F472600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 272 | 650 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300025904|Ga0207647_10124748|Ga0207647_101247481 |
| Length | 213 |
| Sequence | MDRRISVIRCQSCSVQLISDNRAQRHQTMMTGEFSITIHMVSSLDGMIAKKDNSVSWFDTSHYYDKGVDGQDPQEFLKTIDCYVMGSKTYEHALELSKSYGWAYGDKPTIVLTSRNLASGKPNIEFYSDDLNKLVNERLKPNYKNVWVAGGAILTKEFIRQKLADEIRVSILPIILGEGILFFDNIGLEQTLHLADTTAYKNGMVELRYKIIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 262 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 263 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 264 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 265 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 266 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 267 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 269 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 0 |
| Rhizoplane | 1.69 |
| Rhizosphere | 89.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000668 | 3300001989 | Bacteria | 12354 |
| 2 | JGI25153J46596_10017468 | 3300003215 | Bacteria | 2825 |
| 3 | JGI25153J46596_10038746 | 3300003215 | Bacteria | 1498 |
| 4 | rootH1_10026419 | 3300003316 | Unclassified | 2918 |
| 5 | rootH1_10042500 | 3300003316 | Bacteria | 5575 |
| 6 | rootH1_10114680 | 3300003316 | Bacteria | 1087 |
| 7 | rootH1_10114680 | 3300003323 | Bacteria | 2212 |
| 8 | rootH2_10009135 | 3300003320 | Bacteria | 10334 |
| 9 | rootH2_10198307 | 3300003320 | Bacteria | 3330 |
| 10 | rootH2_10245760 | 3300003320 | Bacteria | 1210 |
| 11 | rootL2_10009405 | 3300003322 | Bacteria | 6564 |
| 12 | rootL2_10351884 | 3300003322 | Unclassified | 1866 |
| 13 | rootH1_10013674 | 3300003323 | Bacteria | 50224 |
| 14 | rootH1_10023975 | 3300003323 | Bacteria | 6000 |
| 15 | rootH1_10059108 | 3300003323 | Bacteria | 12058 |
| 16 | Ga0055526_1001778 | 3300003771 | Bacteria | 14972 |
| 17 | Ga0055528_1005387 | 3300003790 | Bacteria | 5967 |
| 18 | Ga0065165_1000743 | 3300005262 | Bacteria | 45003 |
| 19 | Ga0065712_10003429 | 3300005290 | Bacteria | 5173 |
| 20 | Ga0065712_10127103 | 3300005290 | Bacteria | 1590 |
| 21 | Ga0065712_10203039 | 3300005290 | Bacteria | 1092 |
| 22 | Ga0065712_10225445 | 3300005290 | Unclassified | 1027 |
| 23 | Ga0065715_10541427 | 3300005293 | Bacteria | 748 |
| 24 | Ga0065707_10127293 | 3300005295 | Bacteria | 1987 |
| 25 | Ga0065707_10151855 | 3300005295 | Unclassified | 1650 |
| 26 | Ga0070658_10001806 | 3300005327 | Bacteria | 17989 |
| 27 | Ga0070658_10158236 | 3300005327 | Bacteria | 1899 |
| 28 | Ga0070658_10514692 | 3300005327 | Bacteria | 1034 |
| 29 | Ga0070658_10669447 | 3300005327 | Bacteria | 901 |
| 30 | Ga0070676_10276686 | 3300005328 | Bacteria | 1129 |
| 31 | Ga0070683_100070528 | 3300005329 | Bacteria | 3260 |
| 32 | Ga0070683_100088214 | 3300005329 | Unclassified | 2910 |
| 33 | Ga0070683_100090327 | 3300005329 | Bacteria | 2876 |
| 34 | Ga0070683_100138049 | 3300005329 | Bacteria | 2309 |
| 35 | Ga0070683_100249682 | 3300005329 | Unclassified | 1687 |
| 36 | Ga0070683_100359040 | 3300005329 | Bacteria | 1388 |
| 37 | Ga0070690_100141430 | 3300005330 | Bacteria | 1634 |
| 38 | Ga0070690_100200776 | 3300005330 | Bacteria | 1387 |
| 39 | Ga0070670_100001415 | 3300005331 | Bacteria | 19282 |
| 40 | Ga0070670_100008938 | 3300005331 | Bacteria | 8557 |
| 41 | Ga0070670_100392659 | 3300005331 | Bacteria | 1224 |
| 42 | Ga0070677_10216072 | 3300005333 | Bacteria | 934 |
| 43 | Ga0068869_100076231 | 3300005334 | Unclassified | 2493 |
| 44 | Ga0068869_100256049 | 3300005334 | Bacteria | 1400 |
| 45 | Ga0068869_100919473 | 3300005334 | Unclassified | 758 |
| 46 | Ga0070666_10003698 | 3300005335 | Bacteria | 9268 |
| 47 | Ga0070666_10039583 | 3300005335 | Bacteria | 3143 |
| 48 | Ga0070666_10128998 | 3300005335 | Bacteria | 1756 |
| 49 | Ga0070666_10289301 | 3300005335 | Bacteria | 1166 |
| 50 | Ga0070666_10866922 | 3300005335 | Bacteria | 667 |
| 51 | Ga0070680_100003404 | 3300005336 | Bacteria | 11878 |
| 52 | Ga0070680_100031337 | 3300005336 | Bacteria | 4274 |
| 53 | Ga0070680_100055741 | 3300005336 | Bacteria | 3230 |
| 54 | Ga0070680_100652891 | 3300005336 | Unclassified | 904 |
| 55 | Ga0070682_100001128 | 3300005337 | Bacteria | 15254 |
| 56 | Ga0070682_100526998 | 3300005337 | Unclassified | 920 |
| 57 | Ga0068868_100141096 | 3300005338 | Unclassified | 1978 |
| 58 | Ga0068868_100298943 | 3300005338 | Bacteria | 1367 |
| 59 | Ga0070660_100216639 | 3300005339 | Bacteria | 1555 |
| 60 | Ga0070660_100332713 | 3300005339 | Bacteria | 1249 |
| 61 | Ga0070689_100050174 | 3300005340 | Bacteria | 3223 |
| 62 | Ga0070689_100066828 | 3300005340 | Bacteria | 2801 |
| 63 | Ga0070689_100301814 | 3300005340 | Bacteria | 1333 |
| 64 | Ga0070691_10054801 | 3300005341 | Bacteria | 1909 |
| 65 | Ga0070687_100096435 | 3300005343 | Bacteria | 1646 |
| 66 | Ga0070687_100289222 | 3300005343 | Bacteria | 1035 |
| 67 | Ga0070687_100585007 | 3300005343 | Bacteria | 764 |
| 68 | Ga0070661_100016755 | 3300005344 | Bacteria | 5187 |
| 69 | Ga0070661_100038120 | 3300005344 | Unclassified | 3498 |
| 70 | Ga0070661_100237114 | 3300005344 | Bacteria | 1403 |
| 71 | Ga0070661_100555838 | 3300005344 | Bacteria | 924 |
| 72 | Ga0070692_10001670 | 3300005345 | Bacteria | 8202 |
| 73 | Ga0070692_10097663 | 3300005345 | Unclassified | 1606 |
| 74 | Ga0070692_10115762 | 3300005345 | Bacteria | 1489 |
| 75 | Ga0070668_100148853 | 3300005347 | Bacteria | 1891 |
| 76 | Ga0070669_100322897 | 3300005353 | Bacteria | 1247 |
| 77 | Ga0070675_100004691 | 3300005354 | Bacteria | 10429 |
| 78 | Ga0070675_100052533 | 3300005354 | Bacteria | 3351 |
| 79 | Ga0070671_100144489 | 3300005355 | Bacteria | 2008 |
| 80 | Ga0070673_101017855 | 3300005364 | Bacteria | 772 |
| 81 | Ga0070688_100035907 | 3300005365 | Bacteria | 3013 |
| 82 | Ga0070688_100130147 | 3300005365 | Bacteria | 1697 |
| 83 | Ga0070659_100042032 | 3300005366 | Bacteria | 3574 |
| 84 | Ga0070659_100052576 | 3300005366 | Bacteria | 3205 |
| 85 | Ga0070659_100053468 | 3300005366 | Bacteria | 3178 |
| 86 | Ga0070659_100346043 | 3300005366 | Unclassified | 1246 |
| 87 | Ga0070667_100008784 | 3300005367 | Bacteria | 8373 |
| 88 | Ga0070667_100058481 | 3300005367 | Bacteria | 3259 |
| 89 | Ga0070709_10024768 | 3300005434 | Bacteria | 3537 |
| 90 | Ga0070709_10268707 | 3300005434 | Unclassified | 1235 |
| 91 | Ga0070714_100142792 | 3300005435 | Unclassified | 2151 |
| 92 | Ga0070713_100188096 | 3300005436 | Unclassified | 1859 |
| 93 | Ga0070710_10569378 | 3300005437 | Unclassified | 784 |
| 94 | Ga0070701_10424229 | 3300005438 | Unclassified | 848 |
| 95 | Ga0070711_100242038 | 3300005439 | Bacteria | 1411 |
| 96 | Ga0070705_100230921 | 3300005440 | Unclassified | 1287 |
| 97 | Ga0070705_100792472 | 3300005440 | Bacteria | 753 |
| 98 | Ga0070700_100061976 | 3300005441 | Bacteria | 2361 |
| 99 | Ga0070700_100166894 | 3300005441 | Bacteria | 1521 |
| 100 | Ga0070694_100433733 | 3300005444 | Bacteria | 1034 |
| 101 | Ga0070663_100273411 | 3300005455 | Bacteria | 1344 |
| 102 | Ga0070662_100002433 | 3300005457 | Bacteria | 11454 |
| 103 | Ga0070681_10156267 | 3300005458 | Bacteria | 2205 |
| 104 | Ga0070681_10218904 | 3300005458 | Bacteria | 1819 |
| 105 | Ga0070681_10337431 | 3300005458 | Bacteria | 1417 |
| 106 | Ga0068867_100215898 | 3300005459 | Bacteria | 1543 |
| 107 | Ga0068867_100394511 | 3300005459 | Bacteria | 1166 |
| 108 | Ga0068867_100416719 | 3300005459 | Bacteria | 1137 |
| 109 | Ga0070685_10001005 | 3300005466 | Bacteria | 15141 |
| 110 | Ga0070685_10120318 | 3300005466 | Bacteria | 1630 |
| 111 | Ga0070698_100023211 | 3300005471 | Bacteria | 6484 |
| 112 | Ga0070698_100040970 | 3300005471 | Bacteria | 4757 |
| 113 | Ga0070679_100010932 | 3300005530 | Bacteria | 8626 |
| 114 | Ga0070679_100034334 | 3300005530 | Bacteria | 5026 |
| 115 | Ga0070684_100006504 | 3300005535 | Bacteria | 9047 |
| 116 | Ga0070684_100053367 | 3300005535 | Bacteria | 3518 |
| 117 | Ga0070684_100074361 | 3300005535 | Unclassified | 2995 |
| 118 | Ga0070684_100113457 | 3300005535 | Bacteria | 2432 |
| 119 | Ga0070684_100273642 | 3300005535 | Bacteria | 1546 |
| 120 | Ga0070684_100298304 | 3300005535 | Bacteria | 1478 |
| 121 | Ga0068853_100016505 | 3300005539 | Bacteria | 6078 |
| 122 | Ga0068853_100111264 | 3300005539 | Unclassified | 2433 |
| 123 | Ga0068853_100319869 | 3300005539 | Unclassified | 1438 |
| 124 | Ga0068853_100369617 | 3300005539 | Bacteria | 1337 |
| 125 | Ga0070672_100069878 | 3300005543 | Bacteria | 2789 |
| 126 | Ga0070695_100022307 | 3300005545 | Unclassified | 3883 |
| 127 | Ga0070695_100292577 | 3300005545 | Unclassified | 1201 |
| 128 | Ga0070693_100002364 | 3300005547 | Bacteria | 8668 |
| 129 | Ga0068855_100000060 | 3300005563 | Bacteria | 133838 |
| 130 | Ga0068855_100004484 | 3300005563 | Bacteria | 17064 |
| 131 | Ga0068855_100074144 | 3300005563 | Bacteria | 3953 |
| 132 | Ga0068855_100208820 | 3300005563 | Bacteria | 2195 |
| 133 | Ga0068855_100733134 | 3300005563 | Unclassified | 1055 |
| 134 | Ga0068855_101193908 | 3300005563 | Bacteria | 791 |
| 135 | Ga0070664_100006042 | 3300005564 | Bacteria | 9791 |
| 136 | Ga0070664_100008429 | 3300005564 | Bacteria | 8335 |
| 137 | Ga0070664_100418596 | 3300005564 | Bacteria | 1227 |
| 138 | Ga0068857_100002714 | 3300005577 | Bacteria | 14530 |
| 139 | Ga0068857_100007359 | 3300005577 | Bacteria | 9478 |
| 140 | Ga0068857_100050563 | 3300005577 | Bacteria | 3687 |
| 141 | Ga0068854_100106137 | 3300005578 | Bacteria | 2112 |
| 142 | Ga0068856_100155654 | 3300005614 | Unclassified | 2295 |
| 143 | Ga0068856_100341440 | 3300005614 | Bacteria | 1516 |
| 144 | Ga0070702_100099664 | 3300005615 | Bacteria | 1779 |
| 145 | Ga0068852_100001075 | 3300005616 | Bacteria | 18053 |
| 146 | Ga0068852_100034415 | 3300005616 | Unclassified | 4215 |
| 147 | Ga0068852_100055730 | 3300005616 | Bacteria | 3413 |
| 148 | Ga0068852_100079183 | 3300005616 | Bacteria | 2910 |
| 149 | Ga0068852_100353299 | 3300005616 | Bacteria | 1436 |
| 150 | Ga0068852_100458491 | 3300005616 | Bacteria | 1263 |
| 151 | Ga0068859_100288969 | 3300005617 | Bacteria | 1732 |
| 152 | Ga0068859_100440802 | 3300005617 | Unclassified | 1399 |
| 153 | Ga0068859_101428209 | 3300005617 | Unclassified | 763 |
| 154 | Ga0068859_101498598 | 3300005617 | Unclassified | 744 |
| 155 | Ga0068864_100007549 | 3300005618 | Bacteria | 8960 |
| 156 | Ga0068864_100030994 | 3300005618 | Bacteria | 4535 |
| 157 | Ga0068864_100042409 | 3300005618 | Bacteria | 3894 |
| 158 | Ga0068864_100163633 | 3300005618 | Bacteria | 2024 |
| 159 | Ga0068864_100533394 | 3300005618 | Unclassified | 1133 |
| 160 | Ga0068861_100327784 | 3300005719 | Bacteria | 1335 |
| 161 | Ga0068861_101151723 | 3300005719 | Bacteria | 748 |
| 162 | Ga0068851_10161827 | 3300005834 | Bacteria | 1230 |
| 163 | Ga0068851_10186888 | 3300005834 | Bacteria | 1150 |
| 164 | Ga0068870_10010422 | 3300005840 | Unclassified | 4271 |
| 165 | Ga0068863_100002341 | 3300005841 | Bacteria | 18837 |
| 166 | Ga0068863_100013943 | 3300005841 | Bacteria | 7747 |
