329_4903 491
570 3300050508 nmdc:mga09592_4802_c1 nmdc:mga09592_4802_c1_6676_8211 491
571 iso_pu_bacteria 2881101125 2881103199 491
572 3300002773 JGI25152J39213_1005234 JGI25152J39213_10052342 492
573 3300003771 Ga0055526_1000280 Ga0055526_10002802 492
574 3300021361 Ga0213872_10006891 Ga0213872_100068914 492
575 3300025245 Ga0207425_1002035 Ga0207425_10020356 492
576 3300025258 Ga0209129_1000027 Ga0209129_100002746 492
577 3300025273 Ga0209673_1004494 Ga0209673_10044941 492
578 3300025295 Ga0209564_1000139 Ga0209564_100013937 492
579 3300025297 Ga0209758_1000052 Ga0209758_100005274 492
580 3300037471 Ga0395905_0145432 Ga0395905_0145432_52_1590 492
581 3300039447 Ga0436361_0388468 Ga0436361_0388468_7955_9433 492
582 3300041997 Ga0439431_0002567 Ga0439431_0002567_784_2310 492
583 3300045051 Ga0451576_0244981 Ga0451576_0244981_16_1569 492
584 3300048907 Ga0496104_0110012 Ga0496104_0110012_330_1889 492
585 iso_pu_bacteria 2904479285 2904480971 492
586 3300005364 Ga0070673_100118179 Ga0070673_1001181792 493
587 3300013296 Ga0157374_10010968 Ga0157374_100109689 493
588 3300044673 Ga0453683_0009928 Ga0453683_0009928_3559_5046 494
589 3300045051 Ga0451576_0004194 Ga0451576_0004194_3702_5189 494
590 iso_pu_bacteria 2643221644 2644248237 494
591 3300042122 Ga0450920_002898 Ga0450920_002898_1125_2690 495
592 3300042125 Ga0450923_007216 Ga0450923_007216_281_1846 495
593 3300042531 Ga0450918_001027 Ga0450918_001027_3592_5157 495
594 iso_pu_bacteria 2511231002 2511246094 495
595 3300042876 Ga0451577_0023485 Ga0451577_0023485_2932_4425 496
596 3300044673 Ga0453683_0002249 Ga0453683_0002249_5659_7152 496
597 3300045051 Ga0451576_0006910 Ga0451576_0006910_4862_6355 496
598 3300053093 Ga0500651_0005106 Ga0500651_0005106_4519_6009 496
599 3300053117 Ga0500593_000309 Ga0500593_000309_10599_12170 496
600 3300031730 Ga0307516_10003314 Ga0307516_1000331412 498
601 3300002987 JGI25159J45721_1000160 JGI25159J45721_100016014 499
602 3300002987 JGI25159J45721_1001766 JGI25159J45721_10017665 499
603 3300003354 JGI25160J50197_1000283 JGI25160J50197_100028332 499
604 3300003354 JGI25160J50197_1000291 JGI25160J50197_100029136 499
605 3300003374 JGI25161J50226_1000015 JGI25161J50226_100001536 499
606 3300003771 Ga0055526_1002747 Ga0055526_10027479 499
607 3300003771 Ga0055526_1002757 Ga0055526_10027579 499
608 3300003773 Ga0055537_1000353 Ga0055537_100035325 499
609 3300003775 Ga0055524_1000016 Ga0055524_1000016221 499
610 3300003775 Ga0055524_1000332 Ga0055524_100033214 499
611 3300003784 Ga0055534_1000758 Ga0055534_100075813 499
612 3300003790 Ga0055528_1000467 Ga0055528_10004676 499
613 3300003791 Ga0055530_10000506 Ga0055530_1000050626 499
614 3300003792 Ga0055540_1000144 Ga0055540_100014434 499
615 3300003794 Ga0055531_10001304 Ga0055531_1000130413 499
616 3300004625 Ga0055543_1000366 Ga0055543_100036615 499
617 3300025245 Ga0207425_1004948 Ga0207425_10049484 499
618 3300025256 Ga0209759_1015495 Ga0209759_10154951 499
619 3300025263 Ga0209565_1000004 Ga0209565_1000004178 499
620 3300025273 Ga0209673_1000045 Ga0209673_1000045194 499
621 3300025284 Ga0209130_1000413 Ga0209130_100041313 499
622 3300025291 Ga0209675_1000185 Ga0209675_100018529 499
623 3300025292 Ga0209676_1000007 Ga0209676_1000007730 499
624 3300025294 Ga0209025_1001312 Ga0209025_10013125 499
625 3300025294 Ga0209025_1012002 Ga0209025_10120026 499
626 3300025295 Ga0209564_1000962 Ga0209564_100096226 499
627 3300025295 Ga0209564_1001085 Ga0209564_100108523 499
628 3300025298 Ga0209050_1000003 Ga0209050_1000003778 499
629 3300025299 Ga0209256_1000001 Ga0209256_1000001790 499
630 3300025302 Ga0207426_1001465 Ga0207426_10014657 499
631 3300025303 Ga0209051_1000003 Ga0209051_1000003778 499
632 3300025304 Ga0209257_1000020 Ga0209257_1000020730 499
633 3300031238 Ga0265332_10000033 Ga0265332_1000003355 499
634 3300053730 Ga0500645_000436 Ga0500645_000436_2716_4215 499
635 3300053730 Ga0500645_002698 Ga0500645_002698_5324_6823 499
636 3300050496 nmdc:mga07m45_10918_c1 nmdc:mga07m45_10918_c1_1694_3334 502
637 3300031456 Ga0307513_10000120 Ga0307513_1000012096 514
638 3300002704 JGI25155J39150_1000049 JGI25155J39150_100004917 516
639 3300002705 JGI25156J39149_1000023 JGI25156J39149_1000023126 516
640 3300002705 JGI25156J39149_1000142 JGI25156J39149_100014222 516
641 3300002738 JGI25154J39366_1000036 JGI25154J39366_100003631 516
642 3300002741 JGI25157J39369_1000023 JGI25157J39369_1000023127 516
643 3300025206 Ga0209435_100001 Ga0209435_100001278 516
644 3300025246 Ga0209646_1000001 Ga0209646_1000001647 516
645 3300025250 Ga0209026_1000003 Ga0209026_1000003278 516
646 3300025256 Ga0209759_1000001 Ga0209759_1000001278 516
647 3300025284 Ga0209130_1000056 Ga0209130_1000056156 516
648 3300025297 Ga0209758_1006478 Ga0209758_10064786 516
649 3300025302 Ga0207426_1000025 Ga0207426_1000025166 516
650 3300031548 Ga0307408_100006428 Ga0307408_1000064283 516
651 3300053117 Ga0500593_000591 Ga0500593_000591_2585_4135 516
652 3300053129 Ga0500628_006632 Ga0500628_006632_278_1828 516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02541

