F472600

General Info

Members Datasets Scaffolds Average Seq Length
651 272 650 184

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10124748|Ga0207647_101247481
Length 213
Sequence MDRRISVIRCQSCSVQLISDNRAQRHQTMMTGEFSITIHMVSSLDGMIAKKDNSVSWFDTSHYYDKGVDGQDPQEFLKTIDCYVMGSKTYEHALELSKSYGWAYGDKPTIVLTSRNLASGKPNIEFYSDDLNKLVNERLKPNYKNVWVAGGAILTKEFIRQKLADEIRVSILPIILGEGILFFDNIGLEQTLHLADTTAYKNGMVELRYKIIK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
265 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
270 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 0
Rhizoplane 1.69
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000668 3300001989 Bacteria 12354
2 JGI25153J46596_10017468 3300003215 Bacteria 2825
3 JGI25153J46596_10038746 3300003215 Bacteria 1498
4 rootH1_10026419 3300003316 Unclassified 2918
5 rootH1_10042500 3300003316 Bacteria 5575
6 rootH1_10114680 3300003316 Bacteria 1087
7 rootH1_10114680 3300003323 Bacteria 2212
8 rootH2_10009135 3300003320 Bacteria 10334
9 rootH2_10198307 3300003320 Bacteria 3330
10 rootH2_10245760 3300003320 Bacteria 1210
11 rootL2_10009405 3300003322 Bacteria 6564
12 rootL2_10351884 3300003322 Unclassified 1866
13 rootH1_10013674 3300003323 Bacteria 50224
14 rootH1_10023975 3300003323 Bacteria 6000
15 rootH1_10059108 3300003323 Bacteria 12058
16 Ga0055526_1001778 3300003771 Bacteria 14972
17 Ga0055528_1005387 3300003790 Bacteria 5967
18 Ga0065165_1000743 3300005262 Bacteria 45003
19 Ga0065712_10003429 3300005290 Bacteria 5173
20 Ga0065712_10127103 3300005290 Bacteria 1590
21 Ga0065712_10203039 3300005290 Bacteria 1092
22 Ga0065712_10225445 3300005290 Unclassified 1027
23 Ga0065715_10541427 3300005293 Bacteria 748
24 Ga0065707_10127293 3300005295 Bacteria 1987
25 Ga0065707_10151855 3300005295 Unclassified 1650
26 Ga0070658_10001806 3300005327 Bacteria 17989
27 Ga0070658_10158236 3300005327 Bacteria 1899
28 Ga0070658_10514692 3300005327 Bacteria 1034
29 Ga0070658_10669447 3300005327 Bacteria 901
30 Ga0070676_10276686 3300005328 Bacteria 1129
31 Ga0070683_100070528 3300005329 Bacteria 3260
32 Ga0070683_100088214 3300005329 Unclassified 2910
33 Ga0070683_100090327 3300005329 Bacteria 2876
34 Ga0070683_100138049 3300005329 Bacteria 2309
35 Ga0070683_100249682 3300005329 Unclassified 1687
36 Ga0070683_100359040 3300005329 Bacteria 1388
37 Ga0070690_100141430 3300005330 Bacteria 1634
38 Ga0070690_100200776 3300005330 Bacteria 1387
39 Ga0070670_100001415 3300005331 Bacteria 19282
40 Ga0070670_100008938 3300005331 Bacteria 8557
41 Ga0070670_100392659 3300005331 Bacteria 1224
42 Ga0070677_10216072 3300005333 Bacteria 934
43 Ga0068869_100076231 3300005334 Unclassified 2493
44 Ga0068869_100256049 3300005334 Bacteria 1400
45 Ga0068869_100919473 3300005334 Unclassified 758
46 Ga0070666_10003698 3300005335 Bacteria 9268
47 Ga0070666_10039583 3300005335 Bacteria 3143
48 Ga0070666_10128998 3300005335 Bacteria 1756
49 Ga0070666_10289301 3300005335 Bacteria 1166
50 Ga0070666_10866922 3300005335 Bacteria 667
51 Ga0070680_100003404 3300005336 Bacteria 11878
52 Ga0070680_100031337 3300005336 Bacteria 4274
53 Ga0070680_100055741 3300005336 Bacteria 3230
54 Ga0070680_100652891 3300005336 Unclassified 904
55 Ga0070682_100001128 3300005337 Bacteria 15254
56 Ga0070682_100526998 3300005337 Unclassified 920
57 Ga0068868_100141096 3300005338 Unclassified 1978
58 Ga0068868_100298943 3300005338 Bacteria 1367
59 Ga0070660_100216639 3300005339 Bacteria 1555
60 Ga0070660_100332713 3300005339 Bacteria 1249
61 Ga0070689_100050174 3300005340 Bacteria 3223
62 Ga0070689_100066828 3300005340 Bacteria 2801
63 Ga0070689_100301814 3300005340 Bacteria 1333
64 Ga0070691_10054801 3300005341 Bacteria 1909
65 Ga0070687_100096435 3300005343 Bacteria 1646
66 Ga0070687_100289222 3300005343 Bacteria 1035
67 Ga0070687_100585007 3300005343 Bacteria 764
68 Ga0070661_100016755 3300005344 Bacteria 5187
69 Ga0070661_100038120 3300005344 Unclassified 3498
70 Ga0070661_100237114 3300005344 Bacteria 1403
71 Ga0070661_100555838 3300005344 Bacteria 924
72 Ga0070692_10001670 3300005345 Bacteria 8202
73 Ga0070692_10097663 3300005345 Unclassified 1606
74 Ga0070692_10115762 3300005345 Bacteria 1489
75 Ga0070668_100148853 3300005347 Bacteria 1891
76 Ga0070669_100322897 3300005353 Bacteria 1247
77 Ga0070675_100004691 3300005354 Bacteria 10429
78 Ga0070675_100052533 3300005354 Bacteria 3351
79 Ga0070671_100144489 3300005355 Bacteria 2008
80 Ga0070673_101017855 3300005364 Bacteria 772
81 Ga0070688_100035907 3300005365 Bacteria 3013
82 Ga0070688_100130147 3300005365 Bacteria 1697
83 Ga0070659_100042032 3300005366 Bacteria 3574
84 Ga0070659_100052576 3300005366 Bacteria 3205
85 Ga0070659_100053468 3300005366 Bacteria 3178
86 Ga0070659_100346043 3300005366 Unclassified 1246
87 Ga0070667_100008784 3300005367 Bacteria 8373
88 Ga0070667_100058481 3300005367 Bacteria 3259
89 Ga0070709_10024768 3300005434 Bacteria 3537
90 Ga0070709_10268707 3300005434 Unclassified 1235
91 Ga0070714_100142792 3300005435 Unclassified 2151
92 Ga0070713_100188096 3300005436 Unclassified 1859
93 Ga0070710_10569378 3300005437 Unclassified 784
94 Ga0070701_10424229 3300005438 Unclassified 848
95 Ga0070711_100242038 3300005439 Bacteria 1411
96 Ga0070705_100230921 3300005440 Unclassified 1287
97 Ga0070705_100792472 3300005440 Bacteria 753
98 Ga0070700_100061976 3300005441 Bacteria 2361
99 Ga0070700_100166894 3300005441 Bacteria 1521
100 Ga0070694_100433733 3300005444 Bacteria 1034
101 Ga0070663_100273411 3300005455 Bacteria 1344
102 Ga0070662_100002433 3300005457 Bacteria 11454
103 Ga0070681_10156267 3300005458 Bacteria 2205
104 Ga0070681_10218904 3300005458 Bacteria 1819
105 Ga0070681_10337431 3300005458 Bacteria 1417
106 Ga0068867_100215898 3300005459 Bacteria 1543
107 Ga0068867_100394511 3300005459 Bacteria 1166
108 Ga0068867_100416719 3300005459 Bacteria 1137
109 Ga0070685_10001005 3300005466 Bacteria 15141
110 Ga0070685_10120318 3300005466 Bacteria 1630
111 Ga0070698_100023211 3300005471 Bacteria 6484
112 Ga0070698_100040970 3300005471 Bacteria 4757
113 Ga0070679_100010932 3300005530 Bacteria 8626
114 Ga0070679_100034334 3300005530 Bacteria 5026
115 Ga0070684_100006504 3300005535 Bacteria 9047
116 Ga0070684_100053367 3300005535 Bacteria 3518
117 Ga0070684_100074361 3300005535 Unclassified 2995
118 Ga0070684_100113457 3300005535 Bacteria 2432
119 Ga0070684_100273642 3300005535 Bacteria 1546
120 Ga0070684_100298304 3300005535 Bacteria 1478
121 Ga0068853_100016505 3300005539 Bacteria 6078
122 Ga0068853_100111264 3300005539 Unclassified 2433
123 Ga0068853_100319869 3300005539 Unclassified 1438
124 Ga0068853_100369617 3300005539 Bacteria 1337
125 Ga0070672_100069878 3300005543 Bacteria 2789
126 Ga0070695_100022307 3300005545 Unclassified 3883
127 Ga0070695_100292577 3300005545 Unclassified 1201
128 Ga0070693_100002364 3300005547 Bacteria 8668
129 Ga0068855_100000060 3300005563 Bacteria 133838
130 Ga0068855_100004484 3300005563 Bacteria 17064
131 Ga0068855_100074144 3300005563 Bacteria 3953
132 Ga0068855_100208820 3300005563 Bacteria 2195
133 Ga0068855_100733134 3300005563 Unclassified 1055
134 Ga0068855_101193908 3300005563 Bacteria 791
135 Ga0070664_100006042 3300005564 Bacteria 9791
136 Ga0070664_100008429 3300005564 Bacteria 8335
137 Ga0070664_100418596 3300005564 Bacteria 1227
138 Ga0068857_100002714 3300005577 Bacteria 14530
139 Ga0068857_100007359 3300005577 Bacteria 9478
140 Ga0068857_100050563 3300005577 Bacteria 3687
141 Ga0068854_100106137 3300005578 Bacteria 2112
142 Ga0068856_100155654 3300005614 Unclassified 2295
143 Ga0068856_100341440 3300005614 Bacteria 1516
144 Ga0070702_100099664 3300005615 Bacteria 1779
145 Ga0068852_100001075 3300005616 Bacteria 18053
146 Ga0068852_100034415 3300005616 Unclassified 4215
147 Ga0068852_100055730 3300005616 Bacteria 3413
148 Ga0068852_100079183 3300005616 Bacteria 2910
149 Ga0068852_100353299 3300005616 Bacteria 1436
150 Ga0068852_100458491 3300005616 Bacteria 1263
151 Ga0068859_100288969 3300005617 Bacteria 1732
152 Ga0068859_100440802 3300005617 Unclassified 1399
153 Ga0068859_101428209 3300005617 Unclassified 763
154 Ga0068859_101498598 3300005617 Unclassified 744
155 Ga0068864_100007549 3300005618 Bacteria 8960
156 Ga0068864_100030994 3300005618 Bacteria 4535
157 Ga0068864_100042409 3300005618 Bacteria 3894
158 Ga0068864_100163633 3300005618 Bacteria 2024
159 Ga0068864_100533394 3300005618 Unclassified 1133
160 Ga0068861_100327784 3300005719 Bacteria 1335
161 Ga0068861_101151723 3300005719 Bacteria 748
162 Ga0068851_10161827 3300005834 Bacteria 1230
163 Ga0068851_10186888 3300005834 Bacteria 1150
164 Ga0068870_10010422 3300005840 Unclassified 4271
165 Ga0068863_100002341 3300005841 Bacteria 18837
166 Ga0068863_100013943 3300005841 Bacteria 7747
167 Ga0068863_100056997 3300005841 Bacteria 3698
168 Ga0068863_100206384 3300005841 Bacteria 1891
169 Ga0068863_100222254 3300005841 Bacteria 1820
170 Ga0068863_100267983 3300005841 Bacteria 1652
171 Ga0068863_100300806 3300005841 Bacteria 1556
172 Ga0068863_101490501 3300005841 Bacteria 685
173 Ga0068858_100176439 3300005842 Bacteria 2016