| 167 | Ga0068863_100056997 | 3300005841 | Bacteria | 3698 |
| 168 | Ga0068863_100206384 | 3300005841 | Bacteria | 1891 |
| 169 | Ga0068863_100222254 | 3300005841 | Bacteria | 1820 |
| 170 | Ga0068863_100267983 | 3300005841 | Bacteria | 1652 |
| 171 | Ga0068863_100300806 | 3300005841 | Bacteria | 1556 |
| 172 | Ga0068863_101490501 | 3300005841 | Bacteria | 685 |
| 173 | Ga0068858_100176439 | 3300005842 | Bacteria | 2016 |
| 174 | Ga0068860_100001707 | 3300005843 | Bacteria | 23468 |
| 175 | Ga0068860_100005370 | 3300005843 | Bacteria | 12999 |
| 176 | Ga0068860_100007093 | 3300005843 | Bacteria | 11209 |
| 177 | Ga0068860_100044488 | 3300005843 | Bacteria | 4231 |
| 178 | Ga0068860_100162847 | 3300005843 | Bacteria | 2151 |
| 179 | Ga0068860_100486288 | 3300005843 | Unclassified | 1231 |
| 180 | Ga0068860_101033795 | 3300005843 | Bacteria | 840 |
| 181 | Ga0068862_100018573 | 3300005844 | Bacteria | 5791 |
| 182 | Ga0068862_100020358 | 3300005844 | Bacteria | 5542 |
| 183 | Ga0068862_100179383 | 3300005844 | Bacteria | 1900 |
| 184 | Ga0081455_10039482 | 3300005937 | Bacteria | 4170 |
| 185 | Ga0081455_10491735 | 3300005937 | Unclassified | 826 |
| 186 | Ga0081539_10004646 | 3300005985 | Bacteria | 14947 |
| 187 | Ga0070716_100104716 | 3300006173 | Bacteria | 1742 |
| 188 | Ga0075366_10136747 | 3300006195 | Unclassified | 1480 |
| 189 | Ga0075366_10182486 | 3300006195 | Bacteria | 1275 |
| 190 | Ga0097621_100001243 | 3300006237 | Bacteria | 17615 |
| 191 | Ga0097621_100278979 | 3300006237 | Bacteria | 1471 |
| 192 | Ga0097621_100332618 | 3300006237 | Unclassified | 1347 |
| 193 | Ga0068871_100001056 | 3300006358 | Bacteria | 18473 |
| 194 | Ga0068871_100022666 | 3300006358 | Bacteria | 4845 |
| 195 | Ga0068871_100151578 | 3300006358 | Bacteria | 1977 |
| 196 | Ga0075428_100019466 | 3300006844 | Bacteria | 7512 |
| 197 | Ga0075428_100088757 | 3300006844 | Bacteria | 3372 |
| 198 | Ga0075431_100599616 | 3300006847 | Bacteria | 1085 |
| 199 | Ga0075433_11370241 | 3300006852 | Bacteria | 612 |
| 200 | Ga0075429_100000543 | 3300006880 | Bacteria | 28757 |
| 201 | Ga0075429_100695658 | 3300006880 | Bacteria | 890 |
| 202 | Ga0068865_100320885 | 3300006881 | Bacteria | 1246 |
| 203 | Ga0097620_100288974 | 3300006931 | Bacteria | 1732 |
| 204 | Ga0097620_100440806 | 3300006931 | Unclassified | 1399 |
| 205 | Ga0097620_101428185 | 3300006931 | Unclassified | 763 |
| 206 | Ga0105240_10002694 | 3300009093 | Bacteria | 28270 |
| 207 | Ga0105240_10022198 | 3300009093 | Bacteria | 8419 |
| 208 | Ga0105240_10024023 | 3300009093 | Bacteria | 8051 |
| 209 | Ga0105240_10302085 | 3300009093 | Bacteria | 1831 |
| 210 | Ga0105240_10463407 | 3300009093 | Unclassified | 1416 |
| 211 | Ga0105240_10742673 | 3300009093 | Unclassified | 1068 |
| 212 | Ga0111539_10196595 | 3300009094 | Bacteria | 2352 |
| 213 | Ga0105245_10036403 | 3300009098 | Unclassified | 4372 |
| 214 | Ga0105245_10100557 | 3300009098 | Bacteria | 2675 |
| 215 | Ga0105245_10341086 | 3300009098 | Bacteria | 1482 |
| 216 | Ga0105247_10001522 | 3300009101 | Bacteria | 16573 |
| 217 | Ga0105247_10538580 | 3300009101 | Bacteria | 857 |
| 218 | Ga0114129_10009960 | 3300009147 | Bacteria | 13547 |
| 219 | Ga0114129_10020177 | 3300009147 | Bacteria | 9484 |
| 220 | Ga0114129_10384946 | 3300009147 | Bacteria | 1852 |
| 221 | Ga0105241_10682608 | 3300009174 | Bacteria | 936 |
| 222 | Ga0105241_11506635 | 3300009174 | Bacteria | 647 |
| 223 | Ga0105242_10002222 | 3300009176 | Bacteria | 15309 |
| 224 | Ga0105242_10008873 | 3300009176 | Bacteria | 7715 |
| 225 | Ga0105242_10016049 | 3300009176 | Bacteria | 5818 |
| 226 | Ga0105242_10018381 | 3300009176 | Bacteria | 5463 |
| 227 | Ga0105248_10019425 | 3300009177 | Bacteria | 7519 |
| 228 | Ga0105248_10065115 | 3300009177 | Bacteria | 4092 |
| 229 | Ga0105248_10292300 | 3300009177 | Bacteria | 1835 |
| 230 | Ga0105248_10336221 | 3300009177 | Bacteria | 1700 |
| 231 | Ga0105248_11027988 | 3300009177 | Bacteria | 931 |
| 232 | Ga0105237_10000510 | 3300009545 | Bacteria | 54949 |
| 233 | Ga0105237_10000671 | 3300009545 | Bacteria | 47262 |
| 234 | Ga0105237_10012785 | 3300009545 | Bacteria | 8829 |
| 235 | Ga0105237_10040319 | 3300009545 | Bacteria | 4710 |
| 236 | Ga0105237_10147075 | 3300009545 | Bacteria | 2351 |
| 237 | Ga0105237_10254411 | 3300009545 | Bacteria | 1759 |
| 238 | Ga0105237_10464791 | 3300009545 | Bacteria | 1271 |
| 239 | Ga0105238_10014571 | 3300009551 | Bacteria | 7949 |
| 240 | Ga0105238_10032553 | 3300009551 | Bacteria | 5306 |
| 241 | Ga0105249_10010190 | 3300009553 | Bacteria | 8255 |
| 242 | Ga0105249_10189368 | 3300009553 | Bacteria | 2007 |
| 243 | Ga0105249_10195359 | 3300009553 | Bacteria | 1977 |
| 244 | Ga0105249_10229989 | 3300009553 | Bacteria | 1828 |
| 245 | Ga0105249_10336637 | 3300009553 | Bacteria | 1525 |
| 246 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 247 | Ga0105239_10005627 | 3300010375 | Bacteria | 14645 |
| 248 | Ga0105239_10014092 | 3300010375 | Bacteria | 8875 |
| 249 | Ga0105239_10026291 | 3300010375 | Bacteria | 6406 |
| 250 | Ga0105239_10034852 | 3300010375 | Bacteria | 5528 |
| 251 | Ga0105239_10468776 | 3300010375 | Bacteria | 1430 |
| 252 | Ga0105239_10742893 | 3300010375 | Bacteria | 1123 |
| 253 | Ga0105239_10844384 | 3300010375 | Bacteria | 1050 |
| 254 | Ga0105246_10474736 | 3300011119 | Unclassified | 1057 |
| 255 | Ga0157373_10018597 | 3300013100 | Bacteria | 5057 |
| 256 | Ga0157373_10132114 | 3300013100 | Bacteria | 1755 |
| 257 | Ga0157373_10404523 | 3300013100 | Bacteria | 979 |
| 258 | Ga0157371_10008475 | 3300013102 | Bacteria | 8183 |
| 259 | Ga0157371_10054622 | 3300013102 | Bacteria | 2836 |
| 260 | Ga0157371_10152078 | 3300013102 | Unclassified | 1651 |
| 261 | Ga0157371_10161997 | 3300013102 | Unclassified | 1598 |
| 262 | Ga0157371_10669884 | 3300013102 | Bacteria | 775 |
| 263 | Ga0157370_10004709 | 3300013104 | Bacteria | 15550 |
| 264 | Ga0157370_10127132 | 3300013104 | Bacteria | 2379 |
| 265 | Ga0157370_10533512 | 3300013104 | Bacteria | 1076 |
| 266 | Ga0157370_10859523 | 3300013104 | Unclassified | 824 |
| 267 | Ga0157369_10009675 | 3300013105 | Bacteria | 11024 |
| 268 | Ga0157369_10071553 | 3300013105 | Bacteria | 3722 |
| 269 | Ga0157369_10127102 | 3300013105 | Bacteria | 2702 |
| 270 | Ga0157369_10512730 | 3300013105 | Bacteria | 1241 |
| 271 | Ga0157369_10971630 | 3300013105 | Bacteria | 870 |
| 272 | Ga0157374_10005226 | 3300013296 | Bacteria | 10885 |
| 273 | Ga0157374_10467475 | 3300013296 | Bacteria | 1264 |
| 274 | Ga0157374_10471311 | 3300013296 | Bacteria | 1258 |
| 275 | Ga0157374_10983919 | 3300013296 | Bacteria | 863 |
| 276 | Ga0157378_10006930 | 3300013297 | Bacteria | 9894 |
| 277 | Ga0157378_10010437 | 3300013297 | Bacteria | 8112 |
| 278 | Ga0157378_10062311 | 3300013297 | Bacteria | 3330 |
| 279 | Ga0163162_10001262 | 3300013306 | Bacteria | 23654 |
| 280 | Ga0163162_10045726 | 3300013306 | Bacteria | 4386 |
| 281 | Ga0163162_10111389 | 3300013306 | Bacteria | 2834 |
| 282 | Ga0163162_10684131 | 3300013306 | Bacteria | 1148 |
| 283 | Ga0163162_10717936 | 3300013306 | Unclassified | 1120 |
| 284 | Ga0163162_11573770 | 3300013306 | Bacteria | 749 |
| 285 | Ga0157372_10003091 | 3300013307 | Bacteria | 17926 |
| 286 | Ga0157372_10017350 | 3300013307 | Bacteria | 7729 |
| 287 | Ga0157372_10031599 | 3300013307 | Bacteria | 5797 |
| 288 | Ga0157372_10035124 | 3300013307 | Bacteria | 5516 |
| 289 | Ga0157372_10045621 | 3300013307 | Unclassified | 4863 |
| 290 | Ga0157372_10224698 | 3300013307 | Bacteria | 2177 |
| 291 | Ga0157372_10446768 | 3300013307 | Bacteria | 1507 |
| 292 | Ga0157372_10829557 | 3300013307 | Bacteria | 1074 |
| 293 | Ga0157372_10939531 | 3300013307 | Bacteria | 1002 |
| 294 | Ga0157372_10960168 | 3300013307 | Bacteria | 991 |
| 295 | Ga0157372_11403028 | 3300013307 | Bacteria | 805 |
| 296 | Ga0157372_11641903 | 3300013307 | Bacteria | 740 |
| 297 | Ga0157372_11737660 | 3300013307 | Unclassified | 718 |
| 298 | Ga0157375_10000749 | 3300013308 | Bacteria | 28469 |
| 299 | Ga0157375_10004593 | 3300013308 | Bacteria | 12001 |
| 300 | Ga0157375_10034519 | 3300013308 | Bacteria | 4820 |
| 301 | Ga0157375_10072815 | 3300013308 | Bacteria | 3453 |
| 302 | Ga0157375_11704014 | 3300013308 | Unclassified | 746 |
| 303 | Ga0163163_10000494 | 3300014325 | Bacteria | 35512 |
| 304 | Ga0163163_10031353 | 3300014325 | Bacteria | 5130 |
| 305 | Ga0163163_10051496 | 3300014325 | Bacteria | 4060 |
| 306 | Ga0163163_10178674 | 3300014325 | Bacteria | 2169 |
| 307 | Ga0163163_10345214 | 3300014325 | Bacteria | 1544 |
| 308 | Ga0163163_10787281 | 3300014325 | Bacteria | 1014 |
| 309 | Ga0157380_10016089 | 3300014326 | Bacteria | 5510 |
| 310 | Ga0157380_10024856 | 3300014326 | Bacteria | 4537 |
| 311 | Ga0157380_10063975 | 3300014326 | Bacteria | 2951 |
| 312 | Ga0157380_10830028 | 3300014326 | Bacteria | 944 |
| 313 | Ga0157380_11912065 | 3300014326 | Unclassified | 654 |
| 314 | Ga0157377_10035528 | 3300014745 | Unclassified | 2734 |
| 315 | Ga0157377_10270198 | 3300014745 | Bacteria | 1110 |
| 316 | Ga0157379_10106881 | 3300014968 | Bacteria | 2512 |
| 317 | Ga0157376_10000597 | 3300014969 | Bacteria | 23324 |
| 318 | Ga0157376_10024302 | 3300014969 | Bacteria | 4754 |
| 319 | Ga0157376_10067800 | 3300014969 | Bacteria | 3019 |
| 320 | Ga0182007_10029863 | 3300015262 | Bacteria | 1865 |
| 321 | Ga0182007_10147835 | 3300015262 | Bacteria | 797 |
| 322 | Ga0163161_10001497 | 3300017792 | Bacteria | 17273 |
| 323 | Ga0163161_10058586 | 3300017792 | Bacteria | 2799 |
| 324 | Ga0209233_1011331 | 3300025261 | Bacteria | 2631 |
| 325 | Ga0209455_1004066 | 3300025272 | Bacteria | 4930 |
| 326 | Ga0209673_1000438 | 3300025273 | Bacteria | 71700 |
| 327 | Ga0209564_1000606 | 3300025295 | Bacteria | 55783 |
| 328 | Ga0209564_1003267 | 3300025295 | Bacteria | 11308 |
| 329 | Ga0209758_1003210 | 3300025297 | Bacteria | 15233 |
| 330 | Ga0209758_1005303 | 3300025297 | Bacteria | 10065 |
| 331 | Ga0209050_1000892 | 3300025298 | Bacteria | 39709 |
| 332 | Ga0207426_1001400 | 3300025302 | Bacteria | 20323 |
| 333 | Ga0207426_1007438 | 3300025302 | Bacteria | 4586 |
| 334 | Ga0209257_1057924 | 3300025304 | Bacteria | 1064 |
| 335 | Ga0207697_10048015 | 3300025315 | Bacteria | 1760 |
| 336 | Ga0207656_10134494 | 3300025321 | Bacteria | 1161 |
| 337 | Ga0207656_10137980 | 3300025321 | Bacteria | 1147 |
| 338 | Ga0207692_10324150 | 3300025898 | Unclassified | 943 |
| 339 | Ga0207710_10011013 | 3300025900 | Bacteria | 3809 |
| 340 | Ga0207688_10058063 | 3300025901 | Bacteria | 2177 |
| 341 | Ga0207680_10016371 | 3300025903 | Unclassified | 3891 |
| 342 | Ga0207680_10085108 | 3300025903 | Bacteria | 1997 |
| 343 | Ga0207680_10089515 | 3300025903 | Bacteria | 1954 |
| 344 | Ga0207680_10319878 | 3300025903 | Bacteria | 1085 |
| 345 | Ga0207647_10038808 | 3300025904 | Unclassified | 3009 |
| 346 | Ga0207647_10124748 | 3300025904 | Bacteria | 1516 |
| 347 | Ga0207647_10148085 | 3300025904 | Unclassified | 1373 |
| 348 | Ga0207647_10257601 | 3300025904 | Unclassified | 1000 |
| 349 | Ga0207645_10163199 | 3300025907 | Bacteria | 1458 |