Ppx-GppA

Ppx/GppA phosphatase family

25

311

0.97

PF21447

Ppx-GppA_III

Ppx/GppA phosphatase, domain III

322

490

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6z-assembly1.cif.gz_B structure of an e. coli exopolyphosphatase: insight into the processive hydrolysis of polyphosphate and its regulation 0.9102 24 513
6xb3-assembly7.cif.gz_N structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.9021 150 176
6xb3-assembly5.cif.gz_I structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8908 150 176
1u6z-assembly1.cif.gz_B structure of an e. coli exopolyphosphatase: insight into the processive hydrolysis of polyphosphate and its regulation 0.8908 24 513
3cer-assembly5.cif.gz_E crystal structure of the exopolyphosphatase-like protein q8g5j2. northeast structural genomics consortium target blr13 0.8846 22 322
ID Description Score Start End Superfamily
2floB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9714 24 127 3.30.420.40
2floD02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.965 128 307 3.30.420.150
2floD02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.9596 128 307 3.30.420.150
3mdqA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.919 22 135 3.30.420.40
af_P96374_2_133_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9132 22 135 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A3D0HER2-F1-model_v4 Ppx/GppA family phosphatase 0.9847 22 279 GO:0004309
GO:0006798
AF-A0A6N1X2S7-F1-model_v4 Ppx/GppA family phosphatase 0.9818 18 318 GO:0016462
AF-A0A519I708-F1-model_v4 deleted 0.9818 18 178
AF-A0A6N7D3X5-F1-model_v4 Exopolyphosphatase 0.9811 18 516 GO:0016462
AF-A0A5S3VSS5-F1-model_v4 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase 0.9809 57 147 GO:0008894
GO:0015949

Feature Viewer

pLDDT pTM Quality
91.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map