174 Ga0068860_100001707 3300005843 Bacteria 23468
175 Ga0068860_100005370 3300005843 Bacteria 12999
176 Ga0068860_100007093 3300005843 Bacteria 11209
177 Ga0068860_100044488 3300005843 Bacteria 4231
178 Ga0068860_100162847 3300005843 Bacteria 2151
179 Ga0068860_100486288 3300005843 Unclassified 1231
180 Ga0068860_101033795 3300005843 Bacteria 840
181 Ga0068862_100018573 3300005844 Bacteria 5791
182 Ga0068862_100020358 3300005844 Bacteria 5542
183 Ga0068862_100179383 3300005844 Bacteria 1900
184 Ga0081455_10039482 3300005937 Bacteria 4170
185 Ga0081455_10491735 3300005937 Unclassified 826
186 Ga0081539_10004646 3300005985 Bacteria 14947
187 Ga0070716_100104716 3300006173 Bacteria 1742
188 Ga0075366_10136747 3300006195 Unclassified 1480
189 Ga0075366_10182486 3300006195 Bacteria 1275
190 Ga0097621_100001243 3300006237 Bacteria 17615
191 Ga0097621_100278979 3300006237 Bacteria 1471
192 Ga0097621_100332618 3300006237 Unclassified 1347
193 Ga0068871_100001056 3300006358 Bacteria 18473
194 Ga0068871_100022666 3300006358 Bacteria 4845
195 Ga0068871_100151578 3300006358 Bacteria 1977
196 Ga0075428_100019466 3300006844 Bacteria 7512
197 Ga0075428_100088757 3300006844 Bacteria 3372
198 Ga0075431_100599616 3300006847 Bacteria 1085
199 Ga0075433_11370241 3300006852 Bacteria 612
200 Ga0075429_100000543 3300006880 Bacteria 28757
201 Ga0075429_100695658 3300006880 Bacteria 890
202 Ga0068865_100320885 3300006881 Bacteria 1246
203 Ga0097620_100288974 3300006931 Bacteria 1732
204 Ga0097620_100440806 3300006931 Unclassified 1399
205 Ga0097620_101428185 3300006931 Unclassified 763
206 Ga0105240_10002694 3300009093 Bacteria 28270
207 Ga0105240_10022198 3300009093 Bacteria 8419
208 Ga0105240_10024023 3300009093 Bacteria 8051
209 Ga0105240_10302085 3300009093 Bacteria 1831
210 Ga0105240_10463407 3300009093 Unclassified 1416
211 Ga0105240_10742673 3300009093 Unclassified 1068
212 Ga0111539_10196595 3300009094 Bacteria 2352
213 Ga0105245_10036403 3300009098 Unclassified 4372
214 Ga0105245_10100557 3300009098 Bacteria 2675
215 Ga0105245_10341086 3300009098 Bacteria 1482
216 Ga0105247_10001522 3300009101 Bacteria 16573
217 Ga0105247_10538580 3300009101 Bacteria 857
218 Ga0114129_10009960 3300009147 Bacteria 13547
219 Ga0114129_10020177 3300009147 Bacteria 9484
220 Ga0114129_10384946 3300009147 Bacteria 1852
221 Ga0105241_10682608 3300009174 Bacteria 936
222 Ga0105241_11506635 3300009174 Bacteria 647
223 Ga0105242_10002222 3300009176 Bacteria 15309
224 Ga0105242_10008873 3300009176 Bacteria 7715
225 Ga0105242_10016049 3300009176 Bacteria 5818
226 Ga0105242_10018381 3300009176 Bacteria 5463
227 Ga0105248_10019425 3300009177 Bacteria 7519
228 Ga0105248_10065115 3300009177 Bacteria 4092
229 Ga0105248_10292300 3300009177 Bacteria 1835
230 Ga0105248_10336221 3300009177 Bacteria 1700
231 Ga0105248_11027988 3300009177 Bacteria 931
232 Ga0105237_10000510 3300009545 Bacteria 54949
233 Ga0105237_10000671 3300009545 Bacteria 47262
234 Ga0105237_10012785 3300009545 Bacteria 8829
235 Ga0105237_10040319 3300009545 Bacteria 4710
236 Ga0105237_10147075 3300009545 Bacteria 2351
237 Ga0105237_10254411 3300009545 Bacteria 1759
238 Ga0105237_10464791 3300009545 Bacteria 1271
239 Ga0105238_10014571 3300009551 Bacteria 7949
240 Ga0105238_10032553 3300009551 Bacteria 5306
241 Ga0105249_10010190 3300009553 Bacteria 8255
242 Ga0105249_10189368 3300009553 Bacteria 2007
243 Ga0105249_10195359 3300009553 Bacteria 1977
244 Ga0105249_10229989 3300009553 Bacteria 1828
245 Ga0105249_10336637 3300009553 Bacteria 1525
246 Ga0105239_10000017 3300010375 Bacteria 290760
247 Ga0105239_10005627 3300010375 Bacteria 14645
248 Ga0105239_10014092 3300010375 Bacteria 8875
249 Ga0105239_10026291 3300010375 Bacteria 6406
250 Ga0105239_10034852 3300010375 Bacteria 5528
251 Ga0105239_10468776 3300010375 Bacteria 1430
252 Ga0105239_10742893 3300010375 Bacteria 1123
253 Ga0105239_10844384 3300010375 Bacteria 1050
254 Ga0105246_10474736 3300011119 Unclassified 1057
255 Ga0157373_10018597 3300013100 Bacteria 5057
256 Ga0157373_10132114 3300013100 Bacteria 1755
257 Ga0157373_10404523 3300013100 Bacteria 979
258 Ga0157371_10008475 3300013102 Bacteria 8183
259 Ga0157371_10054622 3300013102 Bacteria 2836
260 Ga0157371_10152078 3300013102 Unclassified 1651
261 Ga0157371_10161997 3300013102 Unclassified 1598
262 Ga0157371_10669884 3300013102 Bacteria 775
263 Ga0157370_10004709 3300013104 Bacteria 15550
264 Ga0157370_10127132 3300013104 Bacteria 2379
265 Ga0157370_10533512 3300013104 Bacteria 1076
266 Ga0157370_10859523 3300013104 Unclassified 824
267 Ga0157369_10009675 3300013105 Bacteria 11024
268 Ga0157369_10071553 3300013105 Bacteria 3722
269 Ga0157369_10127102 3300013105 Bacteria 2702
270 Ga0157369_10512730 3300013105 Bacteria 1241
271 Ga0157369_10971630 3300013105 Bacteria 870
272 Ga0157374_10005226 3300013296 Bacteria 10885
273 Ga0157374_10467475 3300013296 Bacteria 1264
274 Ga0157374_10471311 3300013296 Bacteria 1258
275 Ga0157374_10983919 3300013296 Bacteria 863
276 Ga0157378_10006930 3300013297 Bacteria 9894
277 Ga0157378_10010437 3300013297 Bacteria 8112
278 Ga0157378_10062311 3300013297 Bacteria 3330
279 Ga0163162_10001262 3300013306 Bacteria 23654
280 Ga0163162_10045726 3300013306 Bacteria 4386
281 Ga0163162_10111389 3300013306 Bacteria 2834
282 Ga0163162_10684131 3300013306 Bacteria 1148
283 Ga0163162_10717936 3300013306 Unclassified 1120
284 Ga0163162_11573770 3300013306 Bacteria 749
285 Ga0157372_10003091 3300013307 Bacteria 17926
286 Ga0157372_10017350 3300013307 Bacteria 7729
287 Ga0157372_10031599 3300013307 Bacteria 5797
288 Ga0157372_10035124 3300013307 Bacteria 5516
289 Ga0157372_10045621 3300013307 Unclassified 4863
290 Ga0157372_10224698 3300013307 Bacteria 2177
291 Ga0157372_10446768 3300013307 Bacteria 1507
292 Ga0157372_10829557 3300013307 Bacteria 1074
293 Ga0157372_10939531 3300013307 Bacteria 1002
294 Ga0157372_10960168 3300013307 Bacteria 991
295 Ga0157372_11403028 3300013307 Bacteria 805
296 Ga0157372_11641903 3300013307 Bacteria 740
297 Ga0157372_11737660 3300013307 Unclassified 718
298 Ga0157375_10000749 3300013308 Bacteria 28469
299 Ga0157375_10004593 3300013308 Bacteria 12001
300 Ga0157375_10034519 3300013308 Bacteria 4820
301 Ga0157375_10072815 3300013308 Bacteria 3453
302 Ga0157375_11704014 3300013308 Unclassified 746
303 Ga0163163_10000494 3300014325 Bacteria 35512
304 Ga0163163_10031353 3300014325 Bacteria 5130
305 Ga0163163_10051496 3300014325 Bacteria 4060
306 Ga0163163_10178674 3300014325 Bacteria 2169
307 Ga0163163_10345214 3300014325 Bacteria 1544
308 Ga0163163_10787281 3300014325 Bacteria 1014
309 Ga0157380_10016089 3300014326 Bacteria 5510
310 Ga0157380_10024856 3300014326 Bacteria 4537
311 Ga0157380_10063975 3300014326 Bacteria 2951
312 Ga0157380_10830028 3300014326 Bacteria 944
313 Ga0157380_11912065 3300014326 Unclassified 654
314 Ga0157377_10035528 3300014745 Unclassified 2734
315 Ga0157377_10270198 3300014745 Bacteria 1110
316 Ga0157379_10106881 3300014968 Bacteria 2512
317 Ga0157376_10000597 3300014969 Bacteria 23324
318 Ga0157376_10024302 3300014969 Bacteria 4754
319 Ga0157376_10067800 3300014969 Bacteria 3019
320 Ga0182007_10029863 3300015262 Bacteria 1865
321 Ga0182007_10147835 3300015262 Bacteria 797
322 Ga0163161_10001497 3300017792 Bacteria 17273
323 Ga0163161_10058586 3300017792 Bacteria 2799
324 Ga0209233_1011331 3300025261 Bacteria 2631
325 Ga0209455_1004066 3300025272 Bacteria 4930
326 Ga0209673_1000438 3300025273 Bacteria 71700
327 Ga0209564_1000606 3300025295 Bacteria 55783
328 Ga0209564_1003267 3300025295 Bacteria 11308
329 Ga0209758_1003210 3300025297 Bacteria 15233
330 Ga0209758_1005303 3300025297 Bacteria 10065
331 Ga0209050_1000892 3300025298 Bacteria 39709
332 Ga0207426_1001400 3300025302 Bacteria 20323
333 Ga0207426_1007438 3300025302 Bacteria 4586
334 Ga0209257_1057924 3300025304 Bacteria 1064
335 Ga0207697_10048015 3300025315 Bacteria 1760
336 Ga0207656_10134494 3300025321 Bacteria 1161
337 Ga0207656_10137980 3300025321 Bacteria 1147
338 Ga0207692_10324150 3300025898 Unclassified 943
339 Ga0207710_10011013 3300025900 Bacteria 3809
340 Ga0207688_10058063 3300025901 Bacteria 2177
341 Ga0207680_10016371 3300025903 Unclassified 3891
342 Ga0207680_10085108 3300025903 Bacteria 1997
343 Ga0207680_10089515 3300025903 Bacteria 1954
344 Ga0207680_10319878 3300025903 Bacteria 1085
345 Ga0207647_10038808 3300025904 Unclassified 3009
346 Ga0207647_10124748 3300025904 Bacteria 1516
347 Ga0207647_10148085 3300025904 Unclassified 1373
348 Ga0207647_10257601 3300025904 Unclassified 1000
349 Ga0207645_10163199 3300025907 Bacteria 1458
350 Ga0207643_10009608 3300025908 Bacteria 5193
351 Ga0207643_10147201 3300025908 Bacteria 1410
352 Ga0207643_10550565 3300025908 Unclassified 740
353 Ga0207705_10000623 3300025909 Bacteria 29594
354 Ga0207705_10020019 3300025909 Bacteria 4785
355 Ga0207705_10025587 3300025909 Bacteria 4211
356 Ga0207654_10434925 3300025911 Bacteria 918
357 Ga0207707_10043800 3300025912 Bacteria 3902
358 Ga0207707_10046354 3300025912 Unclassified 3786
359 Ga0207707_10329093 3300025912 Bacteria 1318