| 350 | Ga0207643_10009608 | 3300025908 | Bacteria | 5193 |
| 351 | Ga0207643_10147201 | 3300025908 | Bacteria | 1410 |
| 352 | Ga0207643_10550565 | 3300025908 | Unclassified | 740 |
| 353 | Ga0207705_10000623 | 3300025909 | Bacteria | 29594 |
| 354 | Ga0207705_10020019 | 3300025909 | Bacteria | 4785 |
| 355 | Ga0207705_10025587 | 3300025909 | Bacteria | 4211 |
| 356 | Ga0207654_10434925 | 3300025911 | Bacteria | 918 |
| 357 | Ga0207707_10043800 | 3300025912 | Bacteria | 3902 |
| 358 | Ga0207707_10046354 | 3300025912 | Unclassified | 3786 |
| 359 | Ga0207707_10329093 | 3300025912 | Bacteria | 1318 |
| 360 | Ga0207695_10021713 | 3300025913 | Bacteria | 7317 |
| 361 | Ga0207695_10062162 | 3300025913 | Unclassified | 3857 |
| 362 | Ga0207695_10344723 | 3300025913 | Bacteria | 1377 |
| 363 | Ga0207671_10006613 | 3300025914 | Bacteria | 10284 |
| 364 | Ga0207671_10007833 | 3300025914 | Bacteria | 9183 |
| 365 | Ga0207671_10008101 | 3300025914 | Bacteria | 8971 |
| 366 | Ga0207671_10017382 | 3300025914 | Bacteria | 5548 |
| 367 | Ga0207671_10141186 | 3300025914 | Bacteria | 1856 |
| 368 | Ga0207671_10659129 | 3300025914 | Bacteria | 833 |
| 369 | Ga0207671_10675301 | 3300025914 | Bacteria | 822 |
| 370 | Ga0207671_10744430 | 3300025914 | Bacteria | 779 |
| 371 | Ga0207663_10878754 | 3300025916 | Bacteria | 716 |
| 372 | Ga0207660_10171748 | 3300025917 | Bacteria | 1678 |
| 373 | Ga0207660_10172569 | 3300025917 | Bacteria | 1675 |
| 374 | Ga0207660_10278106 | 3300025917 | Unclassified | 1328 |
| 375 | Ga0207660_10632361 | 3300025917 | Unclassified | 872 |
| 376 | Ga0207662_10054656 | 3300025918 | Bacteria | 2381 |
| 377 | Ga0207662_10097097 | 3300025918 | Bacteria | 1821 |
| 378 | Ga0207662_10167762 | 3300025918 | Bacteria | 1406 |
| 379 | Ga0207662_10942984 | 3300025918 | Bacteria | 612 |
| 380 | Ga0207657_10035305 | 3300025919 | Unclassified | 4484 |
| 381 | Ga0207657_10037298 | 3300025919 | Bacteria | 4342 |
| 382 | Ga0207657_10114906 | 3300025919 | Bacteria | 2219 |
| 383 | Ga0207649_10009530 | 3300025920 | Bacteria | 5316 |
| 384 | Ga0207649_10105595 | 3300025920 | Bacteria | 1872 |
| 385 | Ga0207649_10217756 | 3300025920 | Bacteria | 1358 |
| 386 | Ga0207649_10638055 | 3300025920 | Bacteria | 822 |
| 387 | Ga0207652_10663297 | 3300025921 | Unclassified | 932 |
| 388 | Ga0207652_10785280 | 3300025921 | Unclassified | 846 |
| 389 | Ga0207681_10052429 | 3300025923 | Bacteria | 2766 |
| 390 | Ga0207681_10265550 | 3300025923 | Bacteria | 1345 |
| 391 | Ga0207694_10048749 | 3300025924 | Bacteria | 3278 |
| 392 | Ga0207694_10225605 | 3300025924 | Unclassified | 1529 |
| 393 | Ga0207694_10375432 | 3300025924 | Unclassified | 1180 |
| 394 | Ga0207650_10007105 | 3300025925 | Bacteria | 7627 |
| 395 | Ga0207650_10038266 | 3300025925 | Unclassified | 3502 |
| 396 | Ga0207650_10469988 | 3300025925 | Bacteria | 1048 |
| 397 | Ga0207650_10525609 | 3300025925 | Bacteria | 990 |
| 398 | Ga0207659_11008834 | 3300025926 | Bacteria | 716 |
| 399 | Ga0207687_10067073 | 3300025927 | Bacteria | 2552 |
| 400 | Ga0207687_10365474 | 3300025927 | Unclassified | 1179 |
| 401 | Ga0207700_10131531 | 3300025928 | Unclassified | 2044 |
| 402 | Ga0207664_10617332 | 3300025929 | Unclassified | 974 |
| 403 | Ga0207690_10033132 | 3300025932 | Bacteria | 3320 |
| 404 | Ga0207690_10204691 | 3300025932 | Bacteria | 1501 |
| 405 | Ga0207690_10251349 | 3300025932 | Bacteria | 1366 |
| 406 | Ga0207706_10015151 | 3300025933 | Bacteria | 6977 |
| 407 | Ga0207706_10105001 | 3300025933 | Bacteria | 2486 |
| 408 | Ga0207686_10003705 | 3300025934 | Bacteria | 8195 |
| 409 | Ga0207686_10011836 | 3300025934 | Bacteria | 4787 |
| 410 | Ga0207686_10015383 | 3300025934 | Bacteria | 4278 |
| 411 | Ga0207670_10122140 | 3300025936 | Bacteria | 1895 |
| 412 | Ga0207670_10189647 | 3300025936 | Bacteria | 1555 |
| 413 | Ga0207670_10862016 | 3300025936 | Bacteria | 757 |
| 414 | Ga0207691_10050906 | 3300025940 | Bacteria | 3790 |
| 415 | Ga0207691_10145862 | 3300025940 | Unclassified | 2083 |
| 416 | Ga0207691_10375299 | 3300025940 | Bacteria | 1214 |
| 417 | Ga0207691_10508998 | 3300025940 | Bacteria | 1022 |
| 418 | Ga0207711_10021893 | 3300025941 | Bacteria | 5340 |
| 419 | Ga0207711_10801674 | 3300025941 | Bacteria | 877 |
| 420 | Ga0207689_10057603 | 3300025942 | Bacteria | 3196 |
| 421 | Ga0207689_10350294 | 3300025942 | Unclassified | 1227 |
| 422 | Ga0207689_10947726 | 3300025942 | Unclassified | 726 |
| 423 | Ga0207661_10000594 | 3300025944 | Bacteria | 23140 |
| 424 | Ga0207661_10024853 | 3300025944 | Bacteria | 4547 |
| 425 | Ga0207661_10055980 | 3300025944 | Bacteria | 3165 |
| 426 | Ga0207661_10483539 | 3300025944 | Bacteria | 1130 |
| 427 | Ga0207661_10825437 | 3300025944 | Bacteria | 853 |
| 428 | Ga0207679_10029988 | 3300025945 | Bacteria | 3793 |
| 429 | Ga0207679_10058482 | 3300025945 | Bacteria | 2857 |
| 430 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 431 | Ga0207667_10003946 | 3300025949 | Bacteria | 18252 |
| 432 | Ga0207667_10005074 | 3300025949 | Bacteria | 16087 |
| 433 | Ga0207667_10049705 | 3300025949 | Bacteria | 4427 |
| 434 | Ga0207667_10272670 | 3300025949 | Bacteria | 1729 |
| 435 | Ga0207651_10388041 | 3300025960 | Bacteria | 1185 |
| 436 | Ga0207712_10012709 | 3300025961 | Bacteria | 5380 |
| 437 | Ga0207712_10033324 | 3300025961 | Bacteria | 3482 |
| 438 | Ga0207712_10221634 | 3300025961 | Bacteria | 1512 |
| 439 | Ga0207668_10014555 | 3300025972 | Bacteria | 4870 |
| 440 | Ga0207668_10433139 | 3300025972 | Unclassified | 1119 |
| 441 | Ga0207668_10485214 | 3300025972 | Bacteria | 1061 |
| 442 | Ga0207640_10242465 | 3300025981 | Bacteria | 1394 |
| 443 | Ga0207658_10009682 | 3300025986 | Bacteria | 6539 |
| 444 | Ga0207658_10014787 | 3300025986 | Bacteria | 5348 |
| 445 | Ga0207658_10080772 | 3300025986 | Bacteria | 2491 |
| 446 | Ga0207658_10265625 | 3300025986 | Bacteria | 1464 |
| 447 | Ga0207677_10077921 | 3300026023 | Unclassified | 2365 |
| 448 | Ga0207703_10250001 | 3300026035 | Bacteria | 1597 |
| 449 | Ga0207703_11202853 | 3300026035 | Bacteria | 729 |
| 450 | Ga0207639_10107675 | 3300026041 | Unclassified | 2264 |
| 451 | Ga0207639_10142487 | 3300026041 | Bacteria | 1998 |
| 452 | Ga0207639_10345740 | 3300026041 | Bacteria | 1327 |
| 453 | Ga0207678_10063153 | 3300026067 | Bacteria | 3182 |
| 454 | Ga0207708_10117756 | 3300026075 | Bacteria | 2068 |
| 455 | Ga0207708_10211805 | 3300026075 | Bacteria | 1549 |
| 456 | Ga0207708_10316367 | 3300026075 | Bacteria | 1273 |
| 457 | Ga0207702_10015080 | 3300026078 | Bacteria | 6407 |
| 458 | Ga0207702_10047023 | 3300026078 | Unclassified | 3634 |
| 459 | Ga0207641_10000810 | 3300026088 | Bacteria | 33309 |
| 460 | Ga0207641_10034431 | 3300026088 | Unclassified | 4214 |
| 461 | Ga0207641_10052276 | 3300026088 | Bacteria | 3460 |
| 462 | Ga0207641_10167177 | 3300026088 | Unclassified | 2004 |
| 463 | Ga0207641_10717729 | 3300026088 | Bacteria | 985 |
| 464 | Ga0207641_11212337 | 3300026088 | Bacteria | 754 |
| 465 | Ga0207648_10389117 | 3300026089 | Bacteria | 1262 |
| 466 | Ga0207648_10470486 | 3300026089 | Bacteria | 1147 |
| 467 | Ga0207648_10747238 | 3300026089 | Bacteria | 908 |
| 468 | Ga0207676_10006134 | 3300026095 | Bacteria | 8484 |
| 469 | Ga0207676_10047204 | 3300026095 | Bacteria | 3336 |
| 470 | Ga0207676_10082265 | 3300026095 | Bacteria | 2618 |
| 471 | Ga0207676_10115724 | 3300026095 | Bacteria | 2252 |
| 472 | Ga0207676_10325299 | 3300026095 | Unclassified | 1413 |
| 473 | Ga0207676_10386747 | 3300026095 | Bacteria | 1304 |
| 474 | Ga0207674_10001506 | 3300026116 | Bacteria | 30062 |
| 475 | Ga0207674_10001732 | 3300026116 | Bacteria | 27879 |
| 476 | Ga0207674_10002868 | 3300026116 | Bacteria | 21414 |
| 477 | Ga0207674_10035062 | 3300026116 | Bacteria | 5238 |
| 478 | Ga0207674_10069014 | 3300026116 | Bacteria | 3555 |
| 479 | Ga0207674_10096123 | 3300026116 | Bacteria | 2948 |
| 480 | Ga0207674_10097451 | 3300026116 | Bacteria | 2925 |
| 481 | Ga0207674_10129640 | 3300026116 | Bacteria | 2486 |
| 482 | Ga0207675_100024868 | 3300026118 | Bacteria | 5572 |
| 483 | Ga0207675_100313401 | 3300026118 | Bacteria | 1530 |
| 484 | Ga0207675_101586012 | 3300026118 | Unclassified | 675 |
| 485 | Ga0207683_10343053 | 3300026121 | Unclassified | 1370 |
| 486 | Ga0207683_10362331 | 3300026121 | Bacteria | 1331 |
| 487 | Ga0207698_10001106 | 3300026142 | Bacteria | 15707 |
| 488 | Ga0207698_10375805 | 3300026142 | Unclassified | 1350 |
| 489 | Ga0207698_10420123 | 3300026142 | Bacteria | 1283 |
| 490 | Ga0207698_10646958 | 3300026142 | Bacteria | 1047 |
| 491 | Ga0268265_10051881 | 3300028380 | Bacteria | 3098 |
| 492 | Ga0268265_10103754 | 3300028380 | Unclassified | 2303 |
| 493 | Ga0268265_10228689 | 3300028380 | Bacteria | 1633 |
| 494 | Ga0268265_10238768 | 3300028380 | Bacteria | 1602 |
| 495 | Ga0268265_10787529 | 3300028380 | Bacteria | 926 |
| 496 | Ga0268264_10000964 | 3300028381 | Bacteria | 29492 |
| 497 | Ga0268264_10002457 | 3300028381 | Bacteria | 16284 |
| 498 | Ga0268264_10003607 | 3300028381 | Bacteria | 13326 |
| 499 | Ga0268264_10028665 | 3300028381 | Bacteria | 4556 |
| 500 | Ga0268264_10219359 | 3300028381 | Bacteria | 1750 |
| 501 | Ga0265334_10072708 | 3300028573 | Bacteria | 1278 |
| 502 | Ga0307517_10000929 | 3300028786 | Bacteria | 49793 |
| 503 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 504 | Ga0307515_10130467 | 3300028794 | Bacteria | 2773 |
| 505 | Ga0307515_10471874 | 3300028794 | Bacteria | 868 |
| 506 | Ga0307511_10000614 | 3300030521 | Bacteria | 38191 |
| 507 | Ga0265327_10102081 | 3300031251 | Bacteria | 1382 |
| 508 | Ga0307513_10188040 | 3300031456 | Bacteria | 1920 |
| 509 | Ga0307509_10322362 | 3300031507 | Bacteria | 1281 |
| 510 | Ga0307408_100010828 | 3300031548 | Bacteria | 6017 |
| 511 | Ga0307514_10209148 | 3300031649 | Bacteria | 1214 |
| 512 | Ga0265314_10152171 | 3300031711 | Bacteria | 1417 |
| 513 | Ga0307516_10725303 | 3300031730 | Bacteria | 652 |
| 514 | Ga0307406_10193951 | 3300031901 | Bacteria | 1489 |
| 515 | Ga0373959_0075057 | 3300034820 | Bacteria | 770 |
| 516 | Ga0373959_0095244 | 3300034820 | Bacteria | 702 |
| 517 | Ga0373931_0003397 | 3300035691 | Bacteria | 7144 |
| 518 | Ga0373927_0015533 | 3300035695 | Bacteria | 5030 |
| 519 | Ga0373937_0056344 | 3300036401 | Bacteria | 3610 |
| 520 | Ga0373937_0137865 | 3300036401 | Unclassified | 2282 |
| 521 | Ga0395899_0075983 | 3300037312 | Bacteria | 2453 |
| 522 | Ga0395898_0095283 | 3300037466 | Bacteria | 2860 |
| 523 | Ga0395905_0002338 | 3300037471 | Bacteria | 21140 |
| 524 | Ga0395901_0002149 | 3300038443 | Bacteria | 20154 |
| 525 | Ga0436365_1368300 | 3300039437 | Bacteria | 2432 |
| 526 | Ga0436365_1626007 | 3300039437 | Bacteria | 4497 |
| 527 | Ga0436363_1603773 | 3300039450 | Bacteria | 807 |
| 528 | Ga0451807_2330222 | 3300041486 | Bacteria | 829 |
| 529 | Ga0451853_0711190 | 3300041512 | Bacteria | 1031 |
| 530 | Ga0451853_3830960 | 3300041512 | Bacteria | 670 |
| 531 | Ga0439462_0031809 | 3300042015 | Bacteria | 1398 |
| 532 | Ga0451577_0024368 | 3300042876 | Bacteria | 5506 |
| 533 | Ga0466965_0144664 | 3300044683 | Bacteria | 1240 |
| 534 | Ga0466964_0318510 | 3300044706 | Bacteria | 789 |
| 535 | Ga0453684_0152006 | 3300044712 | Bacteria | 2749 |
| 536 | Ga0453684_1051556 | 3300044712 | Bacteria | 863 |
| 537 | Ga0451576_0110747 | 3300045051 | Bacteria | 2857 |
| 538 | Ga0451576_0354112 | 3300045051 | Bacteria | 1537 |
| 539 | Ga0495638_0000026 | 3300046460 | Bacteria | 347061 |
| 540 | Ga0495638_0042957 | 3300046460 | Bacteria | 2854 |
| 541 | Ga0495638_0160782 | 3300046460 | Bacteria | 1296 |
| 542 | Ga0495606_0012352 | 3300046507 | Bacteria | 6859 |
| 543 | Ga0495598_0288139 | 3300046537 | Bacteria | 618 |
| 544 | Ga0495621_0030666 | 3300046539 | Bacteria | 1840 |
| 545 | Ga0495649_0204106 | 3300046694 | Bacteria | 1026 |
| 546 | Ga0495581_0307287 | 3300047315 | Bacteria | 927 |
| 547 | Ga0495672_0016866 | 3300047320 | Bacteria | 4902 |
| 548 | Ga0495686_0016274 | 3300047472 | Bacteria | 5047 |
| 549 | Ga0495686_0056095 | 3300047472 | Bacteria | 2462 |
| 550 | Ga0496101_0097179 | 3300048904 | Bacteria | 2199 |
| 551 | Ga0496104_0000419 | 3300048907 | Bacteria | 37179 |
| 552 | Ga0496108_0027390 | 3300048911 | Bacteria | 4706 |
| 553 | Ga0496109_0590438 | 3300048912 | Bacteria | 1047 |
| 554 | Ga0496109_0979114 | 3300048912 | Unclassified | 784 |
| 555 | Ga0496110_0734886 | 3300048913 | Bacteria | 890 |
| 556 | Ga0496110_1082245 | 3300048913 | Bacteria | 710 |
| 557 | Ga0496112_0001542 | 3300048915 | Bacteria | 17787 |
| 558 | Ga0496113_0125247 | 3300048916 | Bacteria | 2011 |
| 559 | Ga0496114_0111444 | 3300048917 | Bacteria | 2345 |
| 560 | Ga0501031_0063084 | 3300049568 | Bacteria | 2414 |
| 561 | Ga0501031_0794827 | 3300049568 | Unclassified | 607 |
| 562 | Ga0501032_0004292 | 3300049569 | Bacteria | 10761 |
| 563 | Ga0501033_0000627 | 3300049570 | Bacteria | 32716 |
| 564 | Ga0501034_0001088 | 3300049571 | Bacteria | 38356 |
| 565 | Ga0501034_0009695 | 3300049571 | Bacteria | 10071 |
| 566 | Ga0501034_0086883 | 3300049571 | Bacteria | 3127 |
| 567 | Ga0501034_0337749 | 3300049571 | Bacteria | 1437 |
| 568 | Ga0501036_0007064 | 3300049572 | Bacteria | 9137 |
| 569 | Ga0501037_0013718 | 3300049573 | Bacteria | 5968 |
| 570 | Ga0501037_0026900 | 3300049573 | Bacteria | 4249 |
| 571 | Ga0501037_0110275 | 3300049573 | Bacteria | 1983 |
| 572 | Ga0501038_0000577 | 3300049574 | Bacteria | 32475 |
| 573 | Ga0501038_0004801 | 3300049574 | Bacteria | 12554 |
| 574 | Ga0501038_0009748 | 3300049574 | Bacteria | 8807 |
| 575 | Ga0501038_0030839 | 3300049574 | Bacteria | 4740 |
| 576 | Ga0501039_0009994 | 3300049575 | Bacteria | 7234 |
| 577 | Ga0501039_0014718 | 3300049575 | Bacteria | 5984 |
| 578 | Ga0501039_0022751 | 3300049575 | Bacteria | 4809 |
| 579 | Ga0501043_0003669 | 3300049579 | Bacteria | 12609 |
| 580 | Ga0501043_0013535 | 3300049579 | Bacteria | 6383 |
| 581 | Ga0501043_0032562 | 3300049579 | Bacteria | 4099 |
| 582 | Ga0501046_0007091 | 3300049580 | Bacteria | 9865 |
| 583 | Ga0501046_0009712 | 3300049580 | Bacteria | 8299 |
| 584 | Ga0501046_0017963 | 3300049580 | Bacteria | 5894 |
| 585 | Ga0501046_0240368 | 3300049580 | Bacteria | 1336 |
| 586 | Ga0501047_0014150 | 3300049581 | Bacteria | 7581 |
| 587 | Ga0501047_0018106 | 3300049581 | Bacteria | 6750 |
| 588 | Ga0501047_0020717 | 3300049581 | Bacteria | 6315 |
| 589 | Ga0501047_0028066 | 3300049581 | Bacteria | 5424 |
| 590 | Ga0501047_0652651 | 3300049581 | Bacteria | 871 |
| 591 | Ga0501048_0005701 | 3300049582 | Bacteria | 9464 |
| 592 | Ga0501048_0086557 | 3300049582 | Bacteria | 2210 |
| 593 | Ga0501067_0035807 | 3300049583 | Bacteria | 2756 |
| 594 | Ga0501067_0082392 | 3300049583 | Bacteria | 1784 |
| 595 | Ga0501068_0004766 | 3300049584 | Bacteria | 7380 |
| 596 | Ga0501068_0019069 | 3300049584 | Bacteria | 3976 |
| 597 | Ga0501068_0020895 | 3300049584 | Bacteria | 3820 |
| 598 | Ga0501069_0070717 | 3300049585 | Bacteria | 1955 |
| 599 | Ga0501070_0002240 | 3300049586 | Bacteria | 16989 |
| 600 | Ga0501070_0008598 | 3300049586 | Bacteria | 8632 |
| 601 | Ga0501072_0113928 | 3300049588 | Bacteria | 2153 |
| 602 | Ga0501073_0004775 | 3300049589 | Bacteria | 10169 |
| 603 | Ga0501073_0032708 | 3300049589 | Bacteria | 3707 |
| 604 | Ga0501074_0018022 | 3300049590 | Bacteria | 5129 |
| 605 | Ga0501074_0226366 | 3300049590 | Bacteria | 1331 |
| 606 | Ga0501079_0002785 | 3300049741 | Bacteria | 12749 |
| 607 | Ga0501079_0029449 | 3300049741 | Bacteria | 4215 |
| 608 | Ga0501080_0005359 | 3300049742 | Bacteria | 11432 |
| 609 | Ga0501080_0020251 | 3300049742 | Bacteria | 6157 |
| 610 | Ga0501080_0029063 | 3300049742 | Bacteria | 5145 |
| 611 | Ga0501083_0008572 | 3300049744 | Bacteria | 7214 |
| 612 | Ga0501083_0018399 | 3300049744 | Bacteria | 4869 |
| 613 | Ga0501083_0043986 | 3300049744 | Bacteria | 3023 |
| 614 | Ga0501083_0105756 | 3300049744 | Bacteria | 1853 |
| 615 | Ga0501035_0003663 | 3300049822 | Bacteria | 14650 |
| 616 | Ga0501035_0005157 | 3300049822 | Bacteria | 12358 |
| 617 | Ga0501044_0004013 | 3300049823 | Bacteria | 16494 |
| 618 | Ga0501044_0059544 | 3300049823 | Bacteria | 3912 |
| 619 | Ga0501045_0024310 | 3300049824 | Bacteria | 4349 |
| 620 | nmdc:mga0k408_63260_c1 | 3300050493 | Unclassified | 2152 |
| 621 | nmdc:mga05p37_605_c1 | 3300050507 | Bacteria | 16464 |
| 622 | nmdc:mga05p37_75664_c1 | 3300050507 | Bacteria | 4144 |
| 623 | nmdc:mga09592_186052_c1 | 3300050508 | Bacteria | 1797 |
| 624 | nmdc:mga09592_2761_c1 | 3300050508 | Bacteria | 14203 |
| 625 | nmdc:mga06r32_601323_c1 | 3300050510 | Bacteria | 1071 |
| 626 | nmdc:mga08y16_633663_c1 | 3300050511 | Bacteria | 1075 |
| 627 | nmdc:mga0n895_296114_c1 | 3300050512 | Bacteria | 1640 |
| 628 | nmdc:mga08x19_569725_c1 | 3300050514 | Bacteria | 802 |
| 629 | Ga0500646_0011717 | 3300053090 | Bacteria | 2258 |
| 630 | Ga0500583_0000029 | 3300053092 | Bacteria | 107304 |
| 631 | Ga0500583_0000269 | 3300053092 | Bacteria | 18413 |
| 632 | Ga0500651_0270802 | 3300053093 | Bacteria | 982 |
| 633 | Ga0500557_001819 | 3300053105 | Bacteria | 3671 |
| 634 | Ga0500594_0051311 | 3300053118 | Unclassified | 1163 |
| 635 | Ga0500652_050463 | 3300053131 | Bacteria | 1698 |
| 636 | Ga0500616_0000004 | 3300053153 | Bacteria | 1002714 |
| 637 | Ga0500622_0080737 | 3300053156 | Unclassified | 1628 |
| 638 | Ga0500622_0223565 | 3300053156 | Bacteria | 842 |
| 639 | Ga0500622_0250796 | 3300053156 | Unclassified | 777 |
| 640 | Ga0500633_0002655 | 3300053160 | Bacteria | 3730 |
| 641 | Ga0500611_000021 | 3300053727 | Bacteria | 102395 |
| 642 | Ga0501084_0020633 | 3300054114 | Bacteria | 5495 |
| 643 | Ga0501084_0023937 | 3300054114 | Bacteria | 5095 |
| 644 | Ga0501084_0517859 | 3300054114 | Bacteria | 1008 |
| 645 | Ga0501082_0004933 | 3300060353 | Bacteria | 11644 |
| 646 | Ga0501082_0005505 | 3300060353 | Bacteria | 10990 |
| 647 | Ga0501082_0032446 | 3300060353 | Bacteria | 4504 |
| 648 | Ga0501082_0799325 | 3300060353 | Unclassified | 825 |
| 649 | Ga0501082_0840014 | 3300060353 | Bacteria | 803 |
| 650 | Ga0501082_1315584 | 3300060353 | Bacteria | 631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10102081 | Ga0265327_101020811 | 159 |
| 2 | 3300013104 | Ga0157370_10859523 | Ga0157370_108595232 | 162 |
| 3 | 3300044683 | Ga0466965_0144664 | Ga0466965_0144664_725_1225 | 166 |
| 4 | 3300013307 | Ga0157372_10960168 | Ga0157372_109601681 | 169 |
| 5 | iso_pu_bacteria | 2738541278 | 2738730185 | 170 |
| 6 | 3300005290 | Ga0065712_10127103 | Ga0065712_101271032 | 172 |
| 7 | 3300005329 | Ga0070683_100090327 | Ga0070683_1000903274 | 172 |
| 8 | 3300005340 | Ga0070689_100301814 | Ga0070689_1003018142 | 172 |
| 9 | 3300005344 | Ga0070661_100555838 | Ga0070661_1005558382 | 172 |
| 10 | 3300005535 | Ga0070684_100006504 | Ga0070684_1000065042 | 172 |
| 11 | 3300005618 | Ga0068864_100042409 | Ga0068864_1000424094 | 172 |
| 12 | 3300005841 | Ga0068863_101490501 | Ga0068863_1014905011 | 172 |
| 13 | 3300006847 | Ga0075431_100599616 | Ga0075431_1005996161 | 172 |
| 14 | 3300009147 | Ga0114129_10020177 | Ga0114129_100201775 | 172 |
| 15 | 3300009177 | Ga0105248_10065115 | Ga0105248_100651154 | 172 |
| 16 | 3300013307 | Ga0157372_11641903 | Ga0157372_116419031 | 172 |
| 17 | 3300013307 | Ga0157372_11737660 | Ga0157372_117376602 | 172 |
| 18 | 3300014325 | Ga0163163_10051496 | Ga0163163_100514964 | 172 |
| 19 | 3300025936 | Ga0207670_10122140 | Ga0207670_101221402 | 172 |
| 20 | 3300025944 | Ga0207661_10024853 | Ga0207661_100248536 | 172 |
| 21 | 3300026088 | Ga0207641_11212337 | Ga0207641_112123371 | 172 |
| 22 | 3300026095 | Ga0207676_10082265 | Ga0207676_100822652 | 172 |
| 23 | 3300034820 | Ga0373959_0095244 | Ga0373959_0095244_152_682 | 172 |
| 24 | 3300048911 | Ga0496108_0027390 | Ga0496108_0027390_1809_2393 | 172 |
| 25 | 3300048912 | Ga0496109_0979114 | Ga0496109_0979114_31_561 | 172 |
| 26 | 3300048915 | Ga0496112_0001542 | Ga0496112_0001542_10792_11376 | 172 |
| 27 | 3300048916 | Ga0496113_0125247 | Ga0496113_0125247_1267_1851 | 172 |
| 28 | 3300050508 | nmdc:mga09592_186052_c1 | nmdc:mga09592_186052_c1_414_995 | 172 |
| 29 | 3300050514 | nmdc:mga08x19_569725_c1 | nmdc:mga08x19_569725_c1_175_705 | 172 |
| 30 | 3300005341 | Ga0070691_10054801 | Ga0070691_100548012 | 173 |
| 31 | 3300005535 | Ga0070684_100113457 | Ga0070684_1001134572 | 173 |
| 32 | 3300005539 | Ga0068853_100319869 | Ga0068853_1003198692 | 173 |
| 33 | 3300005563 | Ga0068855_101193908 | Ga0068855_1011939082 | 173 |
| 34 | 3300005577 | Ga0068857_100002714 | Ga0068857_1000027144 | 173 |
| 35 | 3300005578 | Ga0068854_100106137 | Ga0068854_1001061372 | 173 |
| 36 | 3300005614 | Ga0068856_100341440 | Ga0068856_1003414402 | 173 |
| 37 | 3300005616 | Ga0068852_100001075 | Ga0068852_1000010752 | 173 |
| 38 | 3300009093 | Ga0105240_10024023 | Ga0105240_100240237 | 173 |
| 39 | 3300009551 | Ga0105238_10014571 | Ga0105238_100145713 | 173 |
| 40 | 3300009551 | Ga0105238_10032553 | Ga0105238_100325534 | 173 |
| 41 | 3300013104 | Ga0157370_10004709 | Ga0157370_100047093 | 173 |
| 42 | 3300013105 | Ga0157369_10009675 | Ga0157369_100096754 | 173 |
| 43 | 3300013307 | Ga0157372_10003091 | Ga0157372_100030915 | 173 |
| 44 | 3300013307 | Ga0157372_10031599 | Ga0157372_100315994 | 173 |
| 45 | 3300025904 | Ga0207647_10038808 | Ga0207647_100388082 | 173 |
| 46 | 3300025913 | Ga0207695_10062162 | Ga0207695_100621622 | 173 |
| 47 | 3300025914 | Ga0207671_10659129 | Ga0207671_106591291 | 173 |
| 48 | 3300025924 | Ga0207694_10048749 | Ga0207694_100487494 | 173 |
| 49 | 3300025924 | Ga0207694_10225605 | Ga0207694_102256052 | 173 |
| 50 | 3300025949 | Ga0207667_10005074 | Ga0207667_100050743 | 173 |
| 51 | 3300026041 | Ga0207639_10107675 | Ga0207639_101076752 | 173 |
| 52 | 3300026116 | Ga0207674_10002868 | Ga0207674_100028684 | 173 |
| 53 | 3300026142 | Ga0207698_10001106 | Ga0207698_100011065 | 173 |
| 54 | 3300036401 | Ga0373937_0056344 | Ga0373937_0056344_1017_1541 | 173 |
| 55 | 3300049588 | Ga0501072_0113928 | Ga0501072_0113928_318_848 | 173 |
| 56 | 3300001989 | JGI24739J22299_10000668 | JGI24739J22299_100006685 | 174 |