360 Ga0207695_10021713 3300025913 Bacteria 7317
361 Ga0207695_10062162 3300025913 Unclassified 3857
362 Ga0207695_10344723 3300025913 Bacteria 1377
363 Ga0207671_10006613 3300025914 Bacteria 10284
364 Ga0207671_10007833 3300025914 Bacteria 9183
365 Ga0207671_10008101 3300025914 Bacteria 8971
366 Ga0207671_10017382 3300025914 Bacteria 5548
367 Ga0207671_10141186 3300025914 Bacteria 1856
368 Ga0207671_10659129 3300025914 Bacteria 833
369 Ga0207671_10675301 3300025914 Bacteria 822
370 Ga0207671_10744430 3300025914 Bacteria 779
371 Ga0207663_10878754 3300025916 Bacteria 716
372 Ga0207660_10171748 3300025917 Bacteria 1678
373 Ga0207660_10172569 3300025917 Bacteria 1675
374 Ga0207660_10278106 3300025917 Unclassified 1328
375 Ga0207660_10632361 3300025917 Unclassified 872
376 Ga0207662_10054656 3300025918 Bacteria 2381
377 Ga0207662_10097097 3300025918 Bacteria 1821
378 Ga0207662_10167762 3300025918 Bacteria 1406
379 Ga0207662_10942984 3300025918 Bacteria 612
380 Ga0207657_10035305 3300025919 Unclassified 4484
381 Ga0207657_10037298 3300025919 Bacteria 4342
382 Ga0207657_10114906 3300025919 Bacteria 2219
383 Ga0207649_10009530 3300025920 Bacteria 5316
384 Ga0207649_10105595 3300025920 Bacteria 1872
385 Ga0207649_10217756 3300025920 Bacteria 1358
386 Ga0207649_10638055 3300025920 Bacteria 822
387 Ga0207652_10663297 3300025921 Unclassified 932
388 Ga0207652_10785280 3300025921 Unclassified 846
389 Ga0207681_10052429 3300025923 Bacteria 2766
390 Ga0207681_10265550 3300025923 Bacteria 1345
391 Ga0207694_10048749 3300025924 Bacteria 3278
392 Ga0207694_10225605 3300025924 Unclassified 1529
393 Ga0207694_10375432 3300025924 Unclassified 1180
394 Ga0207650_10007105 3300025925 Bacteria 7627
395 Ga0207650_10038266 3300025925 Unclassified 3502
396 Ga0207650_10469988 3300025925 Bacteria 1048
397 Ga0207650_10525609 3300025925 Bacteria 990
398 Ga0207659_11008834 3300025926 Bacteria 716
399 Ga0207687_10067073 3300025927 Bacteria 2552
400 Ga0207687_10365474 3300025927 Unclassified 1179
401 Ga0207700_10131531 3300025928 Unclassified 2044
402 Ga0207664_10617332 3300025929 Unclassified 974
403 Ga0207690_10033132 3300025932 Bacteria 3320
404 Ga0207690_10204691 3300025932 Bacteria 1501
405 Ga0207690_10251349 3300025932 Bacteria 1366
406 Ga0207706_10015151 3300025933 Bacteria 6977
407 Ga0207706_10105001 3300025933 Bacteria 2486
408 Ga0207686_10003705 3300025934 Bacteria 8195
409 Ga0207686_10011836 3300025934 Bacteria 4787
410 Ga0207686_10015383 3300025934 Bacteria 4278
411 Ga0207670_10122140 3300025936 Bacteria 1895
412 Ga0207670_10189647 3300025936 Bacteria 1555
413 Ga0207670_10862016 3300025936 Bacteria 757
414 Ga0207691_10050906 3300025940 Bacteria 3790
415 Ga0207691_10145862 3300025940 Unclassified 2083
416 Ga0207691_10375299 3300025940 Bacteria 1214
417 Ga0207691_10508998 3300025940 Bacteria 1022
418 Ga0207711_10021893 3300025941 Bacteria 5340
419 Ga0207711_10801674 3300025941 Bacteria 877
420 Ga0207689_10057603 3300025942 Bacteria 3196
421 Ga0207689_10350294 3300025942 Unclassified 1227
422 Ga0207689_10947726 3300025942 Unclassified 726
423 Ga0207661_10000594 3300025944 Bacteria 23140
424 Ga0207661_10024853 3300025944 Bacteria 4547
425 Ga0207661_10055980 3300025944 Bacteria 3165
426 Ga0207661_10483539 3300025944 Bacteria 1130
427 Ga0207661_10825437 3300025944 Bacteria 853
428 Ga0207679_10029988 3300025945 Bacteria 3793
429 Ga0207679_10058482 3300025945 Bacteria 2857
430 Ga0207667_10000033 3300025949 Bacteria 314353
431 Ga0207667_10003946 3300025949 Bacteria 18252
432 Ga0207667_10005074 3300025949 Bacteria 16087
433 Ga0207667_10049705 3300025949 Bacteria 4427
434 Ga0207667_10272670 3300025949 Bacteria 1729
435 Ga0207651_10388041 3300025960 Bacteria 1185
436 Ga0207712_10012709 3300025961 Bacteria 5380
437 Ga0207712_10033324 3300025961 Bacteria 3482
438 Ga0207712_10221634 3300025961 Bacteria 1512
439 Ga0207668_10014555 3300025972 Bacteria 4870
440 Ga0207668_10433139 3300025972 Unclassified 1119
441 Ga0207668_10485214 3300025972 Bacteria 1061
442 Ga0207640_10242465 3300025981 Bacteria 1394
443 Ga0207658_10009682 3300025986 Bacteria 6539
444 Ga0207658_10014787 3300025986 Bacteria 5348
445 Ga0207658_10080772 3300025986 Bacteria 2491
446 Ga0207658_10265625 3300025986 Bacteria 1464
447 Ga0207677_10077921 3300026023 Unclassified 2365
448 Ga0207703_10250001 3300026035 Bacteria 1597
449 Ga0207703_11202853 3300026035 Bacteria 729
450 Ga0207639_10107675 3300026041 Unclassified 2264
451 Ga0207639_10142487 3300026041 Bacteria 1998
452 Ga0207639_10345740 3300026041 Bacteria 1327
453 Ga0207678_10063153 3300026067 Bacteria 3182
454 Ga0207708_10117756 3300026075 Bacteria 2068
455 Ga0207708_10211805 3300026075 Bacteria 1549
456 Ga0207708_10316367 3300026075 Bacteria 1273
457 Ga0207702_10015080 3300026078 Bacteria 6407
458 Ga0207702_10047023 3300026078 Unclassified 3634
459 Ga0207641_10000810 3300026088 Bacteria 33309
460 Ga0207641_10034431 3300026088 Unclassified 4214
461 Ga0207641_10052276 3300026088 Bacteria 3460
462 Ga0207641_10167177 3300026088 Unclassified 2004
463 Ga0207641_10717729 3300026088 Bacteria 985
464 Ga0207641_11212337 3300026088 Bacteria 754
465 Ga0207648_10389117 3300026089 Bacteria 1262
466 Ga0207648_10470486 3300026089 Bacteria 1147
467 Ga0207648_10747238 3300026089 Bacteria 908
468 Ga0207676_10006134 3300026095 Bacteria 8484
469 Ga0207676_10047204 3300026095 Bacteria 3336
470 Ga0207676_10082265 3300026095 Bacteria 2618
471 Ga0207676_10115724 3300026095 Bacteria 2252
472 Ga0207676_10325299 3300026095 Unclassified 1413
473 Ga0207676_10386747 3300026095 Bacteria 1304
474 Ga0207674_10001506 3300026116 Bacteria 30062
475 Ga0207674_10001732 3300026116 Bacteria 27879
476 Ga0207674_10002868 3300026116 Bacteria 21414
477 Ga0207674_10035062 3300026116 Bacteria 5238
478 Ga0207674_10069014 3300026116 Bacteria 3555
479 Ga0207674_10096123 3300026116 Bacteria 2948
480 Ga0207674_10097451 3300026116 Bacteria 2925
481 Ga0207674_10129640 3300026116 Bacteria 2486
482 Ga0207675_100024868 3300026118 Bacteria 5572
483 Ga0207675_100313401 3300026118 Bacteria 1530
484 Ga0207675_101586012 3300026118 Unclassified 675
485 Ga0207683_10343053 3300026121 Unclassified 1370
486 Ga0207683_10362331 3300026121 Bacteria 1331
487 Ga0207698_10001106 3300026142 Bacteria 15707
488 Ga0207698_10375805 3300026142 Unclassified 1350
489 Ga0207698_10420123 3300026142 Bacteria 1283
490 Ga0207698_10646958 3300026142 Bacteria 1047
491 Ga0268265_10051881 3300028380 Bacteria 3098
492 Ga0268265_10103754 3300028380 Unclassified 2303
493 Ga0268265_10228689 3300028380 Bacteria 1633
494 Ga0268265_10238768 3300028380 Bacteria 1602
495 Ga0268265_10787529 3300028380 Bacteria 926
496 Ga0268264_10000964 3300028381 Bacteria 29492
497 Ga0268264_10002457 3300028381 Bacteria 16284
498 Ga0268264_10003607 3300028381 Bacteria 13326
499 Ga0268264_10028665 3300028381 Bacteria 4556
500 Ga0268264_10219359 3300028381 Bacteria 1750
501 Ga0265334_10072708 3300028573 Bacteria 1278
502 Ga0307517_10000929 3300028786 Bacteria 49793
503 Ga0307515_10000003 3300028794 Bacteria 891317
504 Ga0307515_10130467 3300028794 Bacteria 2773
505 Ga0307515_10471874 3300028794 Bacteria 868
506 Ga0307511_10000614 3300030521 Bacteria 38191
507 Ga0265327_10102081 3300031251 Bacteria 1382
508 Ga0307513_10188040 3300031456 Bacteria 1920
509 Ga0307509_10322362 3300031507 Bacteria 1281
510 Ga0307408_100010828 3300031548 Bacteria 6017
511 Ga0307514_10209148 3300031649 Bacteria 1214
512 Ga0265314_10152171 3300031711 Bacteria 1417
513 Ga0307516_10725303 3300031730 Bacteria 652
514 Ga0307406_10193951 3300031901 Bacteria 1489
515 Ga0373959_0075057 3300034820 Bacteria 770
516 Ga0373959_0095244 3300034820 Bacteria 702
517 Ga0373931_0003397 3300035691 Bacteria 7144
518 Ga0373927_0015533 3300035695 Bacteria 5030
519 Ga0373937_0056344 3300036401 Bacteria 3610
520 Ga0373937_0137865 3300036401 Unclassified 2282
521 Ga0395899_0075983 3300037312 Bacteria 2453
522 Ga0395898_0095283 3300037466 Bacteria 2860
523 Ga0395905_0002338 3300037471 Bacteria 21140
524 Ga0395901_0002149 3300038443 Bacteria 20154
525 Ga0436365_1368300 3300039437 Bacteria 2432
526 Ga0436365_1626007 3300039437 Bacteria 4497
527 Ga0436363_1603773 3300039450 Bacteria 807
528 Ga0451807_2330222 3300041486 Bacteria 829
529 Ga0451853_0711190 3300041512 Bacteria 1031
530 Ga0451853_3830960 3300041512 Bacteria 670
531 Ga0439462_0031809 3300042015 Bacteria 1398
532 Ga0451577_0024368 3300042876 Bacteria 5506
533 Ga0466965_0144664 3300044683 Bacteria 1240
534 Ga0466964_0318510 3300044706 Bacteria 789
535 Ga0453684_0152006 3300044712 Bacteria 2749
536 Ga0453684_1051556 3300044712 Bacteria 863
537 Ga0451576_0110747 3300045051 Bacteria 2857
538 Ga0451576_0354112 3300045051 Bacteria 1537
539 Ga0495638_0000026 3300046460 Bacteria 347061
540 Ga0495638_0042957 3300046460 Bacteria 2854
541 Ga0495638_0160782 3300046460 Bacteria 1296
542 Ga0495606_0012352 3300046507 Bacteria 6859
543 Ga0495598_0288139 3300046537 Bacteria 618
544 Ga0495621_0030666 3300046539 Bacteria 1840
545 Ga0495649_0204106 3300046694 Bacteria 1026
546 Ga0495581_0307287 3300047315 Bacteria 927
547 Ga0495672_0016866 3300047320 Bacteria 4902
548 Ga0495686_0016274 3300047472 Bacteria 5047
549 Ga0495686_0056095 3300047472 Bacteria 2462
550 Ga0496101_0097179 3300048904 Bacteria 2199
551 Ga0496104_0000419 3300048907 Bacteria 37179
552 Ga0496108_0027390 3300048911 Bacteria 4706
553 Ga0496109_0590438 3300048912 Bacteria 1047
554 Ga0496109_0979114 3300048912 Unclassified 784
555 Ga0496110_0734886 3300048913 Bacteria 890
556 Ga0496110_1082245 3300048913 Bacteria 710
557 Ga0496112_0001542 3300048915 Bacteria 17787
558 Ga0496113_0125247 3300048916 Bacteria 2011
559 Ga0496114_0111444 3300048917 Bacteria 2345
560 Ga0501031_0063084 3300049568 Bacteria 2414
561 Ga0501031_0794827 3300049568 Unclassified 607
562 Ga0501032_0004292 3300049569 Bacteria 10761
563 Ga0501033_0000627 3300049570 Bacteria 32716
564 Ga0501034_0001088 3300049571 Bacteria 38356
565 Ga0501034_0009695 3300049571 Bacteria 10071
566 Ga0501034_0086883 3300049571 Bacteria 3127
567 Ga0501034_0337749 3300049571 Bacteria 1437
568 Ga0501036_0007064 3300049572 Bacteria 9137
569 Ga0501037_0013718 3300049573 Bacteria 5968
570 Ga0501037_0026900 3300049573 Bacteria 4249
571 Ga0501037_0110275 3300049573 Bacteria 1983
572 Ga0501038_0000577 3300049574 Bacteria 32475
573 Ga0501038_0004801 3300049574 Bacteria 12554
574 Ga0501038_0009748 3300049574 Bacteria 8807
575 Ga0501038_0030839 3300049574 Bacteria 4740
576 Ga0501039_0009994 3300049575 Bacteria 7234
577 Ga0501039_0014718 3300049575 Bacteria 5984
578 Ga0501039_0022751 3300049575 Bacteria 4809
579 Ga0501043_0003669 3300049579 Bacteria 12609
580 Ga0501043_0013535 3300049579 Bacteria 6383
581 Ga0501043_0032562 3300049579 Bacteria 4099
582 Ga0501046_0007091 3300049580 Bacteria 9865
583 Ga0501046_0009712 3300049580 Bacteria 8299
584 Ga0501046_0017963 3300049580 Bacteria 5894
585 Ga0501046_0240368 3300049580 Bacteria 1336
586 Ga0501047_0014150 3300049581 Bacteria 7581
587 Ga0501047_0018106 3300049581 Bacteria 6750
588 Ga0501047_0020717 3300049581 Bacteria 6315
589 Ga0501047_0028066 3300049581 Bacteria 5424
590 Ga0501047_0652651 3300049581 Bacteria 871
591 Ga0501048_0005701 3300049582 Bacteria 9464
592 Ga0501048_0086557 3300049582 Bacteria 2210
593 Ga0501067_0035807 3300049583 Bacteria 2756
594 Ga0501067_0082392 3300049583 Bacteria 1784
595 Ga0501068_0004766 3300049584 Bacteria 7380
596 Ga0501068_0019069 3300049584 Bacteria 3976
597 Ga0501068_0020895 3300049584 Bacteria 3820
598 Ga0501069_0070717 3300049585 Bacteria 1955
599 Ga0501070_0002240 3300049586 Bacteria 16989
600 Ga0501070_0008598 3300049586 Bacteria 8632
601 Ga0501072_0113928 3300049588 Bacteria 2153
602 Ga0501073_0004775 3300049589 Bacteria 10169
603 Ga0501073_0032708 3300049589 Bacteria 3707
604 Ga0501074_0018022 3300049590 Bacteria 5129
605 Ga0501074_0226366 3300049590 Bacteria 1331
606 Ga0501079_0002785 3300049741 Bacteria 12749
607 Ga0501079_0029449 3300049741 Bacteria 4215
608 Ga0501080_0005359 3300049742 Bacteria 11432
609 Ga0501080_0020251 3300049742 Bacteria 6157
610 Ga0501080_0029063 3300049742 Bacteria 5145
611 Ga0501083_0008572 3300049744 Bacteria 7214
612 Ga0501083_0018399 3300049744 Bacteria 4869
613 Ga0501083_0043986 3300049744 Bacteria 3023
614 Ga0501083_0105756 3300049744 Bacteria 1853
615 Ga0501035_0003663 3300049822 Bacteria 14650
616 Ga0501035_0005157 3300049822 Bacteria 12358
617 Ga0501044_0004013 3300049823 Bacteria 16494
618 Ga0501044_0059544 3300049823 Bacteria 3912
619 Ga0501045_0024310 3300049824 Bacteria 4349
620 nmdc:mga0k408_63260_c1 3300050493 Unclassified 2152
621 nmdc:mga05p37_605_c1 3300050507 Bacteria 16464
622 nmdc:mga05p37_75664_c1 3300050507 Bacteria 4144
623 nmdc:mga09592_186052_c1 3300050508 Bacteria 1797
624 nmdc:mga09592_2761_c1 3300050508 Bacteria 14203
625 nmdc:mga06r32_601323_c1 3300050510 Bacteria 1071
626 nmdc:mga08y16_633663_c1 3300050511 Bacteria 1075
627 nmdc:mga0n895_296114_c1 3300050512 Bacteria 1640
628 nmdc:mga08x19_569725_c1 3300050514 Bacteria 802
629 Ga0500646_0011717 3300053090 Bacteria 2258
630 Ga0500583_0000029 3300053092 Bacteria 107304
631 Ga0500583_0000269 3300053092 Bacteria 18413
632 Ga0500651_0270802 3300053093 Bacteria 982
633 Ga0500557_001819 3300053105 Bacteria 3671
634 Ga0500594_0051311 3300053118 Unclassified 1163
635 Ga0500652_050463 3300053131 Bacteria 1698
636 Ga0500616_0000004 3300053153 Bacteria 1002714
637 Ga0500622_0080737 3300053156 Unclassified 1628
638 Ga0500622_0223565 3300053156 Bacteria 842
639 Ga0500622_0250796 3300053156 Unclassified 777
640 Ga0500633_0002655 3300053160 Bacteria 3730
641 Ga0500611_000021 3300053727 Bacteria 102395
642 Ga0501084_0020633 3300054114 Bacteria 5495
643 Ga0501084_0023937 3300054114 Bacteria 5095
644 Ga0501084_0517859 3300054114 Bacteria 1008
645 Ga0501082_0004933 3300060353 Bacteria 11644
646 Ga0501082_0005505 3300060353 Bacteria 10990
647 Ga0501082_0032446 3300060353 Bacteria 4504
648 Ga0501082_0799325 3300060353 Unclassified 825
649 Ga0501082_0840014 3300060353 Bacteria 803
650 Ga0501082_1315584 3300060353 Bacteria 631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10102081 Ga0265327_101020811 159
2 3300013104 Ga0157370_10859523 Ga0157370_108595232 162
3 3300044683 Ga0466965_0144664 Ga0466965_0144664_725_1225 166
4 3300013307 Ga0157372_10960168 Ga0157372_109601681 169
5 iso_pu_bacteria 2738541278 2738730185 170
6 3300005290 Ga0065712_10127103 Ga0065712_101271032 172
7 3300005329 Ga0070683_100090327 Ga0070683_1000903274 172
8 3300005340 Ga0070689_100301814 Ga0070689_1003018142 172
9 3300005344 Ga0070661_100555838 Ga0070661_1005558382 172
10 3300005535 Ga0070684_100006504 Ga0070684_1000065042 172
11 3300005618 Ga0068864_100042409 Ga0068864_1000424094 172
12 3300005841 Ga0068863_101490501 Ga0068863_1014905011 172
13 3300006847 Ga0075431_100599616 Ga0075431_1005996161 172
14 3300009147 Ga0114129_10020177 Ga0114129_100201775 172
15 3300009177 Ga0105248_10065115 Ga0105248_100651154 172
16 3300013307 Ga0157372_11641903 Ga0157372_116419031 172
17 3300013307 Ga0157372_11737660 Ga0157372_117376602 172
18 3300014325 Ga0163163_10051496 Ga0163163_100514964 172
19 3300025936 Ga0207670_10122140 Ga0207670_101221402 172
20 3300025944 Ga0207661_10024853 Ga0207661_100248536 172
21 3300026088 Ga0207641_11212337 Ga0207641_112123371 172
22 3300026095 Ga0207676_10082265 Ga0207676_100822652 172
23 3300034820 Ga0373959_0095244 Ga0373959_0095244_152_682 172
24 3300048911 Ga0496108_0027390 Ga0496108_0027390_1809_2393 172
25 3300048912 Ga0496109_0979114 Ga0496109_0979114_31_561 172
26 3300048915 Ga0496112_0001542 Ga0496112_0001542_10792_11376 172
27 3300048916 Ga0496113_0125247 Ga0496113_0125247_1267_1851 172
28 3300050508 nmdc:mga09592_186052_c1 nmdc:mga09592_186052_c1_414_995 172
29 3300050514 nmdc:mga08x19_569725_c1 nmdc:mga08x19_569725_c1_175_705 172
30 3300005341 Ga0070691_10054801 Ga0070691_100548012 173
31 3300005535 Ga0070684_100113457 Ga0070684_1001134572 173
32 3300005539 Ga0068853_100319869 Ga0068853_1003198692 173
33 3300005563 Ga0068855_101193908 Ga0068855_1011939082 173
34 3300005577 Ga0068857_100002714 Ga0068857_1000027144 173
35 3300005578 Ga0068854_100106137 Ga0068854_1001061372 173
36 3300005614 Ga0068856_100341440 Ga0068856_1003414402 173
37 3300005616 Ga0068852_100001075 Ga0068852_1000010752 173
38 3300009093 Ga0105240_10024023 Ga0105240_100240237 173
39 3300009551 Ga0105238_10014571 Ga0105238_100145713 173
40 3300009551 Ga0105238_10032553 Ga0105238_100325534 173
41 3300013104 Ga0157370_10004709 Ga0157370_100047093 173
42 3300013105 Ga0157369_10009675 Ga0157369_100096754 173
43 3300013307 Ga0157372_10003091 Ga0157372_100030915 173
44 3300013307 Ga0157372_10031599 Ga0157372_100315994 173
45 3300025904 Ga0207647_10038808 Ga0207647_100388082 173
46 3300025913 Ga0207695_10062162 Ga0207695_100621622 173
47 3300025914 Ga0207671_10659129 Ga0207671_106591291 173
48 3300025924 Ga0207694_10048749 Ga0207694_100487494 173
49 3300025924 Ga0207694_10225605 Ga0207694_102256052 173
50 3300025949 Ga0207667_10005074 Ga0207667_100050743 173
51 3300026041 Ga0207639_10107675 Ga0207639_101076752 173
52 3300026116 Ga0207674_10002868 Ga0207674_100028684 173
53 3300026142 Ga0207698_10001106 Ga0207698_100011065 173
54 3300036401 Ga0373937_0056344 Ga0373937_0056344_1017_1541 173
55 3300049588 Ga0501072_0113928 Ga0501072_0113928_318_848 173
56 3300001989 JGI24739J22299_10000668 JGI24739J22299_100006685 174
57 3300003215 JGI25153J46596_10017468 JGI25153J46596_100174683 174
58 3300003215 JGI25153J46596_10038746 JGI25153J46596_100387462 174
59 3300003316 rootH1_10026419 rootH1_100264193 174
60 3300003316 rootH1_10042500 rootH1_100425005 174
61 3300003316 rootH1_10114680 rootH1_101146802 174
62 3300003320 rootH2_10009135 rootH2_100091355 174
63 3300003320 rootH2_10198307 rootH2_101983073 174
64 3300003320 rootH2_10245760 rootH2_102457602 174
65 3300003322 rootL2_10009405 rootL2_100094057 174
66 3300003322 rootL2_10351884 rootL2_103518843 174
67 3300003323 rootH1_10013674 rootH1_1001367417 174
68 3300003323 rootH1_10023975 rootH1_100239753 174
69 3300003323 rootH1_10059108 rootH1_100591086 174
70 3300003771 Ga0055526_1001778 Ga0055526_100177813 174
71 3300003790 Ga0055528_1005387 Ga0055528_10053873 174