| 57 | 3300003215 | JGI25153J46596_10017468 | JGI25153J46596_100174683 | 174 |
| 58 | 3300003215 | JGI25153J46596_10038746 | JGI25153J46596_100387462 | 174 |
| 59 | 3300003316 | rootH1_10026419 | rootH1_100264193 | 174 |
| 60 | 3300003316 | rootH1_10042500 | rootH1_100425005 | 174 |
| 61 | 3300003316 | rootH1_10114680 | rootH1_101146802 | 174 |
| 62 | 3300003320 | rootH2_10009135 | rootH2_100091355 | 174 |
| 63 | 3300003320 | rootH2_10198307 | rootH2_101983073 | 174 |
| 64 | 3300003320 | rootH2_10245760 | rootH2_102457602 | 174 |
| 65 | 3300003322 | rootL2_10009405 | rootL2_100094057 | 174 |
| 66 | 3300003322 | rootL2_10351884 | rootL2_103518843 | 174 |
| 67 | 3300003323 | rootH1_10013674 | rootH1_1001367417 | 174 |
| 68 | 3300003323 | rootH1_10023975 | rootH1_100239753 | 174 |
| 69 | 3300003323 | rootH1_10059108 | rootH1_100591086 | 174 |
| 70 | 3300003771 | Ga0055526_1001778 | Ga0055526_100177813 | 174 |
| 71 | 3300003790 | Ga0055528_1005387 | Ga0055528_10053873 | 174 |
| 72 | 3300005262 | Ga0065165_1000743 | Ga0065165_100074319 | 174 |
| 73 | 3300005290 | Ga0065712_10003429 | Ga0065712_100034295 | 174 |
| 74 | 3300005290 | Ga0065712_10203039 | Ga0065712_102030392 | 174 |
| 75 | 3300005290 | Ga0065712_10225445 | Ga0065712_102254452 | 174 |
| 76 | 3300005293 | Ga0065715_10541427 | Ga0065715_105414272 | 174 |
| 77 | 3300005295 | Ga0065707_10127293 | Ga0065707_101272932 | 174 |
| 78 | 3300005295 | Ga0065707_10151855 | Ga0065707_101518552 | 174 |
| 79 | 3300005327 | Ga0070658_10001806 | Ga0070658_100018062 | 174 |
| 80 | 3300005327 | Ga0070658_10158236 | Ga0070658_101582362 | 174 |
| 81 | 3300005327 | Ga0070658_10514692 | Ga0070658_105146922 | 174 |
| 82 | 3300005327 | Ga0070658_10669447 | Ga0070658_106694472 | 174 |
| 83 | 3300005328 | Ga0070676_10276686 | Ga0070676_102766862 | 174 |
| 84 | 3300005329 | Ga0070683_100070528 | Ga0070683_1000705284 | 174 |
| 85 | 3300005329 | Ga0070683_100088214 | Ga0070683_1000882143 | 174 |
| 86 | 3300005329 | Ga0070683_100138049 | Ga0070683_1001380493 | 174 |
| 87 | 3300005329 | Ga0070683_100249682 | Ga0070683_1002496822 | 174 |
| 88 | 3300005329 | Ga0070683_100359040 | Ga0070683_1003590402 | 174 |
| 89 | 3300005330 | Ga0070690_100141430 | Ga0070690_1001414302 | 174 |
| 90 | 3300005330 | Ga0070690_100200776 | Ga0070690_1002007761 | 174 |
| 91 | 3300005331 | Ga0070670_100001415 | Ga0070670_1000014159 | 174 |
| 92 | 3300005331 | Ga0070670_100008938 | Ga0070670_1000089386 | 174 |
| 93 | 3300005331 | Ga0070670_100392659 | Ga0070670_1003926592 | 174 |
| 94 | 3300005333 | Ga0070677_10216072 | Ga0070677_102160722 | 174 |
| 95 | 3300005334 | Ga0068869_100076231 | Ga0068869_1000762312 | 174 |
| 96 | 3300005334 | Ga0068869_100256049 | Ga0068869_1002560492 | 174 |
| 97 | 3300005334 | Ga0068869_100919473 | Ga0068869_1009194731 | 174 |
| 98 | 3300005335 | Ga0070666_10003698 | Ga0070666_100036987 | 174 |
| 99 | 3300005335 | Ga0070666_10039583 | Ga0070666_100395832 | 174 |
| 100 | 3300005335 | Ga0070666_10128998 | Ga0070666_101289982 | 174 |
| 101 | 3300005335 | Ga0070666_10289301 | Ga0070666_102893012 | 174 |
| 102 | 3300005335 | Ga0070666_10866922 | Ga0070666_108669221 | 174 |
| 103 | 3300005336 | Ga0070680_100003404 | Ga0070680_1000034045 | 174 |
| 104 | 3300005336 | Ga0070680_100031337 | Ga0070680_1000313373 | 174 |
| 105 | 3300005336 | Ga0070680_100055741 | Ga0070680_1000557414 | 174 |
| 106 | 3300005336 | Ga0070680_100652891 | Ga0070680_1006528911 | 174 |
| 107 | 3300005337 | Ga0070682_100001128 | Ga0070682_10000112813 | 174 |
| 108 | 3300005337 | Ga0070682_100526998 | Ga0070682_1005269982 | 174 |
| 109 | 3300005338 | Ga0068868_100141096 | Ga0068868_1001410961 | 174 |
| 110 | 3300005338 | Ga0068868_100298943 | Ga0068868_1002989432 | 174 |
| 111 | 3300005339 | Ga0070660_100216639 | Ga0070660_1002166392 | 174 |
| 112 | 3300005339 | Ga0070660_100332713 | Ga0070660_1003327132 | 174 |
| 113 | 3300005340 | Ga0070689_100050174 | Ga0070689_1000501741 | 174 |
| 114 | 3300005340 | Ga0070689_100066828 | Ga0070689_1000668282 | 174 |
| 115 | 3300005343 | Ga0070687_100096435 | Ga0070687_1000964352 | 174 |
| 116 | 3300005343 | Ga0070687_100289222 | Ga0070687_1002892221 | 174 |
| 117 | 3300005343 | Ga0070687_100585007 | Ga0070687_1005850071 | 174 |
| 118 | 3300005344 | Ga0070661_100016755 | Ga0070661_1000167553 | 174 |
| 119 | 3300005344 | Ga0070661_100038120 | Ga0070661_1000381203 | 174 |
| 120 | 3300005344 | Ga0070661_100237114 | Ga0070661_1002371142 | 174 |
| 121 | 3300005345 | Ga0070692_10001670 | Ga0070692_100016705 | 174 |
| 122 | 3300005345 | Ga0070692_10097663 | Ga0070692_100976632 | 174 |
| 123 | 3300005345 | Ga0070692_10115762 | Ga0070692_101157622 | 174 |
| 124 | 3300005347 | Ga0070668_100148853 | Ga0070668_1001488533 | 174 |
| 125 | 3300005353 | Ga0070669_100322897 | Ga0070669_1003228972 | 174 |
| 126 | 3300005354 | Ga0070675_100004691 | Ga0070675_1000046913 | 174 |
| 127 | 3300005354 | Ga0070675_100052533 | Ga0070675_1000525331 | 174 |
| 128 | 3300005355 | Ga0070671_100144489 | Ga0070671_1001444891 | 174 |
| 129 | 3300005364 | Ga0070673_101017855 | Ga0070673_1010178551 | 174 |
| 130 | 3300005365 | Ga0070688_100035907 | Ga0070688_1000359072 | 174 |
| 131 | 3300005365 | Ga0070688_100130147 | Ga0070688_1001301471 | 174 |
| 132 | 3300005366 | Ga0070659_100042032 | Ga0070659_1000420322 | 174 |
| 133 | 3300005366 | Ga0070659_100052576 | Ga0070659_1000525763 | 174 |
| 134 | 3300005366 | Ga0070659_100053468 | Ga0070659_1000534684 | 174 |
| 135 | 3300005366 | Ga0070659_100346043 | Ga0070659_1003460432 | 174 |
| 136 | 3300005367 | Ga0070667_100008784 | Ga0070667_1000087846 | 174 |
| 137 | 3300005367 | Ga0070667_100058481 | Ga0070667_1000584813 | 174 |
| 138 | 3300005434 | Ga0070709_10024768 | Ga0070709_100247683 | 174 |
| 139 | 3300005434 | Ga0070709_10268707 | Ga0070709_102687072 | 174 |
| 140 | 3300005435 | Ga0070714_100142792 | Ga0070714_1001427922 | 174 |
| 141 | 3300005436 | Ga0070713_100188096 | Ga0070713_1001880962 | 174 |
| 142 | 3300005437 | Ga0070710_10569378 | Ga0070710_105693781 | 174 |
| 143 | 3300005438 | Ga0070701_10424229 | Ga0070701_104242292 | 174 |
| 144 | 3300005439 | Ga0070711_100242038 | Ga0070711_1002420381 | 174 |
| 145 | 3300005440 | Ga0070705_100230921 | Ga0070705_1002309211 | 174 |
| 146 | 3300005440 | Ga0070705_100792472 | Ga0070705_1007924721 | 174 |
| 147 | 3300005441 | Ga0070700_100061976 | Ga0070700_1000619763 | 174 |
| 148 | 3300005441 | Ga0070700_100166894 | Ga0070700_1001668942 | 174 |
| 149 | 3300005444 | Ga0070694_100433733 | Ga0070694_1004337332 | 174 |
| 150 | 3300005455 | Ga0070663_100273411 | Ga0070663_1002734112 | 174 |
| 151 | 3300005457 | Ga0070662_100002433 | Ga0070662_1000024334 | 174 |
| 152 | 3300005458 | Ga0070681_10156267 | Ga0070681_101562671 | 174 |
| 153 | 3300005458 | Ga0070681_10218904 | Ga0070681_102189043 | 174 |
| 154 | 3300005458 | Ga0070681_10337431 | Ga0070681_103374311 | 174 |
| 155 | 3300005459 | Ga0068867_100215898 | Ga0068867_1002158982 | 174 |
| 156 | 3300005459 | Ga0068867_100394511 | Ga0068867_1003945112 | 174 |
| 157 | 3300005459 | Ga0068867_100416719 | Ga0068867_1004167193 | 174 |
| 158 | 3300005466 | Ga0070685_10001005 | Ga0070685_1000100516 | 174 |
| 159 | 3300005466 | Ga0070685_10120318 | Ga0070685_101203182 | 174 |
| 160 | 3300005471 | Ga0070698_100023211 | Ga0070698_1000232117 | 174 |
| 161 | 3300005471 | Ga0070698_100040970 | Ga0070698_1000409706 | 174 |
| 162 | 3300005530 | Ga0070679_100010932 | Ga0070679_1000109325 | 174 |
| 163 | 3300005530 | Ga0070679_100034334 | Ga0070679_1000343344 | 174 |
| 164 | 3300005535 | Ga0070684_100053367 | Ga0070684_1000533673 | 174 |
| 165 | 3300005535 | Ga0070684_100074361 | Ga0070684_1000743611 | 174 |
| 166 | 3300005535 | Ga0070684_100273642 | Ga0070684_1002736423 | 174 |
| 167 | 3300005535 | Ga0070684_100298304 | Ga0070684_1002983042 | 174 |
| 168 | 3300005539 | Ga0068853_100016505 | Ga0068853_1000165053 | 174 |
| 169 | 3300005539 | Ga0068853_100111264 | Ga0068853_1001112644 | 174 |
| 170 | 3300005539 | Ga0068853_100369617 | Ga0068853_1003696172 | 174 |
| 171 | 3300005543 | Ga0070672_100069878 | Ga0070672_1000698783 | 174 |
| 172 | 3300005545 | Ga0070695_100022307 | Ga0070695_1000223073 | 174 |
| 173 | 3300005545 | Ga0070695_100292577 | Ga0070695_1002925772 | 174 |
| 174 | 3300005547 | Ga0070693_100002364 | Ga0070693_1000023641 | 174 |
| 175 | 3300005563 | Ga0068855_100000060 | Ga0068855_100000060129 | 174 |
| 176 | 3300005563 | Ga0068855_100004484 | Ga0068855_10000448418 | 174 |
| 177 | 3300005563 | Ga0068855_100074144 | Ga0068855_1000741444 | 174 |
| 178 | 3300005563 | Ga0068855_100208820 | Ga0068855_1002088201 | 174 |
| 179 | 3300005563 | Ga0068855_100733134 | Ga0068855_1007331342 | 174 |
| 180 | 3300005564 | Ga0070664_100006042 | Ga0070664_1000060422 | 174 |
| 181 | 3300005564 | Ga0070664_100008429 | Ga0070664_1000084293 | 174 |
| 182 | 3300005564 | Ga0070664_100418596 | Ga0070664_1004185962 | 174 |
| 183 | 3300005577 | Ga0068857_100007359 | Ga0068857_1000073596 | 174 |
| 184 | 3300005577 | Ga0068857_100050563 | Ga0068857_1000505633 | 174 |
| 185 | 3300005614 | Ga0068856_100155654 | Ga0068856_1001556542 | 174 |
| 186 | 3300005615 | Ga0070702_100099664 | Ga0070702_1000996642 | 174 |
| 187 | 3300005616 | Ga0068852_100034415 | Ga0068852_1000344151 | 174 |
| 188 | 3300005616 | Ga0068852_100055730 | Ga0068852_1000557307 | 174 |
| 189 | 3300005616 | Ga0068852_100079183 | Ga0068852_1000791832 | 174 |
| 190 | 3300005616 | Ga0068852_100353299 | Ga0068852_1003532992 | 174 |
| 191 | 3300005616 | Ga0068852_100458491 | Ga0068852_1004584913 | 174 |
| 192 | 3300005617 | Ga0068859_100288969 | Ga0068859_1002889692 | 174 |
| 193 | 3300005617 | Ga0068859_100440802 | Ga0068859_1004408023 | 174 |
| 194 | 3300005617 | Ga0068859_101428209 | Ga0068859_1014282091 | 174 |
| 195 | 3300005617 | Ga0068859_101498598 | Ga0068859_1014985982 | 174 |
| 196 | 3300005618 | Ga0068864_100007549 | Ga0068864_1000075492 | 174 |
| 197 | 3300005618 | Ga0068864_100030994 | Ga0068864_1000309944 | 174 |
| 198 | 3300005618 | Ga0068864_100163633 | Ga0068864_1001636333 | 174 |
| 199 | 3300005618 | Ga0068864_100533394 | Ga0068864_1005333941 | 174 |
| 200 | 3300005719 | Ga0068861_100327784 | Ga0068861_1003277842 | 174 |
| 201 | 3300005719 | Ga0068861_101151723 | Ga0068861_1011517231 | 174 |
| 202 | 3300005834 | Ga0068851_10161827 | Ga0068851_101618271 | 174 |
| 203 | 3300005834 | Ga0068851_10186888 | Ga0068851_101868882 | 174 |
| 204 | 3300005840 | Ga0068870_10010422 | Ga0068870_100104222 | 174 |
| 205 | 3300005841 | Ga0068863_100002341 | Ga0068863_1000023416 | 174 |
| 206 | 3300005841 | Ga0068863_100013943 | Ga0068863_1000139432 | 174 |
| 207 | 3300005841 | Ga0068863_100056997 | Ga0068863_1000569972 | 174 |
| 208 | 3300005841 | Ga0068863_100206384 | Ga0068863_1002063843 | 174 |
| 209 | 3300005841 | Ga0068863_100222254 | Ga0068863_1002222542 | 174 |
| 210 | 3300005841 | Ga0068863_100267983 | Ga0068863_1002679832 | 174 |
| 211 | 3300005841 | Ga0068863_100300806 | Ga0068863_1003008061 | 174 |
| 212 | 3300005842 | Ga0068858_100176439 | Ga0068858_1001764393 | 174 |