72 3300005262 Ga0065165_1000743 Ga0065165_100074319 174
73 3300005290 Ga0065712_10003429 Ga0065712_100034295 174
74 3300005290 Ga0065712_10203039 Ga0065712_102030392 174
75 3300005290 Ga0065712_10225445 Ga0065712_102254452 174
76 3300005293 Ga0065715_10541427 Ga0065715_105414272 174
77 3300005295 Ga0065707_10127293 Ga0065707_101272932 174
78 3300005295 Ga0065707_10151855 Ga0065707_101518552 174
79 3300005327 Ga0070658_10001806 Ga0070658_100018062 174
80 3300005327 Ga0070658_10158236 Ga0070658_101582362 174
81 3300005327 Ga0070658_10514692 Ga0070658_105146922 174
82 3300005327 Ga0070658_10669447 Ga0070658_106694472 174
83 3300005328 Ga0070676_10276686 Ga0070676_102766862 174
84 3300005329 Ga0070683_100070528 Ga0070683_1000705284 174
85 3300005329 Ga0070683_100088214 Ga0070683_1000882143 174
86 3300005329 Ga0070683_100138049 Ga0070683_1001380493 174
87 3300005329 Ga0070683_100249682 Ga0070683_1002496822 174
88 3300005329 Ga0070683_100359040 Ga0070683_1003590402 174
89 3300005330 Ga0070690_100141430 Ga0070690_1001414302 174
90 3300005330 Ga0070690_100200776 Ga0070690_1002007761 174
91 3300005331 Ga0070670_100001415 Ga0070670_1000014159 174
92 3300005331 Ga0070670_100008938 Ga0070670_1000089386 174
93 3300005331 Ga0070670_100392659 Ga0070670_1003926592 174
94 3300005333 Ga0070677_10216072 Ga0070677_102160722 174
95 3300005334 Ga0068869_100076231 Ga0068869_1000762312 174
96 3300005334 Ga0068869_100256049 Ga0068869_1002560492 174
97 3300005334 Ga0068869_100919473 Ga0068869_1009194731 174
98 3300005335 Ga0070666_10003698 Ga0070666_100036987 174
99 3300005335 Ga0070666_10039583 Ga0070666_100395832 174
100 3300005335 Ga0070666_10128998 Ga0070666_101289982 174
101 3300005335 Ga0070666_10289301 Ga0070666_102893012 174
102 3300005335 Ga0070666_10866922 Ga0070666_108669221 174
103 3300005336 Ga0070680_100003404 Ga0070680_1000034045 174
104 3300005336 Ga0070680_100031337 Ga0070680_1000313373 174
105 3300005336 Ga0070680_100055741 Ga0070680_1000557414 174
106 3300005336 Ga0070680_100652891 Ga0070680_1006528911 174
107 3300005337 Ga0070682_100001128 Ga0070682_10000112813 174
108 3300005337 Ga0070682_100526998 Ga0070682_1005269982 174
109 3300005338 Ga0068868_100141096 Ga0068868_1001410961 174
110 3300005338 Ga0068868_100298943 Ga0068868_1002989432 174
111 3300005339 Ga0070660_100216639 Ga0070660_1002166392 174
112 3300005339 Ga0070660_100332713 Ga0070660_1003327132 174
113 3300005340 Ga0070689_100050174 Ga0070689_1000501741 174
114 3300005340 Ga0070689_100066828 Ga0070689_1000668282 174
115 3300005343 Ga0070687_100096435 Ga0070687_1000964352 174
116 3300005343 Ga0070687_100289222 Ga0070687_1002892221 174
117 3300005343 Ga0070687_100585007 Ga0070687_1005850071 174
118 3300005344 Ga0070661_100016755 Ga0070661_1000167553 174
119 3300005344 Ga0070661_100038120 Ga0070661_1000381203 174
120 3300005344 Ga0070661_100237114 Ga0070661_1002371142 174
121 3300005345 Ga0070692_10001670 Ga0070692_100016705 174
122 3300005345 Ga0070692_10097663 Ga0070692_100976632 174
123 3300005345 Ga0070692_10115762 Ga0070692_101157622 174
124 3300005347 Ga0070668_100148853 Ga0070668_1001488533 174
125 3300005353 Ga0070669_100322897 Ga0070669_1003228972 174
126 3300005354 Ga0070675_100004691 Ga0070675_1000046913 174
127 3300005354 Ga0070675_100052533 Ga0070675_1000525331 174
128 3300005355 Ga0070671_100144489 Ga0070671_1001444891 174
129 3300005364 Ga0070673_101017855 Ga0070673_1010178551 174
130 3300005365 Ga0070688_100035907 Ga0070688_1000359072 174
131 3300005365 Ga0070688_100130147 Ga0070688_1001301471 174
132 3300005366 Ga0070659_100042032 Ga0070659_1000420322 174
133 3300005366 Ga0070659_100052576 Ga0070659_1000525763 174
134 3300005366 Ga0070659_100053468 Ga0070659_1000534684 174
135 3300005366 Ga0070659_100346043 Ga0070659_1003460432 174
136 3300005367 Ga0070667_100008784 Ga0070667_1000087846 174
137 3300005367 Ga0070667_100058481 Ga0070667_1000584813 174
138 3300005434 Ga0070709_10024768 Ga0070709_100247683 174
139 3300005434 Ga0070709_10268707 Ga0070709_102687072 174
140 3300005435 Ga0070714_100142792 Ga0070714_1001427922 174
141 3300005436 Ga0070713_100188096 Ga0070713_1001880962 174
142 3300005437 Ga0070710_10569378 Ga0070710_105693781 174
143 3300005438 Ga0070701_10424229 Ga0070701_104242292 174
144 3300005439 Ga0070711_100242038 Ga0070711_1002420381 174
145 3300005440 Ga0070705_100230921 Ga0070705_1002309211 174
146 3300005440 Ga0070705_100792472 Ga0070705_1007924721 174
147 3300005441 Ga0070700_100061976 Ga0070700_1000619763 174
148 3300005441 Ga0070700_100166894 Ga0070700_1001668942 174
149 3300005444 Ga0070694_100433733 Ga0070694_1004337332 174
150 3300005455 Ga0070663_100273411 Ga0070663_1002734112 174
151 3300005457 Ga0070662_100002433 Ga0070662_1000024334 174
152 3300005458 Ga0070681_10156267 Ga0070681_101562671 174
153 3300005458 Ga0070681_10218904 Ga0070681_102189043 174
154 3300005458 Ga0070681_10337431 Ga0070681_103374311 174
155 3300005459 Ga0068867_100215898 Ga0068867_1002158982 174
156 3300005459 Ga0068867_100394511 Ga0068867_1003945112 174
157 3300005459 Ga0068867_100416719 Ga0068867_1004167193 174
158 3300005466 Ga0070685_10001005 Ga0070685_1000100516 174
159 3300005466 Ga0070685_10120318 Ga0070685_101203182 174
160 3300005471 Ga0070698_100023211 Ga0070698_1000232117 174
161 3300005471 Ga0070698_100040970 Ga0070698_1000409706 174
162 3300005530 Ga0070679_100010932 Ga0070679_1000109325 174
163 3300005530 Ga0070679_100034334 Ga0070679_1000343344 174
164 3300005535 Ga0070684_100053367 Ga0070684_1000533673 174
165 3300005535 Ga0070684_100074361 Ga0070684_1000743611 174
166 3300005535 Ga0070684_100273642 Ga0070684_1002736423 174
167 3300005535 Ga0070684_100298304 Ga0070684_1002983042 174
168 3300005539 Ga0068853_100016505 Ga0068853_1000165053 174
169 3300005539 Ga0068853_100111264 Ga0068853_1001112644 174
170 3300005539 Ga0068853_100369617 Ga0068853_1003696172 174
171 3300005543 Ga0070672_100069878 Ga0070672_1000698783 174
172 3300005545 Ga0070695_100022307 Ga0070695_1000223073 174
173 3300005545 Ga0070695_100292577 Ga0070695_1002925772 174
174 3300005547 Ga0070693_100002364 Ga0070693_1000023641 174
175 3300005563 Ga0068855_100000060 Ga0068855_100000060129 174
176 3300005563 Ga0068855_100004484 Ga0068855_10000448418 174
177 3300005563 Ga0068855_100074144 Ga0068855_1000741444 174
178 3300005563 Ga0068855_100208820 Ga0068855_1002088201 174
179 3300005563 Ga0068855_100733134 Ga0068855_1007331342 174
180 3300005564 Ga0070664_100006042 Ga0070664_1000060422 174
181 3300005564 Ga0070664_100008429 Ga0070664_1000084293 174
182 3300005564 Ga0070664_100418596 Ga0070664_1004185962 174
183 3300005577 Ga0068857_100007359 Ga0068857_1000073596 174
184 3300005577 Ga0068857_100050563 Ga0068857_1000505633 174
185 3300005614 Ga0068856_100155654 Ga0068856_1001556542 174
186 3300005615 Ga0070702_100099664 Ga0070702_1000996642 174
187 3300005616 Ga0068852_100034415 Ga0068852_1000344151 174
188 3300005616 Ga0068852_100055730 Ga0068852_1000557307 174
189 3300005616 Ga0068852_100079183 Ga0068852_1000791832 174
190 3300005616 Ga0068852_100353299 Ga0068852_1003532992 174
191 3300005616 Ga0068852_100458491 Ga0068852_1004584913 174
192 3300005617 Ga0068859_100288969 Ga0068859_1002889692 174
193 3300005617 Ga0068859_100440802 Ga0068859_1004408023 174
194 3300005617 Ga0068859_101428209 Ga0068859_1014282091 174
195 3300005617 Ga0068859_101498598 Ga0068859_1014985982 174
196 3300005618 Ga0068864_100007549 Ga0068864_1000075492 174
197 3300005618 Ga0068864_100030994 Ga0068864_1000309944 174
198 3300005618 Ga0068864_100163633 Ga0068864_1001636333 174
199 3300005618 Ga0068864_100533394 Ga0068864_1005333941 174
200 3300005719 Ga0068861_100327784 Ga0068861_1003277842 174
201 3300005719 Ga0068861_101151723 Ga0068861_1011517231 174
202 3300005834 Ga0068851_10161827 Ga0068851_101618271 174
203 3300005834 Ga0068851_10186888 Ga0068851_101868882 174
204 3300005840 Ga0068870_10010422 Ga0068870_100104222 174
205 3300005841 Ga0068863_100002341 Ga0068863_1000023416 174
206 3300005841 Ga0068863_100013943 Ga0068863_1000139432 174
207 3300005841 Ga0068863_100056997 Ga0068863_1000569972 174
208 3300005841 Ga0068863_100206384 Ga0068863_1002063843 174
209 3300005841 Ga0068863_100222254 Ga0068863_1002222542 174
210 3300005841 Ga0068863_100267983 Ga0068863_1002679832 174
211 3300005841 Ga0068863_100300806 Ga0068863_1003008061 174
212 3300005842 Ga0068858_100176439 Ga0068858_1001764393 174
213 3300005843 Ga0068860_100001707 Ga0068860_10000170713 174
214 3300005843 Ga0068860_100005370 Ga0068860_10000537010 174
215 3300005843 Ga0068860_100007093 Ga0068860_1000070935 174
216 3300005843 Ga0068860_100044488 Ga0068860_1000444883 174
217 3300005843 Ga0068860_100162847 Ga0068860_1001628472 174
218 3300005843 Ga0068860_100486288 Ga0068860_1004862883 174
219 3300005843 Ga0068860_101033795 Ga0068860_1010337951 174
220 3300005844 Ga0068862_100018573 Ga0068862_1000185735 174
221 3300005844 Ga0068862_100020358 Ga0068862_1000203583 174
222 3300005844 Ga0068862_100179383 Ga0068862_1001793831 174
223 3300005937 Ga0081455_10039482 Ga0081455_100394823 174
224 3300005937 Ga0081455_10491735 Ga0081455_104917352 174
225 3300005985 Ga0081539_10004646 Ga0081539_100046467 174
226 3300006173 Ga0070716_100104716 Ga0070716_1001047162 174
227 3300006195 Ga0075366_10136747 Ga0075366_101367472 174
228 3300006195 Ga0075366_10182486 Ga0075366_101824861 174
229 3300006237 Ga0097621_100001243 Ga0097621_10000124320 174
230 3300006237 Ga0097621_100278979 Ga0097621_1002789792 174
231 3300006237 Ga0097621_100332618 Ga0097621_1003326182 174
232 3300006358 Ga0068871_100001056 Ga0068871_1000010562 174
233 3300006358 Ga0068871_100022666 Ga0068871_1000226664 174
234 3300006358 Ga0068871_100151578 Ga0068871_1001515783 174
235 3300006844 Ga0075428_100019466 Ga0075428_1000194662 174
236 3300006844 Ga0075428_100088757 Ga0075428_1000887572 174
237 3300006852 Ga0075433_11370241 Ga0075433_113702411 174
238 3300006880 Ga0075429_100000543 Ga0075429_1000005436 174
239 3300006880 Ga0075429_100695658 Ga0075429_1006956581 174
240 3300006881 Ga0068865_100320885 Ga0068865_1003208852 174
241 3300006931 Ga0097620_100288974 Ga0097620_1002889742 174
242 3300006931 Ga0097620_100440806 Ga0097620_1004408062 174
243 3300006931 Ga0097620_101428185 Ga0097620_1014281851 174
244 3300009093 Ga0105240_10002694 Ga0105240_100026944 174
245 3300009093 Ga0105240_10022198 Ga0105240_100221985 174
246 3300009093 Ga0105240_10302085 Ga0105240_103020852 174
247 3300009093 Ga0105240_10463407 Ga0105240_104634072 174
248 3300009093 Ga0105240_10742673 Ga0105240_107426732 174
249 3300009094 Ga0111539_10196595 Ga0111539_101965953 174
250 3300009098 Ga0105245_10036403 Ga0105245_100364033 174
251 3300009098 Ga0105245_10100557 Ga0105245_101005574 174
252 3300009098 Ga0105245_10341086 Ga0105245_103410862 174
253 3300009101 Ga0105247_10001522 Ga0105247_1000152212 174
254 3300009101 Ga0105247_10538580 Ga0105247_105385802 174
255 3300009147 Ga0114129_10009960 Ga0114129_100099603 174
256 3300009147 Ga0114129_10384946 Ga0114129_103849462 174
257 3300009174 Ga0105241_10682608 Ga0105241_106826081 174
258 3300009174 Ga0105241_11506635 Ga0105241_115066351 174
259 3300009176 Ga0105242_10002222 Ga0105242_1000222214 174
260 3300009176 Ga0105242_10008873 Ga0105242_100088732 174
261 3300009176 Ga0105242_10016049 Ga0105242_100160494 174
262 3300009176 Ga0105242_10018381 Ga0105242_100183814 174
263 3300009177 Ga0105248_10019425 Ga0105248_100194254 174
264 3300009177 Ga0105248_10292300 Ga0105248_102923001 174
265 3300009177 Ga0105248_10336221 Ga0105248_103362212 174
266 3300009177 Ga0105248_11027988 Ga0105248_110279882 174
267 3300009545 Ga0105237_10000510 Ga0105237_1000051022 174
268 3300009545 Ga0105237_10000671 Ga0105237_1000067142 174
269 3300009545 Ga0105237_10012785 Ga0105237_100127857 174
270 3300009545 Ga0105237_10040319 Ga0105237_100403191 174
271 3300009545 Ga0105237_10147075 Ga0105237_101470753 174
272 3300009545 Ga0105237_10254411 Ga0105237_102544112 174
273 3300009545 Ga0105237_10464791 Ga0105237_104647912 174
274 3300009553 Ga0105249_10010190 Ga0105249_100101904 174
275 3300009553 Ga0105249_10189368 Ga0105249_101893684 174
276 3300009553 Ga0105249_10195359 Ga0105249_101953593 174
277 3300009553 Ga0105249_10229989 Ga0105249_102299893 174
278 3300009553 Ga0105249_10336637 Ga0105249_103366372 174
279 3300010375 Ga0105239_10000017 Ga0105239_10000017112 174
280 3300010375 Ga0105239_10005627 Ga0105239_100056279 174
281 3300010375 Ga0105239_10014092 Ga0105239_100140922 174
282 3300010375 Ga0105239_10026291 Ga0105239_100262913 174
283 3300010375 Ga0105239_10034852 Ga0105239_100348524 174
284 3300010375 Ga0105239_10468776 Ga0105239_104687762 174
285 3300010375 Ga0105239_10742893 Ga0105239_107428933 174
286 3300010375 Ga0105239_10844384 Ga0105239_108443841 174
287 3300011119 Ga0105246_10474736 Ga0105246_104747362 174
288 3300013100 Ga0157373_10018597 Ga0157373_100185974 174
289 3300013100 Ga0157373_10132114 Ga0157373_101321143 174
290 3300013100 Ga0157373_10404523 Ga0157373_104045232 174
291 3300013102 Ga0157371_10008475 Ga0157371_100084753 174
292 3300013102 Ga0157371_10054622 Ga0157371_100546223 174
293 3300013102 Ga0157371_10152078 Ga0157371_101520783 174
294 3300013102 Ga0157371_10161997 Ga0157371_101619972 174
295 3300013102 Ga0157371_10669884 Ga0157371_106698841 174
296 3300013104 Ga0157370_10127132 Ga0157370_101271324 174
297 3300013104 Ga0157370_10533512 Ga0157370_105335122 174
298 3300013105 Ga0157369_10071553 Ga0157369_100715534 174
299 3300013105 Ga0157369_10127102 Ga0157369_101271024 174
300 3300013105 Ga0157369_10512730 Ga0157369_105127302 174
301 3300013105 Ga0157369_10971630 Ga0157369_109716301 174
302 3300013296 Ga0157374_10005226 Ga0157374_100052265 174
303 3300013296 Ga0157374_10467475 Ga0157374_104674752 174
304 3300013296 Ga0157374_10471311 Ga0157374_104713112 174
305 3300013296 Ga0157374_10983919 Ga0157374_109839192 174
306 3300013297 Ga0157378_10006930 Ga0157378_1000693011 174
307 3300013297 Ga0157378_10010437 Ga0157378_1001043711 174
308 3300013297 Ga0157378_10062311 Ga0157378_100623112 174
309 3300013306 Ga0163162_10001262 Ga0163162_1000126212 174
310 3300013306 Ga0163162_10045726 Ga0163162_100457263 174
311 3300013306 Ga0163162_10111389 Ga0163162_101113893 174
312 3300013306 Ga0163162_10684131 Ga0163162_106841312 174
313 3300013306 Ga0163162_10717936 Ga0163162_107179362 174
314 3300013306 Ga0163162_11573770 Ga0163162_115737701 174
315 3300013307 Ga0157372_10017350 Ga0157372_100173503 174
316 3300013307 Ga0157372_10035124 Ga0157372_100351242 174
317 3300013307 Ga0157372_10045621 Ga0157372_100456213 174
318 3300013307 Ga0157372_10224698 Ga0157372_102246983 174
319 3300013307 Ga0157372_10446768 Ga0157372_104467682 174
320 3300013307 Ga0157372_10829557 Ga0157372_108295571 174
321 3300013307 Ga0157372_10939531 Ga0157372_109395311 174
322 3300013307 Ga0157372_11403028 Ga0157372_114030281 174
323 3300013308 Ga0157375_10000749 Ga0157375_1000074922 174
324 3300013308 Ga0157375_10004593 Ga0157375_100045934 174
325 3300013308 Ga0157375_10034519 Ga0157375_100345192 174
326 3300013308 Ga0157375_10072815 Ga0157375_100728155 174
327 3300013308 Ga0157375_11704014 Ga0157375_117040141 174
328 3300014325 Ga0163163_10000494 Ga0163163_100004949 174
329 3300014325 Ga0163163_10031353 Ga0163163_100313533 174
330 3300014325 Ga0163163_10178674 Ga0163163_101786742 174
331 3300014325 Ga0163163_10345214 Ga0163163_103452142 174
332 3300014325 Ga0163163_10787281 Ga0163163_107872812 174
333 3300014326 Ga0157380_10016089 Ga0157380_100160895 174
334 3300014326 Ga0157380_10024856 Ga0157380_100248562 174
335 3300014326 Ga0157380_10063975 Ga0157380_100639752 174
336 3300014326 Ga0157380_10830028 Ga0157380_108300282 174
337 3300014326 Ga0157380_11912065 Ga0157380_119120651 174
338 3300014745 Ga0157377_10035528 Ga0157377_100355282 174
339 3300014745 Ga0157377_10270198 Ga0157377_102701982 174
340 3300014968 Ga0157379_10106881 Ga0157379_101068812 174
341 3300014969 Ga0157376_10000597 Ga0157376_1000059711 174
342 3300014969 Ga0157376_10024302 Ga0157376_100243021 174
343 3300014969 Ga0157376_10067800 Ga0157376_100678004 174
344 3300015262 Ga0182007_10029863 Ga0182007_100298632 174
345 3300015262 Ga0182007_10147835 Ga0182007_101478352 174
346 3300017792 Ga0163161_10001497 Ga0163161_1000149711 174
347 3300017792 Ga0163161_10058586 Ga0163161_100585864 174
348 3300025261 Ga0209233_1011331 Ga0209233_10113312 174
349 3300025272 Ga0209455_1004066 Ga0209455_10040663 174
350 3300025273 Ga0209673_1000438 Ga0209673_100043824 174
351 3300025295 Ga0209564_1000606 Ga0209564_100060616 174
352 3300025295 Ga0209564_1003267 Ga0209564_100326713 174
353 3300025297 Ga0209758_1003210 Ga0209758_100321015 174
354 3300025297 Ga0209758_1005303 Ga0209758_10053037 174
355 3300025298 Ga0209050_1000892 Ga0209050_100089233 174
356 3300025302 Ga0207426_1001400 Ga0207426_100140010 174
357 3300025302 Ga0207426_1007438 Ga0207426_10074385 174
358 3300025304 Ga0209257_1057924 Ga0209257_10579242 174
359 3300025315 Ga0207697_10048015 Ga0207697_100480152 174
360 3300025321 Ga0207656_10134494 Ga0207656_101344942 174
361 3300025321 Ga0207656_10137980 Ga0207656_101379801 174
362 3300025898 Ga0207692_10324150 Ga0207692_103241502 174
363 3300025900 Ga0207710_10011013 Ga0207710_100110134 174
364 3300025901 Ga0207688_10058063 Ga0207688_100580631 174
365 3300025903 Ga0207680_10016371 Ga0207680_100163712 174
366 3300025903 Ga0207680_10085108 Ga0207680_100851082 174
367 3300025903 Ga0207680_10089515 Ga0207680_100895152 174
368 3300025903 Ga0207680_10319878 Ga0207680_103198781 174
369 3300025904 Ga0207647_10124748 Ga0207647_101247481 174
370 3300025904 Ga0207647_10148085 Ga0207647_101480852 174
371 3300025904 Ga0207647_10257601 Ga0207647_102576011 174
372 3300025907 Ga0207645_10163199 Ga0207645_101631992 174
373 3300025908 Ga0207643_10009608 Ga0207643_100096083 174
374 3300025908 Ga0207643_10147201 Ga0207643_101472011 174
375 3300025908 Ga0207643_10550565 Ga0207643_105505651 174
376 3300025909 Ga0207705_10000623 Ga0207705_1000062317 174
377 3300025909 Ga0207705_10020019 Ga0207705_100200194 174
378 3300025909 Ga0207705_10025587 Ga0207705_100255875 174
379 3300025911 Ga0207654_10434925 Ga0207654_104349252 174