| 213 | 3300005843 | Ga0068860_100001707 | Ga0068860_10000170713 | 174 |
| 214 | 3300005843 | Ga0068860_100005370 | Ga0068860_10000537010 | 174 |
| 215 | 3300005843 | Ga0068860_100007093 | Ga0068860_1000070935 | 174 |
| 216 | 3300005843 | Ga0068860_100044488 | Ga0068860_1000444883 | 174 |
| 217 | 3300005843 | Ga0068860_100162847 | Ga0068860_1001628472 | 174 |
| 218 | 3300005843 | Ga0068860_100486288 | Ga0068860_1004862883 | 174 |
| 219 | 3300005843 | Ga0068860_101033795 | Ga0068860_1010337951 | 174 |
| 220 | 3300005844 | Ga0068862_100018573 | Ga0068862_1000185735 | 174 |
| 221 | 3300005844 | Ga0068862_100020358 | Ga0068862_1000203583 | 174 |
| 222 | 3300005844 | Ga0068862_100179383 | Ga0068862_1001793831 | 174 |
| 223 | 3300005937 | Ga0081455_10039482 | Ga0081455_100394823 | 174 |
| 224 | 3300005937 | Ga0081455_10491735 | Ga0081455_104917352 | 174 |
| 225 | 3300005985 | Ga0081539_10004646 | Ga0081539_100046467 | 174 |
| 226 | 3300006173 | Ga0070716_100104716 | Ga0070716_1001047162 | 174 |
| 227 | 3300006195 | Ga0075366_10136747 | Ga0075366_101367472 | 174 |
| 228 | 3300006195 | Ga0075366_10182486 | Ga0075366_101824861 | 174 |
| 229 | 3300006237 | Ga0097621_100001243 | Ga0097621_10000124320 | 174 |
| 230 | 3300006237 | Ga0097621_100278979 | Ga0097621_1002789792 | 174 |
| 231 | 3300006237 | Ga0097621_100332618 | Ga0097621_1003326182 | 174 |
| 232 | 3300006358 | Ga0068871_100001056 | Ga0068871_1000010562 | 174 |
| 233 | 3300006358 | Ga0068871_100022666 | Ga0068871_1000226664 | 174 |
| 234 | 3300006358 | Ga0068871_100151578 | Ga0068871_1001515783 | 174 |
| 235 | 3300006844 | Ga0075428_100019466 | Ga0075428_1000194662 | 174 |
| 236 | 3300006844 | Ga0075428_100088757 | Ga0075428_1000887572 | 174 |
| 237 | 3300006852 | Ga0075433_11370241 | Ga0075433_113702411 | 174 |
| 238 | 3300006880 | Ga0075429_100000543 | Ga0075429_1000005436 | 174 |
| 239 | 3300006880 | Ga0075429_100695658 | Ga0075429_1006956581 | 174 |
| 240 | 3300006881 | Ga0068865_100320885 | Ga0068865_1003208852 | 174 |
| 241 | 3300006931 | Ga0097620_100288974 | Ga0097620_1002889742 | 174 |
| 242 | 3300006931 | Ga0097620_100440806 | Ga0097620_1004408062 | 174 |
| 243 | 3300006931 | Ga0097620_101428185 | Ga0097620_1014281851 | 174 |
| 244 | 3300009093 | Ga0105240_10002694 | Ga0105240_100026944 | 174 |
| 245 | 3300009093 | Ga0105240_10022198 | Ga0105240_100221985 | 174 |
| 246 | 3300009093 | Ga0105240_10302085 | Ga0105240_103020852 | 174 |
| 247 | 3300009093 | Ga0105240_10463407 | Ga0105240_104634072 | 174 |
| 248 | 3300009093 | Ga0105240_10742673 | Ga0105240_107426732 | 174 |
| 249 | 3300009094 | Ga0111539_10196595 | Ga0111539_101965953 | 174 |
| 250 | 3300009098 | Ga0105245_10036403 | Ga0105245_100364033 | 174 |
| 251 | 3300009098 | Ga0105245_10100557 | Ga0105245_101005574 | 174 |
| 252 | 3300009098 | Ga0105245_10341086 | Ga0105245_103410862 | 174 |
| 253 | 3300009101 | Ga0105247_10001522 | Ga0105247_1000152212 | 174 |
| 254 | 3300009101 | Ga0105247_10538580 | Ga0105247_105385802 | 174 |
| 255 | 3300009147 | Ga0114129_10009960 | Ga0114129_100099603 | 174 |
| 256 | 3300009147 | Ga0114129_10384946 | Ga0114129_103849462 | 174 |
| 257 | 3300009174 | Ga0105241_10682608 | Ga0105241_106826081 | 174 |
| 258 | 3300009174 | Ga0105241_11506635 | Ga0105241_115066351 | 174 |
| 259 | 3300009176 | Ga0105242_10002222 | Ga0105242_1000222214 | 174 |
| 260 | 3300009176 | Ga0105242_10008873 | Ga0105242_100088732 | 174 |
| 261 | 3300009176 | Ga0105242_10016049 | Ga0105242_100160494 | 174 |
| 262 | 3300009176 | Ga0105242_10018381 | Ga0105242_100183814 | 174 |
| 263 | 3300009177 | Ga0105248_10019425 | Ga0105248_100194254 | 174 |
| 264 | 3300009177 | Ga0105248_10292300 | Ga0105248_102923001 | 174 |
| 265 | 3300009177 | Ga0105248_10336221 | Ga0105248_103362212 | 174 |
| 266 | 3300009177 | Ga0105248_11027988 | Ga0105248_110279882 | 174 |
| 267 | 3300009545 | Ga0105237_10000510 | Ga0105237_1000051022 | 174 |
| 268 | 3300009545 | Ga0105237_10000671 | Ga0105237_1000067142 | 174 |
| 269 | 3300009545 | Ga0105237_10012785 | Ga0105237_100127857 | 174 |
| 270 | 3300009545 | Ga0105237_10040319 | Ga0105237_100403191 | 174 |
| 271 | 3300009545 | Ga0105237_10147075 | Ga0105237_101470753 | 174 |
| 272 | 3300009545 | Ga0105237_10254411 | Ga0105237_102544112 | 174 |
| 273 | 3300009545 | Ga0105237_10464791 | Ga0105237_104647912 | 174 |
| 274 | 3300009553 | Ga0105249_10010190 | Ga0105249_100101904 | 174 |
| 275 | 3300009553 | Ga0105249_10189368 | Ga0105249_101893684 | 174 |
| 276 | 3300009553 | Ga0105249_10195359 | Ga0105249_101953593 | 174 |
| 277 | 3300009553 | Ga0105249_10229989 | Ga0105249_102299893 | 174 |
| 278 | 3300009553 | Ga0105249_10336637 | Ga0105249_103366372 | 174 |
| 279 | 3300010375 | Ga0105239_10000017 | Ga0105239_10000017112 | 174 |
| 280 | 3300010375 | Ga0105239_10005627 | Ga0105239_100056279 | 174 |
| 281 | 3300010375 | Ga0105239_10014092 | Ga0105239_100140922 | 174 |
| 282 | 3300010375 | Ga0105239_10026291 | Ga0105239_100262913 | 174 |
| 283 | 3300010375 | Ga0105239_10034852 | Ga0105239_100348524 | 174 |
| 284 | 3300010375 | Ga0105239_10468776 | Ga0105239_104687762 | 174 |
| 285 | 3300010375 | Ga0105239_10742893 | Ga0105239_107428933 | 174 |
| 286 | 3300010375 | Ga0105239_10844384 | Ga0105239_108443841 | 174 |
| 287 | 3300011119 | Ga0105246_10474736 | Ga0105246_104747362 | 174 |
| 288 | 3300013100 | Ga0157373_10018597 | Ga0157373_100185974 | 174 |
| 289 | 3300013100 | Ga0157373_10132114 | Ga0157373_101321143 | 174 |
| 290 | 3300013100 | Ga0157373_10404523 | Ga0157373_104045232 | 174 |
| 291 | 3300013102 | Ga0157371_10008475 | Ga0157371_100084753 | 174 |
| 292 | 3300013102 | Ga0157371_10054622 | Ga0157371_100546223 | 174 |
| 293 | 3300013102 | Ga0157371_10152078 | Ga0157371_101520783 | 174 |
| 294 | 3300013102 | Ga0157371_10161997 | Ga0157371_101619972 | 174 |
| 295 | 3300013102 | Ga0157371_10669884 | Ga0157371_106698841 | 174 |
| 296 | 3300013104 | Ga0157370_10127132 | Ga0157370_101271324 | 174 |
| 297 | 3300013104 | Ga0157370_10533512 | Ga0157370_105335122 | 174 |
| 298 | 3300013105 | Ga0157369_10071553 | Ga0157369_100715534 | 174 |
| 299 | 3300013105 | Ga0157369_10127102 | Ga0157369_101271024 | 174 |
| 300 | 3300013105 | Ga0157369_10512730 | Ga0157369_105127302 | 174 |
| 301 | 3300013105 | Ga0157369_10971630 | Ga0157369_109716301 | 174 |
| 302 | 3300013296 | Ga0157374_10005226 | Ga0157374_100052265 | 174 |
| 303 | 3300013296 | Ga0157374_10467475 | Ga0157374_104674752 | 174 |
| 304 | 3300013296 | Ga0157374_10471311 | Ga0157374_104713112 | 174 |
| 305 | 3300013296 | Ga0157374_10983919 | Ga0157374_109839192 | 174 |
| 306 | 3300013297 | Ga0157378_10006930 | Ga0157378_1000693011 | 174 |
| 307 | 3300013297 | Ga0157378_10010437 | Ga0157378_1001043711 | 174 |
| 308 | 3300013297 | Ga0157378_10062311 | Ga0157378_100623112 | 174 |
| 309 | 3300013306 | Ga0163162_10001262 | Ga0163162_1000126212 | 174 |
| 310 | 3300013306 | Ga0163162_10045726 | Ga0163162_100457263 | 174 |
| 311 | 3300013306 | Ga0163162_10111389 | Ga0163162_101113893 | 174 |
| 312 | 3300013306 | Ga0163162_10684131 | Ga0163162_106841312 | 174 |
| 313 | 3300013306 | Ga0163162_10717936 | Ga0163162_107179362 | 174 |
| 314 | 3300013306 | Ga0163162_11573770 | Ga0163162_115737701 | 174 |
| 315 | 3300013307 | Ga0157372_10017350 | Ga0157372_100173503 | 174 |
| 316 | 3300013307 | Ga0157372_10035124 | Ga0157372_100351242 | 174 |
| 317 | 3300013307 | Ga0157372_10045621 | Ga0157372_100456213 | 174 |
| 318 | 3300013307 | Ga0157372_10224698 | Ga0157372_102246983 | 174 |
| 319 | 3300013307 | Ga0157372_10446768 | Ga0157372_104467682 | 174 |
| 320 | 3300013307 | Ga0157372_10829557 | Ga0157372_108295571 | 174 |
| 321 | 3300013307 | Ga0157372_10939531 | Ga0157372_109395311 | 174 |
| 322 | 3300013307 | Ga0157372_11403028 | Ga0157372_114030281 | 174 |
| 323 | 3300013308 | Ga0157375_10000749 | Ga0157375_1000074922 | 174 |
| 324 | 3300013308 | Ga0157375_10004593 | Ga0157375_100045934 | 174 |
| 325 | 3300013308 | Ga0157375_10034519 | Ga0157375_100345192 | 174 |
| 326 | 3300013308 | Ga0157375_10072815 | Ga0157375_100728155 | 174 |
| 327 | 3300013308 | Ga0157375_11704014 | Ga0157375_117040141 | 174 |
| 328 | 3300014325 | Ga0163163_10000494 | Ga0163163_100004949 | 174 |
| 329 | 3300014325 | Ga0163163_10031353 | Ga0163163_100313533 | 174 |
| 330 | 3300014325 | Ga0163163_10178674 | Ga0163163_101786742 | 174 |
| 331 | 3300014325 | Ga0163163_10345214 | Ga0163163_103452142 | 174 |
| 332 | 3300014325 | Ga0163163_10787281 | Ga0163163_107872812 | 174 |
| 333 | 3300014326 | Ga0157380_10016089 | Ga0157380_100160895 | 174 |
| 334 | 3300014326 | Ga0157380_10024856 | Ga0157380_100248562 | 174 |
| 335 | 3300014326 | Ga0157380_10063975 | Ga0157380_100639752 | 174 |
| 336 | 3300014326 | Ga0157380_10830028 | Ga0157380_108300282 | 174 |
| 337 | 3300014326 | Ga0157380_11912065 | Ga0157380_119120651 | 174 |
| 338 | 3300014745 | Ga0157377_10035528 | Ga0157377_100355282 | 174 |
| 339 | 3300014745 | Ga0157377_10270198 | Ga0157377_102701982 | 174 |
| 340 | 3300014968 | Ga0157379_10106881 | Ga0157379_101068812 | 174 |
| 341 | 3300014969 | Ga0157376_10000597 | Ga0157376_1000059711 | 174 |
| 342 | 3300014969 | Ga0157376_10024302 | Ga0157376_100243021 | 174 |
| 343 | 3300014969 | Ga0157376_10067800 | Ga0157376_100678004 | 174 |
| 344 | 3300015262 | Ga0182007_10029863 | Ga0182007_100298632 | 174 |
| 345 | 3300015262 | Ga0182007_10147835 | Ga0182007_101478352 | 174 |
| 346 | 3300017792 | Ga0163161_10001497 | Ga0163161_1000149711 | 174 |
| 347 | 3300017792 | Ga0163161_10058586 | Ga0163161_100585864 | 174 |
| 348 | 3300025261 | Ga0209233_1011331 | Ga0209233_10113312 | 174 |
| 349 | 3300025272 | Ga0209455_1004066 | Ga0209455_10040663 | 174 |
| 350 | 3300025273 | Ga0209673_1000438 | Ga0209673_100043824 | 174 |
| 351 | 3300025295 | Ga0209564_1000606 | Ga0209564_100060616 | 174 |
| 352 | 3300025295 | Ga0209564_1003267 | Ga0209564_100326713 | 174 |
| 353 | 3300025297 | Ga0209758_1003210 | Ga0209758_100321015 | 174 |
| 354 | 3300025297 | Ga0209758_1005303 | Ga0209758_10053037 | 174 |
| 355 | 3300025298 | Ga0209050_1000892 | Ga0209050_100089233 | 174 |
| 356 | 3300025302 | Ga0207426_1001400 | Ga0207426_100140010 | 174 |
| 357 | 3300025302 | Ga0207426_1007438 | Ga0207426_10074385 | 174 |
| 358 | 3300025304 | Ga0209257_1057924 | Ga0209257_10579242 | 174 |
| 359 | 3300025315 | Ga0207697_10048015 | Ga0207697_100480152 | 174 |
| 360 | 3300025321 | Ga0207656_10134494 | Ga0207656_101344942 | 174 |
| 361 | 3300025321 | Ga0207656_10137980 | Ga0207656_101379801 | 174 |
| 362 | 3300025898 | Ga0207692_10324150 | Ga0207692_103241502 | 174 |
| 363 | 3300025900 | Ga0207710_10011013 | Ga0207710_100110134 | 174 |
| 364 | 3300025901 | Ga0207688_10058063 | Ga0207688_100580631 | 174 |
| 365 | 3300025903 | Ga0207680_10016371 | Ga0207680_100163712 | 174 |
| 366 | 3300025903 | Ga0207680_10085108 | Ga0207680_100851082 | 174 |
| 367 | 3300025903 | Ga0207680_10089515 | Ga0207680_100895152 | 174 |
| 368 | 3300025903 | Ga0207680_10319878 | Ga0207680_103198781 | 174 |
| 369 | 3300025904 | Ga0207647_10124748 | Ga0207647_101247481 | 174 |