380 3300025912 Ga0207707_10043800 Ga0207707_100438002 174
381 3300025912 Ga0207707_10046354 Ga0207707_100463541 174
382 3300025912 Ga0207707_10329093 Ga0207707_103290933 174
383 3300025913 Ga0207695_10021713 Ga0207695_100217136 174
384 3300025913 Ga0207695_10344723 Ga0207695_103447232 174
385 3300025914 Ga0207671_10006613 Ga0207671_1000661310 174
386 3300025914 Ga0207671_10007833 Ga0207671_100078339 174
387 3300025914 Ga0207671_10008101 Ga0207671_100081014 174
388 3300025914 Ga0207671_10017382 Ga0207671_100173822 174
389 3300025914 Ga0207671_10141186 Ga0207671_101411862 174
390 3300025914 Ga0207671_10675301 Ga0207671_106753011 174
391 3300025914 Ga0207671_10744430 Ga0207671_107444301 174
392 3300025916 Ga0207663_10878754 Ga0207663_108787541 174
393 3300025917 Ga0207660_10171748 Ga0207660_101717481 174
394 3300025917 Ga0207660_10172569 Ga0207660_101725692 174
395 3300025917 Ga0207660_10278106 Ga0207660_102781062 174
396 3300025917 Ga0207660_10632361 Ga0207660_106323612 174
397 3300025918 Ga0207662_10054656 Ga0207662_100546563 174
398 3300025918 Ga0207662_10097097 Ga0207662_100970972 174
399 3300025918 Ga0207662_10167762 Ga0207662_101677622 174
400 3300025918 Ga0207662_10942984 Ga0207662_109429841 174
401 3300025919 Ga0207657_10035305 Ga0207657_100353055 174
402 3300025919 Ga0207657_10037298 Ga0207657_100372984 174
403 3300025919 Ga0207657_10114906 Ga0207657_101149063 174
404 3300025920 Ga0207649_10009530 Ga0207649_100095303 174
405 3300025920 Ga0207649_10105595 Ga0207649_101055952 174
406 3300025920 Ga0207649_10217756 Ga0207649_102177562 174
407 3300025920 Ga0207649_10638055 Ga0207649_106380551 174
408 3300025921 Ga0207652_10663297 Ga0207652_106632971 174
409 3300025921 Ga0207652_10785280 Ga0207652_107852802 174
410 3300025923 Ga0207681_10052429 Ga0207681_100524292 174
411 3300025923 Ga0207681_10265550 Ga0207681_102655502 174
412 3300025924 Ga0207694_10375432 Ga0207694_103754322 174
413 3300025925 Ga0207650_10007105 Ga0207650_100071053 174
414 3300025925 Ga0207650_10038266 Ga0207650_100382662 174
415 3300025925 Ga0207650_10469988 Ga0207650_104699882 174
416 3300025925 Ga0207650_10525609 Ga0207650_105256091 174
417 3300025926 Ga0207659_11008834 Ga0207659_110088341 174
418 3300025927 Ga0207687_10067073 Ga0207687_100670733 174
419 3300025927 Ga0207687_10365474 Ga0207687_103654742 174
420 3300025928 Ga0207700_10131531 Ga0207700_101315311 174
421 3300025929 Ga0207664_10617332 Ga0207664_106173322 174
422 3300025932 Ga0207690_10033132 Ga0207690_100331323 174
423 3300025932 Ga0207690_10204691 Ga0207690_102046912 174
424 3300025932 Ga0207690_10251349 Ga0207690_102513492 174
425 3300025933 Ga0207706_10015151 Ga0207706_100151514 174
426 3300025933 Ga0207706_10105001 Ga0207706_101050013 174
427 3300025934 Ga0207686_10003705 Ga0207686_1000370510 174
428 3300025934 Ga0207686_10011836 Ga0207686_100118363 174
429 3300025934 Ga0207686_10015383 Ga0207686_100153832 174
430 3300025936 Ga0207670_10189647 Ga0207670_101896472 174
431 3300025936 Ga0207670_10862016 Ga0207670_108620161 174
432 3300025940 Ga0207691_10050906 Ga0207691_100509066 174
433 3300025940 Ga0207691_10145862 Ga0207691_101458624 174
434 3300025940 Ga0207691_10375299 Ga0207691_103752992 174
435 3300025940 Ga0207691_10508998 Ga0207691_105089981 174
436 3300025941 Ga0207711_10021893 Ga0207711_100218935 174
437 3300025941 Ga0207711_10801674 Ga0207711_108016742 174
438 3300025942 Ga0207689_10057603 Ga0207689_100576032 174
439 3300025942 Ga0207689_10350294 Ga0207689_103502942 174
440 3300025942 Ga0207689_10947726 Ga0207689_109477262 174
441 3300025944 Ga0207661_10000594 Ga0207661_100005945 174
442 3300025944 Ga0207661_10055980 Ga0207661_100559804 174
443 3300025944 Ga0207661_10483539 Ga0207661_104835392 174
444 3300025944 Ga0207661_10825437 Ga0207661_108254372 174
445 3300025945 Ga0207679_10029988 Ga0207679_100299883 174
446 3300025945 Ga0207679_10058482 Ga0207679_100584821 174
447 3300025949 Ga0207667_10000033 Ga0207667_10000033161 174
448 3300025949 Ga0207667_10003946 Ga0207667_1000394618 174
449 3300025949 Ga0207667_10049705 Ga0207667_100497054 174
450 3300025949 Ga0207667_10272670 Ga0207667_102726701 174
451 3300025960 Ga0207651_10388041 Ga0207651_103880411 174
452 3300025961 Ga0207712_10012709 Ga0207712_100127096 174
453 3300025961 Ga0207712_10033324 Ga0207712_100333243 174
454 3300025961 Ga0207712_10221634 Ga0207712_102216342 174
455 3300025972 Ga0207668_10014555 Ga0207668_100145553 174
456 3300025972 Ga0207668_10433139 Ga0207668_104331392 174
457 3300025972 Ga0207668_10485214 Ga0207668_104852141 174
458 3300025981 Ga0207640_10242465 Ga0207640_102424652 174
459 3300025986 Ga0207658_10009682 Ga0207658_100096826 174
460 3300025986 Ga0207658_10014787 Ga0207658_100147877 174
461 3300025986 Ga0207658_10080772 Ga0207658_100807722 174
462 3300025986 Ga0207658_10265625 Ga0207658_102656252 174
463 3300026023 Ga0207677_10077921 Ga0207677_100779213 174
464 3300026035 Ga0207703_10250001 Ga0207703_102500012 174
465 3300026035 Ga0207703_11202853 Ga0207703_112028531 174
466 3300026041 Ga0207639_10142487 Ga0207639_101424871 174
467 3300026041 Ga0207639_10345740 Ga0207639_103457402 174
468 3300026067 Ga0207678_10063153 Ga0207678_100631531 174
469 3300026075 Ga0207708_10117756 Ga0207708_101177562 174
470 3300026075 Ga0207708_10211805 Ga0207708_102118052 174
471 3300026075 Ga0207708_10316367 Ga0207708_103163672 174
472 3300026078 Ga0207702_10015080 Ga0207702_100150805 174
473 3300026078 Ga0207702_10047023 Ga0207702_100470232 174
474 3300026088 Ga0207641_10000810 Ga0207641_1000081018 174
475 3300026088 Ga0207641_10034431 Ga0207641_100344316 174
476 3300026088 Ga0207641_10052276 Ga0207641_100522762 174
477 3300026088 Ga0207641_10167177 Ga0207641_101671772 174
478 3300026088 Ga0207641_10717729 Ga0207641_107177292 174
479 3300026089 Ga0207648_10389117 Ga0207648_103891171 174
480 3300026089 Ga0207648_10470486 Ga0207648_104704862 174
481 3300026089 Ga0207648_10747238 Ga0207648_107472381 174
482 3300026095 Ga0207676_10006134 Ga0207676_100061347 174
483 3300026095 Ga0207676_10047204 Ga0207676_100472043 174
484 3300026095 Ga0207676_10115724 Ga0207676_101157243 174
485 3300026095 Ga0207676_10325299 Ga0207676_103252992 174
486 3300026095 Ga0207676_10386747 Ga0207676_103867472 174
487 3300026116 Ga0207674_10001506 Ga0207674_1000150611 174
488 3300026116 Ga0207674_10001732 Ga0207674_1000173220 174
489 3300026116 Ga0207674_10035062 Ga0207674_100350624 174
490 3300026116 Ga0207674_10069014 Ga0207674_100690142 174
491 3300026116 Ga0207674_10096123 Ga0207674_100961232 174
492 3300026116 Ga0207674_10097451 Ga0207674_100974514 174
493 3300026116 Ga0207674_10129640 Ga0207674_101296403 174
494 3300026118 Ga0207675_100024868 Ga0207675_1000248686 174
495 3300026118 Ga0207675_100313401 Ga0207675_1003134012 174
496 3300026118 Ga0207675_101586012 Ga0207675_1015860121 174
497 3300026121 Ga0207683_10343053 Ga0207683_103430531 174
498 3300026121 Ga0207683_10362331 Ga0207683_103623311 174
499 3300026142 Ga0207698_10375805 Ga0207698_103758052 174
500 3300026142 Ga0207698_10420123 Ga0207698_104201232 174
501 3300026142 Ga0207698_10646958 Ga0207698_106469582 174
502 3300028380 Ga0268265_10051881 Ga0268265_100518813 174
503 3300028380 Ga0268265_10103754 Ga0268265_101037543 174
504 3300028380 Ga0268265_10228689 Ga0268265_102286891 174
505 3300028380 Ga0268265_10238768 Ga0268265_102387681 174
506 3300028380 Ga0268265_10787529 Ga0268265_107875292 174
507 3300028381 Ga0268264_10000964 Ga0268264_100009646 174
508 3300028381 Ga0268264_10002457 Ga0268264_1000245716 174
509 3300028381 Ga0268264_10003607 Ga0268264_100036074 174
510 3300028381 Ga0268264_10028665 Ga0268264_100286652 174
511 3300028381 Ga0268264_10219359 Ga0268264_102193592 174
512 3300028573 Ga0265334_10072708 Ga0265334_100727082 174
513 3300028786 Ga0307517_10000929 Ga0307517_1000092945 174
514 3300028794 Ga0307515_10000003 Ga0307515_10000003188 174
515 3300028794 Ga0307515_10130467 Ga0307515_101304673 174
516 3300028794 Ga0307515_10471874 Ga0307515_104718741 174
517 3300030521 Ga0307511_10000614 Ga0307511_1000061412 174
518 3300031456 Ga0307513_10188040 Ga0307513_101880402 174
519 3300031507 Ga0307509_10322362 Ga0307509_103223622 174
520 3300031548 Ga0307408_100010828 Ga0307408_1000108287 174
521 3300031649 Ga0307514_10209148 Ga0307514_102091482 174
522 3300031711 Ga0265314_10152171 Ga0265314_101521712 174
523 3300031730 Ga0307516_10725303 Ga0307516_107253031 174
524 3300031901 Ga0307406_10193951 Ga0307406_101939513 174
525 3300034820 Ga0373959_0075057 Ga0373959_0075057_148_714 174
526 3300035691 Ga0373931_0003397 Ga0373931_0003397_3654_4205 174
527 3300035695 Ga0373927_0015533 Ga0373927_0015533_403_963 174
528 3300036401 Ga0373937_0137865 Ga0373937_0137865_1279_1836 174
529 3300037312 Ga0395899_0075983 Ga0395899_0075983_1297_1860 174
530 3300037466 Ga0395898_0095283 Ga0395898_0095283_336_899 174
531 3300037471 Ga0395905_0002338 Ga0395905_0002338_7317_7880 174
532 3300038443 Ga0395901_0002149 Ga0395901_0002149_12220_12783 174
533 3300039437 Ga0436365_1368300 Ga0436365_1368300_632_1168 174
534 3300039437 Ga0436365_1626007 Ga0436365_1626007_3170_3850 174
535 3300039450 Ga0436363_1603773 Ga0436363_1603773_38_637 174
536 3300041486 Ga0451807_2330222 Ga0451807_2330222_98_661 174
537 3300041512 Ga0451853_0711190 Ga0451853_0711190_409_966 174
538 3300041512 Ga0451853_3830960 Ga0451853_3830960_100_627 174
539 3300042015 Ga0439462_0031809 Ga0439462_0031809_221_787 174
540 3300042876 Ga0451577_0024368 Ga0451577_0024368_999_1559 174
541 3300044706 Ga0466964_0318510 Ga0466964_0318510_116_673 174
542 3300044712 Ga0453684_0152006 Ga0453684_0152006_1497_2057 174
543 3300044712 Ga0453684_1051556 Ga0453684_1051556_69_629 174
544 3300045051 Ga0451576_0110747 Ga0451576_0110747_2023_2583 174
545 3300045051 Ga0451576_0354112 Ga0451576_0354112_421_981 174
546 3300046460 Ga0495638_0000026 Ga0495638_0000026_110574_111128 174
547 3300046460 Ga0495638_0042957 Ga0495638_0042957_1552_2112 174
548 3300046460 Ga0495638_0160782 Ga0495638_0160782_582_1106 174
549 3300046507 Ga0495606_0012352 Ga0495606_0012352_143_703 174
550 3300046537 Ga0495598_0288139 Ga0495598_0288139_26_595 174
551 3300046539 Ga0495621_0030666 Ga0495621_0030666_1180_1707 174
552 3300046694 Ga0495649_0204106 Ga0495649_0204106_55_579 174
553 3300047315 Ga0495581_0307287 Ga0495581_0307287_367_900 174
554 3300047320 Ga0495672_0016866 Ga0495672_0016866_2601_3161 174
555 3300047472 Ga0495686_0016274 Ga0495686_0016274_175_738 174
556 3300047472 Ga0495686_0056095 Ga0495686_0056095_1889_2452 174
557 3300048904 Ga0496101_0097179 Ga0496101_0097179_722_1300 174
558 3300048907 Ga0496104_0000419 Ga0496104_0000419_6248_6805 174
559 3300048912 Ga0496109_0590438 Ga0496109_0590438_275_808 174
560 3300048913 Ga0496110_0734886 Ga0496110_0734886_341_865 174
561 3300048913 Ga0496110_1082245 Ga0496110_1082245_99_665 174
562 3300048917 Ga0496114_0111444 Ga0496114_0111444_960_1538 174
563 3300049568 Ga0501031_0063084 Ga0501031_0063084_156_722 174
564 3300049568 Ga0501031_0794827 Ga0501031_0794827_32_589 174
565 3300049569 Ga0501032_0004292 Ga0501032_0004292_3804_4370 174
566 3300049570 Ga0501033_0000627 Ga0501033_0000627_20702_21268 174
567 3300049571 Ga0501034_0001088 Ga0501034_0001088_812_1384 174
568 3300049571 Ga0501034_0009695 Ga0501034_0009695_1767_2333 174
569 3300049571 Ga0501034_0086883 Ga0501034_0086883_819_1409 174
570 3300049571 Ga0501034_0337749 Ga0501034_0337749_777_1334 174
571 3300049572 Ga0501036_0007064 Ga0501036_0007064_1104_1670 174
572 3300049573 Ga0501037_0013718 Ga0501037_0013718_1693_2259 174
573 3300049573 Ga0501037_0026900 Ga0501037_0026900_3389_3979 174
574 3300049573 Ga0501037_0110275 Ga0501037_0110275_450_1022 174
575 3300049574 Ga0501038_0000577 Ga0501038_0000577_6911_7483 174
576 3300049574 Ga0501038_0004801 Ga0501038_0004801_1761_2327 174
577 3300049574 Ga0501038_0009748 Ga0501038_0009748_527_1060 174
578 3300049574 Ga0501038_0030839 Ga0501038_0030839_899_1489 174
579 3300049575 Ga0501039_0009994 Ga0501039_0009994_6327_6860 174
580 3300049575 Ga0501039_0014718 Ga0501039_0014718_141_713 174
581 3300049575 Ga0501039_0022751 Ga0501039_0022751_2493_3059 174
582 3300049579 Ga0501043_0003669 Ga0501043_0003669_1313_1879 174
583 3300049579 Ga0501043_0013535 Ga0501043_0013535_4999_5553 174
584 3300049579 Ga0501043_0032562 Ga0501043_0032562_2927_3517 174
585 3300049580 Ga0501046_0007091 Ga0501046_0007091_2480_3052 174
586 3300049580 Ga0501046_0009712 Ga0501046_0009712_5288_5821 174
587 3300049580 Ga0501046_0017963 Ga0501046_0017963_1611_2177 174
588 3300049580 Ga0501046_0240368 Ga0501046_0240368_409_1032 174
589 3300049581 Ga0501047_0014150 Ga0501047_0014150_6737_7303 174
590 3300049581 Ga0501047_0018106 Ga0501047_0018106_5367_5939 174
591 3300049581 Ga0501047_0020717 Ga0501047_0020717_2316_2870 174
592 3300049581 Ga0501047_0028066 Ga0501047_0028066_2895_3428 174
593 3300049581 Ga0501047_0652651 Ga0501047_0652651_24_590 174
594 3300049582 Ga0501048_0005701 Ga0501048_0005701_7795_8361 174
595 3300049582 Ga0501048_0086557 Ga0501048_0086557_185_757 174
596 3300049583 Ga0501067_0035807 Ga0501067_0035807_1916_2449 174
597 3300049583 Ga0501067_0082392 Ga0501067_0082392_1089_1655 174
598 3300049584 Ga0501068_0004766 Ga0501068_0004766_6781_7353 174
599 3300049584 Ga0501068_0019069 Ga0501068_0019069_2039_2605 174
600 3300049584 Ga0501068_0020895 Ga0501068_0020895_1805_2338 174
601 3300049585 Ga0501069_0070717 Ga0501069_0070717_702_1268 174
602 3300049586 Ga0501070_0002240 Ga0501070_0002240_14602_15192 174
603 3300049586 Ga0501070_0008598 Ga0501070_0008598_737_1303 174
604 3300049589 Ga0501073_0004775 Ga0501073_0004775_8772_9344 174
605 3300049589 Ga0501073_0032708 Ga0501073_0032708_1184_1717 174
606 3300049590 Ga0501074_0018022 Ga0501074_0018022_736_1326 174
607 3300049590 Ga0501074_0226366 Ga0501074_0226366_240_806 174
608 3300049741 Ga0501079_0002785 Ga0501079_0002785_1085_1651 174
609 3300049741 Ga0501079_0029449 Ga0501079_0029449_3379_3969 174
610 3300049742 Ga0501080_0005359 Ga0501080_0005359_3354_3926 174
611 3300049742 Ga0501080_0020251 Ga0501080_0020251_2285_2875 174
612 3300049742 Ga0501080_0029063 Ga0501080_0029063_706_1272 174
613 3300049744 Ga0501083_0008572 Ga0501083_0008572_4828_5418 174
614 3300049744 Ga0501083_0018399 Ga0501083_0018399_3589_4155 174
615 3300049744 Ga0501083_0043986 Ga0501083_0043986_2136_2690 174
616 3300049744 Ga0501083_0105756 Ga0501083_0105756_1032_1604 174
617 3300049822 Ga0501035_0003663 Ga0501035_0003663_6566_7138 174
618 3300049822 Ga0501035_0005157 Ga0501035_0005157_8676_9266 174
619 3300049823 Ga0501044_0004013 Ga0501044_0004013_6705_7277 174
620 3300049823 Ga0501044_0059544 Ga0501044_0059544_1561_2094 174
621 3300049824 Ga0501045_0024310 Ga0501045_0024310_1113_1679 174
622 3300050493 nmdc:mga0k408_63260_c1 nmdc:mga0k408_63260_c1_293_853 174
623 3300050507 nmdc:mga05p37_605_c1 nmdc:mga05p37_605_c1_4210_4770 174
624 3300050507 nmdc:mga05p37_75664_c1 nmdc:mga05p37_75664_c1_2841_3413 174
625 3300050508 nmdc:mga09592_2761_c1 nmdc:mga09592_2761_c1_7583_8155 174
626 3300050510 nmdc:mga06r32_601323_c1 nmdc:mga06r32_601323_c1_11_583 174
627 3300050511 nmdc:mga08y16_633663_c1 nmdc:mga08y16_633663_c1_292_858 174
628 3300050512 nmdc:mga0n895_296114_c1 nmdc:mga0n895_296114_c1_494_1027 174
629 3300053090 Ga0500646_0011717 Ga0500646_0011717_272_838 174
630 3300053092 Ga0500583_0000029 Ga0500583_0000029_62909_63475 174
631 3300053092 Ga0500583_0000269 Ga0500583_0000269_10238_10795 174
632 3300053093 Ga0500651_0270802 Ga0500651_0270802_42_602 174
633 3300053105 Ga0500557_001819 Ga0500557_001819_321_878 174
634 3300053118 Ga0500594_0051311 Ga0500594_0051311_147_704 174
635 3300053131 Ga0500652_050463 Ga0500652_050463_346_903 174
636 3300053153 Ga0500616_0000004 Ga0500616_0000004_127601_128158 174
637 3300053156 Ga0500622_0080737 Ga0500622_0080737_918_1472 174
638 3300053156 Ga0500622_0223565 Ga0500622_0223565_20_544 174
639 3300053156 Ga0500622_0250796 Ga0500622_0250796_61_618 174
640 3300053160 Ga0500633_0002655 Ga0500633_0002655_2733_3257 174
641 3300053727 Ga0500611_000021 Ga0500611_000021_85047_85571 174
642 3300054114 Ga0501084_0020633 Ga0501084_0020633_837_1391 174
643 3300054114 Ga0501084_0023937 Ga0501084_0023937_3144_3734 174
644 3300054114 Ga0501084_0517859 Ga0501084_0517859_92_658 174
645 3300060353 Ga0501082_0004933 Ga0501082_0004933_4888_5478 174
646 3300060353 Ga0501082_0005505 Ga0501082_0005505_5407_5979 174
647 3300060353 Ga0501082_0032446 Ga0501082_0032446_1842_2375 174
648 3300060353 Ga0501082_0799325 Ga0501082_0799325_177_794 174
649 3300060353 Ga0501082_0840014 Ga0501082_0840014_254_787 174
650 3300060353 Ga0501082_1315584 Ga0501082_1315584_13_579 174
651 iso_pu_bacteria 2929921140 2929921193 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

35

206

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8596 33 173
3ei0-assembly1.cif.gz_C structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic) 0.8414 149 172
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8175 3 171
3uu3-assembly1.cif.gz_D the glic pentameric ligand-gated ion channel loop2-20' oxidized mutant in a locally-closed conformation (lc1 subtype) 0.8105 149 172
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8008 3 174
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8569 33 174 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8141 3 171 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8067 1 171 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7891 3 174 3.40.430.10
af_Q5JKW4_92_204_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.7843 153 173 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A4Q3WB29-F1-model_v4 Dihydrofolate reductase 0.9712 51 174 GO:0008703
GO:0009231
AF-A0A370ERS3-F1-model_v4 RibD domain-containing protein 0.9455 109 173 GO:0008703
GO:0009231
AF-A0A098BX07-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9276 46 174 GO:0008703
GO:0009231
AF-A0A6P1WA70-F1-model_v4 Dihydrofolate reductase 0.9262 1 174 GO:0008703
GO:0009231
AF-A4SR96-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9229 35 174 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
81.54 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map