| 370 | 3300025904 | Ga0207647_10148085 | Ga0207647_101480852 | 174 |
| 371 | 3300025904 | Ga0207647_10257601 | Ga0207647_102576011 | 174 |
| 372 | 3300025907 | Ga0207645_10163199 | Ga0207645_101631992 | 174 |
| 373 | 3300025908 | Ga0207643_10009608 | Ga0207643_100096083 | 174 |
| 374 | 3300025908 | Ga0207643_10147201 | Ga0207643_101472011 | 174 |
| 375 | 3300025908 | Ga0207643_10550565 | Ga0207643_105505651 | 174 |
| 376 | 3300025909 | Ga0207705_10000623 | Ga0207705_1000062317 | 174 |
| 377 | 3300025909 | Ga0207705_10020019 | Ga0207705_100200194 | 174 |
| 378 | 3300025909 | Ga0207705_10025587 | Ga0207705_100255875 | 174 |
| 379 | 3300025911 | Ga0207654_10434925 | Ga0207654_104349252 | 174 |
| 380 | 3300025912 | Ga0207707_10043800 | Ga0207707_100438002 | 174 |
| 381 | 3300025912 | Ga0207707_10046354 | Ga0207707_100463541 | 174 |
| 382 | 3300025912 | Ga0207707_10329093 | Ga0207707_103290933 | 174 |
| 383 | 3300025913 | Ga0207695_10021713 | Ga0207695_100217136 | 174 |
| 384 | 3300025913 | Ga0207695_10344723 | Ga0207695_103447232 | 174 |
| 385 | 3300025914 | Ga0207671_10006613 | Ga0207671_1000661310 | 174 |
| 386 | 3300025914 | Ga0207671_10007833 | Ga0207671_100078339 | 174 |
| 387 | 3300025914 | Ga0207671_10008101 | Ga0207671_100081014 | 174 |
| 388 | 3300025914 | Ga0207671_10017382 | Ga0207671_100173822 | 174 |
| 389 | 3300025914 | Ga0207671_10141186 | Ga0207671_101411862 | 174 |
| 390 | 3300025914 | Ga0207671_10675301 | Ga0207671_106753011 | 174 |
| 391 | 3300025914 | Ga0207671_10744430 | Ga0207671_107444301 | 174 |
| 392 | 3300025916 | Ga0207663_10878754 | Ga0207663_108787541 | 174 |
| 393 | 3300025917 | Ga0207660_10171748 | Ga0207660_101717481 | 174 |
| 394 | 3300025917 | Ga0207660_10172569 | Ga0207660_101725692 | 174 |
| 395 | 3300025917 | Ga0207660_10278106 | Ga0207660_102781062 | 174 |
| 396 | 3300025917 | Ga0207660_10632361 | Ga0207660_106323612 | 174 |
| 397 | 3300025918 | Ga0207662_10054656 | Ga0207662_100546563 | 174 |
| 398 | 3300025918 | Ga0207662_10097097 | Ga0207662_100970972 | 174 |
| 399 | 3300025918 | Ga0207662_10167762 | Ga0207662_101677622 | 174 |
| 400 | 3300025918 | Ga0207662_10942984 | Ga0207662_109429841 | 174 |
| 401 | 3300025919 | Ga0207657_10035305 | Ga0207657_100353055 | 174 |
| 402 | 3300025919 | Ga0207657_10037298 | Ga0207657_100372984 | 174 |
| 403 | 3300025919 | Ga0207657_10114906 | Ga0207657_101149063 | 174 |
| 404 | 3300025920 | Ga0207649_10009530 | Ga0207649_100095303 | 174 |
| 405 | 3300025920 | Ga0207649_10105595 | Ga0207649_101055952 | 174 |
| 406 | 3300025920 | Ga0207649_10217756 | Ga0207649_102177562 | 174 |
| 407 | 3300025920 | Ga0207649_10638055 | Ga0207649_106380551 | 174 |
| 408 | 3300025921 | Ga0207652_10663297 | Ga0207652_106632971 | 174 |
| 409 | 3300025921 | Ga0207652_10785280 | Ga0207652_107852802 | 174 |
| 410 | 3300025923 | Ga0207681_10052429 | Ga0207681_100524292 | 174 |
| 411 | 3300025923 | Ga0207681_10265550 | Ga0207681_102655502 | 174 |
| 412 | 3300025924 | Ga0207694_10375432 | Ga0207694_103754322 | 174 |
| 413 | 3300025925 | Ga0207650_10007105 | Ga0207650_100071053 | 174 |
| 414 | 3300025925 | Ga0207650_10038266 | Ga0207650_100382662 | 174 |
| 415 | 3300025925 | Ga0207650_10469988 | Ga0207650_104699882 | 174 |
| 416 | 3300025925 | Ga0207650_10525609 | Ga0207650_105256091 | 174 |
| 417 | 3300025926 | Ga0207659_11008834 | Ga0207659_110088341 | 174 |
| 418 | 3300025927 | Ga0207687_10067073 | Ga0207687_100670733 | 174 |
| 419 | 3300025927 | Ga0207687_10365474 | Ga0207687_103654742 | 174 |
| 420 | 3300025928 | Ga0207700_10131531 | Ga0207700_101315311 | 174 |
| 421 | 3300025929 | Ga0207664_10617332 | Ga0207664_106173322 | 174 |
| 422 | 3300025932 | Ga0207690_10033132 | Ga0207690_100331323 | 174 |
| 423 | 3300025932 | Ga0207690_10204691 | Ga0207690_102046912 | 174 |
| 424 | 3300025932 | Ga0207690_10251349 | Ga0207690_102513492 | 174 |
| 425 | 3300025933 | Ga0207706_10015151 | Ga0207706_100151514 | 174 |
| 426 | 3300025933 | Ga0207706_10105001 | Ga0207706_101050013 | 174 |
| 427 | 3300025934 | Ga0207686_10003705 | Ga0207686_1000370510 | 174 |
| 428 | 3300025934 | Ga0207686_10011836 | Ga0207686_100118363 | 174 |
| 429 | 3300025934 | Ga0207686_10015383 | Ga0207686_100153832 | 174 |
| 430 | 3300025936 | Ga0207670_10189647 | Ga0207670_101896472 | 174 |
| 431 | 3300025936 | Ga0207670_10862016 | Ga0207670_108620161 | 174 |
| 432 | 3300025940 | Ga0207691_10050906 | Ga0207691_100509066 | 174 |
| 433 | 3300025940 | Ga0207691_10145862 | Ga0207691_101458624 | 174 |
| 434 | 3300025940 | Ga0207691_10375299 | Ga0207691_103752992 | 174 |
| 435 | 3300025940 | Ga0207691_10508998 | Ga0207691_105089981 | 174 |
| 436 | 3300025941 | Ga0207711_10021893 | Ga0207711_100218935 | 174 |
| 437 | 3300025941 | Ga0207711_10801674 | Ga0207711_108016742 | 174 |
| 438 | 3300025942 | Ga0207689_10057603 | Ga0207689_100576032 | 174 |
| 439 | 3300025942 | Ga0207689_10350294 | Ga0207689_103502942 | 174 |
| 440 | 3300025942 | Ga0207689_10947726 | Ga0207689_109477262 | 174 |
| 441 | 3300025944 | Ga0207661_10000594 | Ga0207661_100005945 | 174 |
| 442 | 3300025944 | Ga0207661_10055980 | Ga0207661_100559804 | 174 |
| 443 | 3300025944 | Ga0207661_10483539 | Ga0207661_104835392 | 174 |
| 444 | 3300025944 | Ga0207661_10825437 | Ga0207661_108254372 | 174 |
| 445 | 3300025945 | Ga0207679_10029988 | Ga0207679_100299883 | 174 |
| 446 | 3300025945 | Ga0207679_10058482 | Ga0207679_100584821 | 174 |
| 447 | 3300025949 | Ga0207667_10000033 | Ga0207667_10000033161 | 174 |
| 448 | 3300025949 | Ga0207667_10003946 | Ga0207667_1000394618 | 174 |
| 449 | 3300025949 | Ga0207667_10049705 | Ga0207667_100497054 | 174 |
| 450 | 3300025949 | Ga0207667_10272670 | Ga0207667_102726701 | 174 |
| 451 | 3300025960 | Ga0207651_10388041 | Ga0207651_103880411 | 174 |
| 452 | 3300025961 | Ga0207712_10012709 | Ga0207712_100127096 | 174 |
| 453 | 3300025961 | Ga0207712_10033324 | Ga0207712_100333243 | 174 |
| 454 | 3300025961 | Ga0207712_10221634 | Ga0207712_102216342 | 174 |
| 455 | 3300025972 | Ga0207668_10014555 | Ga0207668_100145553 | 174 |
| 456 | 3300025972 | Ga0207668_10433139 | Ga0207668_104331392 | 174 |
| 457 | 3300025972 | Ga0207668_10485214 | Ga0207668_104852141 | 174 |
| 458 | 3300025981 | Ga0207640_10242465 | Ga0207640_102424652 | 174 |
| 459 | 3300025986 | Ga0207658_10009682 | Ga0207658_100096826 | 174 |
| 460 | 3300025986 | Ga0207658_10014787 | Ga0207658_100147877 | 174 |
| 461 | 3300025986 | Ga0207658_10080772 | Ga0207658_100807722 | 174 |
| 462 | 3300025986 | Ga0207658_10265625 | Ga0207658_102656252 | 174 |
| 463 | 3300026023 | Ga0207677_10077921 | Ga0207677_100779213 | 174 |
| 464 | 3300026035 | Ga0207703_10250001 | Ga0207703_102500012 | 174 |
| 465 | 3300026035 | Ga0207703_11202853 | Ga0207703_112028531 | 174 |
| 466 | 3300026041 | Ga0207639_10142487 | Ga0207639_101424871 | 174 |
| 467 | 3300026041 | Ga0207639_10345740 | Ga0207639_103457402 | 174 |
| 468 | 3300026067 | Ga0207678_10063153 | Ga0207678_100631531 | 174 |
| 469 | 3300026075 | Ga0207708_10117756 | Ga0207708_101177562 | 174 |
| 470 | 3300026075 | Ga0207708_10211805 | Ga0207708_102118052 | 174 |
| 471 | 3300026075 | Ga0207708_10316367 | Ga0207708_103163672 | 174 |
| 472 | 3300026078 | Ga0207702_10015080 | Ga0207702_100150805 | 174 |
| 473 | 3300026078 | Ga0207702_10047023 | Ga0207702_100470232 | 174 |
| 474 | 3300026088 | Ga0207641_10000810 | Ga0207641_1000081018 | 174 |
| 475 | 3300026088 | Ga0207641_10034431 | Ga0207641_100344316 | 174 |
| 476 | 3300026088 | Ga0207641_10052276 | Ga0207641_100522762 | 174 |
| 477 | 3300026088 | Ga0207641_10167177 | Ga0207641_101671772 | 174 |
| 478 | 3300026088 | Ga0207641_10717729 | Ga0207641_107177292 | 174 |
| 479 | 3300026089 | Ga0207648_10389117 | Ga0207648_103891171 | 174 |
| 480 | 3300026089 | Ga0207648_10470486 | Ga0207648_104704862 | 174 |
| 481 | 3300026089 | Ga0207648_10747238 | Ga0207648_107472381 | 174 |
| 482 | 3300026095 | Ga0207676_10006134 | Ga0207676_100061347 | 174 |
| 483 | 3300026095 | Ga0207676_10047204 | Ga0207676_100472043 | 174 |
| 484 | 3300026095 | Ga0207676_10115724 | Ga0207676_101157243 | 174 |
| 485 | 3300026095 | Ga0207676_10325299 | Ga0207676_103252992 | 174 |
| 486 | 3300026095 | Ga0207676_10386747 | Ga0207676_103867472 | 174 |
| 487 | 3300026116 | Ga0207674_10001506 | Ga0207674_1000150611 | 174 |
| 488 | 3300026116 | Ga0207674_10001732 | Ga0207674_1000173220 | 174 |
| 489 | 3300026116 | Ga0207674_10035062 | Ga0207674_100350624 | 174 |
| 490 | 3300026116 | Ga0207674_10069014 | Ga0207674_100690142 | 174 |
| 491 | 3300026116 | Ga0207674_10096123 | Ga0207674_100961232 | 174 |
| 492 | 3300026116 | Ga0207674_10097451 | Ga0207674_100974514 | 174 |
| 493 | 3300026116 | Ga0207674_10129640 | Ga0207674_101296403 | 174 |
| 494 | 3300026118 | Ga0207675_100024868 | Ga0207675_1000248686 | 174 |
| 495 | 3300026118 | Ga0207675_100313401 | Ga0207675_1003134012 | 174 |
| 496 | 3300026118 | Ga0207675_101586012 | Ga0207675_1015860121 | 174 |
| 497 | 3300026121 | Ga0207683_10343053 | Ga0207683_103430531 | 174 |
| 498 | 3300026121 | Ga0207683_10362331 | Ga0207683_103623311 | 174 |
| 499 | 3300026142 | Ga0207698_10375805 | Ga0207698_103758052 | 174 |
| 500 | 3300026142 | Ga0207698_10420123 | Ga0207698_104201232 | 174 |
| 501 | 3300026142 | Ga0207698_10646958 | Ga0207698_106469582 | 174 |
| 502 | 3300028380 | Ga0268265_10051881 | Ga0268265_100518813 | 174 |
| 503 | 3300028380 | Ga0268265_10103754 | Ga0268265_101037543 | 174 |
| 504 | 3300028380 | Ga0268265_10228689 | Ga0268265_102286891 | 174 |
| 505 | 3300028380 | Ga0268265_10238768 | Ga0268265_102387681 | 174 |
| 506 | 3300028380 | Ga0268265_10787529 | Ga0268265_107875292 | 174 |
| 507 | 3300028381 | Ga0268264_10000964 | Ga0268264_100009646 | 174 |
| 508 | 3300028381 | Ga0268264_10002457 | Ga0268264_1000245716 | 174 |
| 509 | 3300028381 | Ga0268264_10003607 | Ga0268264_100036074 | 174 |
| 510 | 3300028381 | Ga0268264_10028665 | Ga0268264_100286652 | 174 |
| 511 | 3300028381 | Ga0268264_10219359 | Ga0268264_102193592 | 174 |
| 512 | 3300028573 | Ga0265334_10072708 | Ga0265334_100727082 | 174 |
| 513 | 3300028786 | Ga0307517_10000929 | Ga0307517_1000092945 | 174 |
| 514 | 3300028794 | Ga0307515_10000003 | Ga0307515_10000003188 | 174 |
| 515 | 3300028794 | Ga0307515_10130467 | Ga0307515_101304673 | 174 |
| 516 | 3300028794 | Ga0307515_10471874 | Ga0307515_104718741 | 174 |
| 517 | 3300030521 | Ga0307511_10000614 | Ga0307511_1000061412 | 174 |
| 518 | 3300031456 | Ga0307513_10188040 | Ga0307513_101880402 | 174 |
| 519 | 3300031507 | Ga0307509_10322362 | Ga0307509_103223622 | 174 |
| 520 | 3300031548 | Ga0307408_100010828 | Ga0307408_1000108287 | 174 |
| 521 | 3300031649 | Ga0307514_10209148 | Ga0307514_102091482 | 174 |
| 522 | 3300031711 | Ga0265314_10152171 | Ga0265314_101521712 | 174 |
| 523 | 3300031730 | Ga0307516_10725303 | Ga0307516_107253031 | 174 |
| 524 | 3300031901 | Ga0307406_10193951 | Ga0307406_101939513 | 174 |
| 525 | 3300034820 | Ga0373959_0075057 | Ga0373959_0075057_148_714 | 174 |
| 526 | 3300035691 | Ga0373931_0003397 | Ga0373931_0003397_3654_4205 | 174 |
| 527 | 3300035695 | Ga0373927_0015533 | Ga0373927_0015533_403_963 | 174 |
| 528 | 3300036401 | Ga0373937_0137865 | Ga0373937_0137865_1279_1836 | 174 |
| 529 | 3300037312 | Ga0395899_0075983 | Ga0395899_0075983_1297_1860 | 174 |
| 530 | 3300037466 | Ga0395898_0095283 | Ga0395898_0095283_336_899 | 174 |
| 531 | 3300037471 | Ga0395905_0002338 | Ga0395905_0002338_7317_7880 | 174 |
| 532 | 3300038443 | Ga0395901_0002149 | Ga0395901_0002149_12220_12783 | 174 |
| 533 | 3300039437 | Ga0436365_1368300 | Ga0436365_1368300_632_1168 | 174 |
| 534 | 3300039437 | Ga0436365_1626007 | Ga0436365_1626007_3170_3850 | 174 |
| 535 | 3300039450 | Ga0436363_1603773 | Ga0436363_1603773_38_637 | 174 |
| 536 | 3300041486 | Ga0451807_2330222 | Ga0451807_2330222_98_661 | 174 |
| 537 | 3300041512 | Ga0451853_0711190 | Ga0451853_0711190_409_966 | 174 |
| 538 | 3300041512 | Ga0451853_3830960 | Ga0451853_3830960_100_627 | 174 |
| 539 | 3300042015 | Ga0439462_0031809 | Ga0439462_0031809_221_787 | 174 |
| 540 | 3300042876 | Ga0451577_0024368 | Ga0451577_0024368_999_1559 | 174 |
| 541 | 3300044706 | Ga0466964_0318510 | Ga0466964_0318510_116_673 | 174 |
| 542 | 3300044712 | Ga0453684_0152006 | Ga0453684_0152006_1497_2057 | 174 |
| 543 | 3300044712 | Ga0453684_1051556 | Ga0453684_1051556_69_629 | 174 |
| 544 | 3300045051 | Ga0451576_0110747 | Ga0451576_0110747_2023_2583 | 174 |
| 545 | 3300045051 | Ga0451576_0354112 | Ga0451576_0354112_421_981 | 174 |
| 546 | 3300046460 | Ga0495638_0000026 | Ga0495638_0000026_110574_111128 | 174 |
| 547 | 3300046460 | Ga0495638_0042957 | Ga0495638_0042957_1552_2112 | 174 |
| 548 | 3300046460 | Ga0495638_0160782 | Ga0495638_0160782_582_1106 | 174 |
| 549 | 3300046507 | Ga0495606_0012352 | Ga0495606_0012352_143_703 | 174 |
| 550 | 3300046537 | Ga0495598_0288139 | Ga0495598_0288139_26_595 | 174 |
| 551 | 3300046539 | Ga0495621_0030666 | Ga0495621_0030666_1180_1707 | 174 |
| 552 | 3300046694 | Ga0495649_0204106 | Ga0495649_0204106_55_579 | 174 |
| 553 | 3300047315 | Ga0495581_0307287 | Ga0495581_0307287_367_900 | 174 |
| 554 | 3300047320 | Ga0495672_0016866 | Ga0495672_0016866_2601_3161 | 174 |
| 555 | 3300047472 | Ga0495686_0016274 | Ga0495686_0016274_175_738 | 174 |
| 556 | 3300047472 | Ga0495686_0056095 | Ga0495686_0056095_1889_2452 | 174 |
| 557 | 3300048904 | Ga0496101_0097179 | Ga0496101_0097179_722_1300 | 174 |
| 558 | 3300048907 | Ga0496104_0000419 | Ga0496104_0000419_6248_6805 | 174 |
| 559 | 3300048912 | Ga0496109_0590438 | Ga0496109_0590438_275_808 | 174 |
| 560 | 3300048913 | Ga0496110_0734886 | Ga0496110_0734886_341_865 | 174 |
| 561 | 3300048913 | Ga0496110_1082245 | Ga0496110_1082245_99_665 | 174 |
| 562 | 3300048917 | Ga0496114_0111444 | Ga0496114_0111444_960_1538 | 174 |
| 563 | 3300049568 | Ga0501031_0063084 | Ga0501031_0063084_156_722 | 174 |
| 564 | 3300049568 | Ga0501031_0794827 | Ga0501031_0794827_32_589 | 174 |
| 565 | 3300049569 | Ga0501032_0004292 | Ga0501032_0004292_3804_4370 | 174 |
| 566 | 3300049570 | Ga0501033_0000627 | Ga0501033_0000627_20702_21268 | 174 |
| 567 | 3300049571 | Ga0501034_0001088 | Ga0501034_0001088_812_1384 | 174 |
| 568 | 3300049571 | Ga0501034_0009695 | Ga0501034_0009695_1767_2333 | 174 |
| 569 | 3300049571 | Ga0501034_0086883 | Ga0501034_0086883_819_1409 | 174 |
| 570 | 3300049571 | Ga0501034_0337749 | Ga0501034_0337749_777_1334 | 174 |
| 571 | 3300049572 | Ga0501036_0007064 | Ga0501036_0007064_1104_1670 | 174 |
| 572 | 3300049573 | Ga0501037_0013718 | Ga0501037_0013718_1693_2259 | 174 |
| 573 | 3300049573 | Ga0501037_0026900 | Ga0501037_0026900_3389_3979 | 174 |
| 574 | 3300049573 | Ga0501037_0110275 | Ga0501037_0110275_450_1022 | 174 |
| 575 | 3300049574 | Ga0501038_0000577 | Ga0501038_0000577_6911_7483 | 174 |
| 576 | 3300049574 | Ga0501038_0004801 | Ga0501038_0004801_1761_2327 | 174 |
| 577 | 3300049574 | Ga0501038_0009748 | Ga0501038_0009748_527_1060 | 174 |
| 578 | 3300049574 | Ga0501038_0030839 | Ga0501038_0030839_899_1489 | 174 |
| 579 | 3300049575 | Ga0501039_0009994 | Ga0501039_0009994_6327_6860 | 174 |
| 580 | 3300049575 | Ga0501039_0014718 | Ga0501039_0014718_141_713 | 174 |
| 581 | 3300049575 | Ga0501039_0022751 | Ga0501039_0022751_2493_3059 | 174 |
| 582 | 3300049579 | Ga0501043_0003669 | Ga0501043_0003669_1313_1879 | 174 |
| 583 | 3300049579 | Ga0501043_0013535 | Ga0501043_0013535_4999_5553 | 174 |
| 584 | 3300049579 | Ga0501043_0032562 | Ga0501043_0032562_2927_3517 | 174 |
| 585 | 3300049580 | Ga0501046_0007091 | Ga0501046_0007091_2480_3052 | 174 |
| 586 | 3300049580 | Ga0501046_0009712 | Ga0501046_0009712_5288_5821 | 174 |
| 587 | 3300049580 | Ga0501046_0017963 | Ga0501046_0017963_1611_2177 | 174 |
| 588 | 3300049580 | Ga0501046_0240368 | Ga0501046_0240368_409_1032 | 174 |
| 589 | 3300049581 | Ga0501047_0014150 | Ga0501047_0014150_6737_7303 | 174 |
| 590 | 3300049581 | Ga0501047_0018106 | Ga0501047_0018106_5367_5939 | 174 |
| 591 | 3300049581 | Ga0501047_0020717 | Ga0501047_0020717_2316_2870 | 174 |
| 592 | 3300049581 | Ga0501047_0028066 | Ga0501047_0028066_2895_3428 | 174 |
| 593 | 3300049581 | Ga0501047_0652651 | Ga0501047_0652651_24_590 | 174 |
| 594 | 3300049582 | Ga0501048_0005701 | Ga0501048_0005701_7795_8361 | 174 |
| 595 | 3300049582 | Ga0501048_0086557 | Ga0501048_0086557_185_757 | 174 |
| 596 | 3300049583 | Ga0501067_0035807 | Ga0501067_0035807_1916_2449 | 174 |
| 597 | 3300049583 | Ga0501067_0082392 | Ga0501067_0082392_1089_1655 | 174 |
| 598 | 3300049584 | Ga0501068_0004766 | Ga0501068_0004766_6781_7353 | 174 |
| 599 | 3300049584 | Ga0501068_0019069 | Ga0501068_0019069_2039_2605 | 174 |
| 600 | 3300049584 | Ga0501068_0020895 | Ga0501068_0020895_1805_2338 | 174 |
| 601 | 3300049585 | Ga0501069_0070717 | Ga0501069_0070717_702_1268 | 174 |
| 602 | 3300049586 | Ga0501070_0002240 | Ga0501070_0002240_14602_15192 | 174 |
| 603 | 3300049586 | Ga0501070_0008598 | Ga0501070_0008598_737_1303 | 174 |
| 604 | 3300049589 | Ga0501073_0004775 | Ga0501073_0004775_8772_9344 | 174 |
| 605 | 3300049589 | Ga0501073_0032708 | Ga0501073_0032708_1184_1717 | 174 |
| 606 | 3300049590 | Ga0501074_0018022 | Ga0501074_0018022_736_1326 | 174 |
| 607 | 3300049590 | Ga0501074_0226366 | Ga0501074_0226366_240_806 | 174 |
| 608 | 3300049741 | Ga0501079_0002785 | Ga0501079_0002785_1085_1651 | 174 |
| 609 | 3300049741 | Ga0501079_0029449 | Ga0501079_0029449_3379_3969 | 174 |
| 610 | 3300049742 | Ga0501080_0005359 | Ga0501080_0005359_3354_3926 | 174 |
| 611 | 3300049742 | Ga0501080_0020251 | Ga0501080_0020251_2285_2875 | 174 |
| 612 | 3300049742 | Ga0501080_0029063 | Ga0501080_0029063_706_1272 | 174 |
| 613 | 3300049744 | Ga0501083_0008572 | Ga0501083_0008572_4828_5418 | 174 |
| 614 | 3300049744 | Ga0501083_0018399 | Ga0501083_0018399_3589_4155 | 174 |
| 615 | 3300049744 | Ga0501083_0043986 | Ga0501083_0043986_2136_2690 | 174 |
| 616 | 3300049744 | Ga0501083_0105756 | Ga0501083_0105756_1032_1604 | 174 |
| 617 | 3300049822 | Ga0501035_0003663 | Ga0501035_0003663_6566_7138 | 174 |
| 618 | 3300049822 | Ga0501035_0005157 | Ga0501035_0005157_8676_9266 | 174 |
| 619 | 3300049823 | Ga0501044_0004013 | Ga0501044_0004013_6705_7277 | 174 |
| 620 | 3300049823 | Ga0501044_0059544 | Ga0501044_0059544_1561_2094 | 174 |
| 621 | 3300049824 | Ga0501045_0024310 | Ga0501045_0024310_1113_1679 | 174 |
| 622 | 3300050493 | nmdc:mga0k408_63260_c1 | nmdc:mga0k408_63260_c1_293_853 | 174 |
| 623 | 3300050507 | nmdc:mga05p37_605_c1 | nmdc:mga05p37_605_c1_4210_4770 | 174 |
| 624 | 3300050507 | nmdc:mga05p37_75664_c1 | nmdc:mga05p37_75664_c1_2841_3413 | 174 |
| 625 | 3300050508 | nmdc:mga09592_2761_c1 | nmdc:mga09592_2761_c1_7583_8155 | 174 |
| 626 | 3300050510 | nmdc:mga06r32_601323_c1 | nmdc:mga06r32_601323_c1_11_583 | 174 |
| 627 | 3300050511 | nmdc:mga08y16_633663_c1 | nmdc:mga08y16_633663_c1_292_858 | 174 |
| 628 | 3300050512 | nmdc:mga0n895_296114_c1 | nmdc:mga0n895_296114_c1_494_1027 | 174 |
| 629 | 3300053090 | Ga0500646_0011717 | Ga0500646_0011717_272_838 | 174 |
| 630 | 3300053092 | Ga0500583_0000029 | Ga0500583_0000029_62909_63475 | 174 |
| 631 | 3300053092 | Ga0500583_0000269 | Ga0500583_0000269_10238_10795 | 174 |
| 632 | 3300053093 | Ga0500651_0270802 | Ga0500651_0270802_42_602 | 174 |
| 633 | 3300053105 | Ga0500557_001819 | Ga0500557_001819_321_878 | 174 |
| 634 | 3300053118 | Ga0500594_0051311 | Ga0500594_0051311_147_704 | 174 |
| 635 | 3300053131 | Ga0500652_050463 | Ga0500652_050463_346_903 | 174 |
| 636 | 3300053153 | Ga0500616_0000004 | Ga0500616_0000004_127601_128158 | 174 |
| 637 | 3300053156 | Ga0500622_0080737 | Ga0500622_0080737_918_1472 | 174 |
| 638 | 3300053156 | Ga0500622_0223565 | Ga0500622_0223565_20_544 | 174 |
| 639 | 3300053156 | Ga0500622_0250796 | Ga0500622_0250796_61_618 | 174 |
| 640 | 3300053160 | Ga0500633_0002655 | Ga0500633_0002655_2733_3257 | 174 |
| 641 | 3300053727 | Ga0500611_000021 | Ga0500611_000021_85047_85571 | 174 |
| 642 | 3300054114 | Ga0501084_0020633 | Ga0501084_0020633_837_1391 | 174 |
| 643 | 3300054114 | Ga0501084_0023937 | Ga0501084_0023937_3144_3734 | 174 |
| 644 | 3300054114 | Ga0501084_0517859 | Ga0501084_0517859_92_658 | 174 |
| 645 | 3300060353 | Ga0501082_0004933 | Ga0501082_0004933_4888_5478 | 174 |
| 646 | 3300060353 | Ga0501082_0005505 | Ga0501082_0005505_5407_5979 | 174 |
| 647 | 3300060353 | Ga0501082_0032446 | Ga0501082_0032446_1842_2375 | 174 |
| 648 | 3300060353 | Ga0501082_0799325 | Ga0501082_0799325_177_794 | 174 |
| 649 | 3300060353 | Ga0501082_0840014 | Ga0501082_0840014_254_787 | 174 |
| 650 | 3300060353 | Ga0501082_1315584 | Ga0501082_1315584_13_579 | 174 |
| 651 | iso_pu_bacteria | 2929921140 | 2929921193 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8596 | 33 | 173 |
| 3ei0-assembly1.cif.gz_C | structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic) | 0.8414 | 149 | 172 |
| 7xh2-assembly1.cif.gz_A | dihydrofolate reductase-like protein sach in safracin biosynthesis | 0.8175 | 3 | 171 |
| 3uu3-assembly1.cif.gz_D | the glic pentameric ligand-gated ion channel loop2-20' oxidized mutant in a locally-closed conformation (lc1 subtype) | 0.8105 | 149 | 172 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.8008 | 3 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8569 | 33 | 174 | 3.40.430.10 |
| 3ky8B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8141 | 3 | 171 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8067 | 1 | 171 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7891 | 3 | 174 | 3.40.430.10 |
| af_Q5JKW4_92_204_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.7843 | 153 | 173 | 2.30.130.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3WB29-F1-model_v4 | Dihydrofolate reductase | 0.9712 | 51 | 174 |
GO:0008703
GO:0009231 |
| AF-A0A370ERS3-F1-model_v4 | RibD domain-containing protein | 0.9455 | 109 | 173 |
GO:0008703
GO:0009231 |
| AF-A0A098BX07-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9276 | 46 | 174 |
GO:0008703
GO:0009231 |
| AF-A0A6P1WA70-F1-model_v4 | Dihydrofolate reductase | 0.9262 | 1 | 174 |
GO:0008703
GO:0009231 |
| AF-A4SR96-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9229 | 35 | 174 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar